data_9CY8 # _entry.id 9CY8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.400 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9CY8 pdb_00009cy8 10.2210/pdb9cy8/pdb WWPDB D_1000286927 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-12-25 2 'Structure model' 1 1 2025-01-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' entity_src_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_entity_src_gen.gene_src_common_name' 5 2 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 6 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9CY8 _pdbx_database_status.recvd_initial_deposition_date 2024-08-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 3 _pdbx_contact_author.email maurizio.pellecchia@ucr.edu _pdbx_contact_author.name_first Maurizio _pdbx_contact_author.name_last Pellecchia _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5179-470X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Muzzarelli, K.M.' 1 0000-0003-1488-0750 'Assar, Z.' 2 0000-0001-6008-6203 'Prentis, A.M.' 3 ? 'Baggio, C.' 4 ? 'Pellecchia, M.' 5 0000-0001-5179-470X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 67 _citation.language ? _citation.page_first 22245 _citation.page_last 22253 _citation.title 'Constrained beta-Hairpins Targeting the EphA4 Ligand Binding Domain.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.4c02286 _citation.pdbx_database_id_PubMed 39656022 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Prentiss, A.M.' 1 ? primary 'Baggio, C.' 2 ? primary 'Pagett, J.' 3 ? primary 'Kulinich, A.O.' 4 ? primary 'Ethell, I.M.' 5 ? primary 'Muzzarelli, K.' 6 ? primary 'Assar, Z.' 7 ? primary 'Pellecchia, M.' 8 0000-0001-5179-470X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ephrin type-A receptor 4' 21259.100 1 2.7.10.1 ? ? ? 2 polymer syn 'Constrained b-hairpin' 1518.737 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 51 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'EPH-like kinase 8,EK8,hEK8,Tyrosine-protein kinase TYRO1,Tyrosine-protein kinase receptor SEK' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFT LRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLA FQDVGACIALVSVRVFYKKAPLTVR ; ;GSHMNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFT LRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLA FQDVGACIALVSVRVFYKKAPLTVR ; A ? 2 'polypeptide(L)' no yes '(BAL)PY(NLE)VYR(A1A0X)EWSP(NH2)' XPYLVYRXEWSPX B ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ASN n 1 6 GLU n 1 7 VAL n 1 8 THR n 1 9 LEU n 1 10 LEU n 1 11 ASP n 1 12 SER n 1 13 ARG n 1 14 SER n 1 15 VAL n 1 16 GLN n 1 17 GLY n 1 18 GLU n 1 19 LEU n 1 20 GLY n 1 21 TRP n 1 22 ILE n 1 23 ALA n 1 24 SER n 1 25 PRO n 1 26 LEU n 1 27 GLU n 1 28 GLY n 1 29 GLY n 1 30 TRP n 1 31 GLU n 1 32 GLU n 1 33 VAL n 1 34 SER n 1 35 ILE n 1 36 MET n 1 37 ASP n 1 38 GLU n 1 39 LYS n 1 40 ASN n 1 41 THR n 1 42 PRO n 1 43 ILE n 1 44 ARG n 1 45 THR n 1 46 TYR n 1 47 GLN n 1 48 VAL n 1 49 CYS n 1 50 ASN n 1 51 VAL n 1 52 MET n 1 53 GLU n 1 54 PRO n 1 55 SER n 1 56 GLN n 1 57 ASN n 1 58 ASN n 1 59 TRP n 1 60 LEU n 1 61 ARG n 1 62 THR n 1 63 ASP n 1 64 TRP n 1 65 ILE n 1 66 THR n 1 67 ARG n 1 68 GLU n 1 69 GLY n 1 70 ALA n 1 71 GLN n 1 72 ARG n 1 73 VAL n 1 74 TYR n 1 75 ILE n 1 76 GLU n 1 77 ILE n 1 78 LYS n 1 79 PHE n 1 80 THR n 1 81 LEU n 1 82 ARG n 1 83 ASP n 1 84 CYS n 1 85 ASN n 1 86 SER n 1 87 LEU n 1 88 PRO n 1 89 GLY n 1 90 VAL n 1 91 MET n 1 92 GLY n 1 93 THR n 1 94 CYS n 1 95 LYS n 1 96 GLU n 1 97 THR n 1 98 PHE n 1 99 ASN n 1 100 LEU n 1 101 TYR n 1 102 TYR n 1 103 TYR n 1 104 GLU n 1 105 SER n 1 106 ASP n 1 107 ASN n 1 108 ASP n 1 109 LYS n 1 110 GLU n 1 111 ARG n 1 112 PHE n 1 113 ILE n 1 114 ARG n 1 115 GLU n 1 116 ASN n 1 117 GLN n 1 118 PHE n 1 119 VAL n 1 120 LYS n 1 121 ILE n 1 122 ASP n 1 123 THR n 1 124 ILE n 1 125 ALA n 1 126 ALA n 1 127 ASP n 1 128 GLU n 1 129 SER n 1 130 PHE n 1 131 THR n 1 132 GLN n 1 133 VAL n 1 134 ASP n 1 135 ILE n 1 136 GLY n 1 137 ASP n 1 138 ARG n 1 139 ILE n 1 140 MET n 1 141 LYS n 1 142 LEU n 1 143 ASN n 1 144 THR n 1 145 GLU n 1 146 ILE n 1 147 ARG n 1 148 ASP n 1 149 VAL n 1 150 GLY n 1 151 PRO n 1 152 LEU n 1 153 SER n 1 154 LYS n 1 155 LYS n 1 156 GLY n 1 157 PHE n 1 158 TYR n 1 159 LEU n 1 160 ALA n 1 161 PHE n 1 162 GLN n 1 163 ASP n 1 164 VAL n 1 165 GLY n 1 166 ALA n 1 167 CYS n 1 168 ILE n 1 169 ALA n 1 170 LEU n 1 171 VAL n 1 172 SER n 1 173 VAL n 1 174 ARG n 1 175 VAL n 1 176 PHE n 1 177 TYR n 1 178 LYS n 1 179 LYS n 1 180 ALA n 1 181 PRO n 1 182 LEU n 1 183 THR n 1 184 VAL n 1 185 ARG n 2 1 BAL n 2 2 PRO n 2 3 TYR n 2 4 NLE n 2 5 VAL n 2 6 TYR n 2 7 ARG n 2 8 A1A0X n 2 9 GLU n 2 10 TRP n 2 11 SER n 2 12 PRO n 2 13 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 185 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EPHA4, HEK8, SEK, TYRO1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 13 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1A0X non-polymer n '4-amino-5-methylthiophene-3-carboxylic acid' ? 'C6 H7 N O2 S' 157.190 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BAL peptide-like . BETA-ALANINE ? 'C3 H7 N O2' 89.093 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 NLE 'L-peptide linking' n NORLEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 25 25 GLY GLY A . n A 1 2 SER 2 26 26 SER SER A . n A 1 3 HIS 3 27 27 HIS HIS A . n A 1 4 MET 4 28 28 MET MET A . n A 1 5 ASN 5 29 29 ASN ASN A . n A 1 6 GLU 6 30 30 GLU GLU A . n A 1 7 VAL 7 31 31 VAL VAL A . n A 1 8 THR 8 32 32 THR THR A . n A 1 9 LEU 9 33 33 LEU LEU A . n A 1 10 LEU 10 34 34 LEU LEU A . n A 1 11 ASP 11 35 35 ASP ASP A . n A 1 12 SER 12 36 36 SER SER A . n A 1 13 ARG 13 37 37 ARG ARG A . n A 1 14 SER 14 38 38 SER SER A . n A 1 15 VAL 15 39 39 VAL VAL A . n A 1 16 GLN 16 40 40 GLN GLN A . n A 1 17 GLY 17 41 41 GLY GLY A . n A 1 18 GLU 18 42 42 GLU GLU A . n A 1 19 LEU 19 43 43 LEU LEU A . n A 1 20 GLY 20 44 44 GLY GLY A . n A 1 21 TRP 21 45 45 TRP TRP A . n A 1 22 ILE 22 46 46 ILE ILE A . n A 1 23 ALA 23 47 47 ALA ALA A . n A 1 24 SER 24 48 48 SER SER A . n A 1 25 PRO 25 49 49 PRO PRO A . n A 1 26 LEU 26 50 50 LEU LEU A . n A 1 27 GLU 27 51 51 GLU GLU A . n A 1 28 GLY 28 52 52 GLY GLY A . n A 1 29 GLY 29 53 53 GLY GLY A . n A 1 30 TRP 30 54 54 TRP TRP A . n A 1 31 GLU 31 55 55 GLU GLU A . n A 1 32 GLU 32 56 56 GLU GLU A . n A 1 33 VAL 33 57 57 VAL VAL A . n A 1 34 SER 34 58 58 SER SER A . n A 1 35 ILE 35 59 59 ILE ILE A . n A 1 36 MET 36 60 60 MET MET A . n A 1 37 ASP 37 61 ? ? ? A . n A 1 38 GLU 38 62 ? ? ? A . n A 1 39 LYS 39 63 ? ? ? A . n A 1 40 ASN 40 64 ? ? ? A . n A 1 41 THR 41 65 65 THR THR A . n A 1 42 PRO 42 66 66 PRO PRO A . n A 1 43 ILE 43 67 67 ILE ILE A . n A 1 44 ARG 44 68 68 ARG ARG A . n A 1 45 THR 45 69 69 THR THR A . n A 1 46 TYR 46 70 70 TYR TYR A . n A 1 47 GLN 47 71 71 GLN GLN A . n A 1 48 VAL 48 72 72 VAL VAL A . n A 1 49 CYS 49 73 73 CYS CYS A . n A 1 50 ASN 50 74 74 ASN ASN A . n A 1 51 VAL 51 75 75 VAL VAL A . n A 1 52 MET 52 76 76 MET MET A . n A 1 53 GLU 53 77 77 GLU GLU A . n A 1 54 PRO 54 78 78 PRO PRO A . n A 1 55 SER 55 79 79 SER SER A . n A 1 56 GLN 56 80 80 GLN GLN A . n A 1 57 ASN 57 81 81 ASN ASN A . n A 1 58 ASN 58 82 82 ASN ASN A . n A 1 59 TRP 59 83 83 TRP TRP A . n A 1 60 LEU 60 84 84 LEU LEU A . n A 1 61 ARG 61 85 85 ARG ARG A . n A 1 62 THR 62 86 86 THR THR A . n A 1 63 ASP 63 87 87 ASP ASP A . n A 1 64 TRP 64 88 88 TRP TRP A . n A 1 65 ILE 65 89 89 ILE ILE A . n A 1 66 THR 66 90 90 THR THR A . n A 1 67 ARG 67 91 91 ARG ARG A . n A 1 68 GLU 68 92 92 GLU GLU A . n A 1 69 GLY 69 93 93 GLY GLY A . n A 1 70 ALA 70 94 94 ALA ALA A . n A 1 71 GLN 71 95 95 GLN GLN A . n A 1 72 ARG 72 96 96 ARG ARG A . n A 1 73 VAL 73 97 97 VAL VAL A . n A 1 74 TYR 74 98 98 TYR TYR A . n A 1 75 ILE 75 99 99 ILE ILE A . n A 1 76 GLU 76 100 100 GLU GLU A . n A 1 77 ILE 77 101 101 ILE ILE A . n A 1 78 LYS 78 102 102 LYS LYS A . n A 1 79 PHE 79 103 103 PHE PHE A . n A 1 80 THR 80 104 104 THR THR A . n A 1 81 LEU 81 105 105 LEU LEU A . n A 1 82 ARG 82 106 106 ARG ARG A . n A 1 83 ASP 83 107 107 ASP ASP A . n A 1 84 CYS 84 108 108 CYS CYS A . n A 1 85 ASN 85 109 109 ASN ASN A . n A 1 86 SER 86 110 110 SER SER A . n A 1 87 LEU 87 111 111 LEU LEU A . n A 1 88 PRO 88 112 112 PRO PRO A . n A 1 89 GLY 89 113 113 GLY GLY A . n A 1 90 VAL 90 114 114 VAL VAL A . n A 1 91 MET 91 115 115 MET MET A . n A 1 92 GLY 92 116 116 GLY GLY A . n A 1 93 THR 93 117 117 THR THR A . n A 1 94 CYS 94 118 118 CYS CYS A . n A 1 95 LYS 95 119 119 LYS LYS A . n A 1 96 GLU 96 120 120 GLU GLU A . n A 1 97 THR 97 121 121 THR THR A . n A 1 98 PHE 98 122 122 PHE PHE A . n A 1 99 ASN 99 123 123 ASN ASN A . n A 1 100 LEU 100 124 124 LEU LEU A . n A 1 101 TYR 101 125 125 TYR TYR A . n A 1 102 TYR 102 126 126 TYR TYR A . n A 1 103 TYR 103 127 127 TYR TYR A . n A 1 104 GLU 104 128 128 GLU GLU A . n A 1 105 SER 105 129 129 SER SER A . n A 1 106 ASP 106 130 130 ASP ASP A . n A 1 107 ASN 107 131 131 ASN ASN A . n A 1 108 ASP 108 132 132 ASP ASP A . n A 1 109 LYS 109 133 133 LYS LYS A . n A 1 110 GLU 110 134 134 GLU GLU A . n A 1 111 ARG 111 135 135 ARG ARG A . n A 1 112 PHE 112 136 136 PHE PHE A . n A 1 113 ILE 113 137 137 ILE ILE A . n A 1 114 ARG 114 138 138 ARG ARG A . n A 1 115 GLU 115 139 139 GLU GLU A . n A 1 116 ASN 116 140 140 ASN ASN A . n A 1 117 GLN 117 141 141 GLN GLN A . n A 1 118 PHE 118 142 142 PHE PHE A . n A 1 119 VAL 119 143 143 VAL VAL A . n A 1 120 LYS 120 144 144 LYS LYS A . n A 1 121 ILE 121 145 145 ILE ILE A . n A 1 122 ASP 122 146 146 ASP ASP A . n A 1 123 THR 123 147 147 THR THR A . n A 1 124 ILE 124 148 148 ILE ILE A . n A 1 125 ALA 125 149 149 ALA ALA A . n A 1 126 ALA 126 150 150 ALA ALA A . n A 1 127 ASP 127 151 151 ASP ASP A . n A 1 128 GLU 128 152 152 GLU GLU A . n A 1 129 SER 129 153 153 SER SER A . n A 1 130 PHE 130 154 154 PHE PHE A . n A 1 131 THR 131 155 155 THR THR A . n A 1 132 GLN 132 156 156 GLN GLN A . n A 1 133 VAL 133 157 157 VAL VAL A . n A 1 134 ASP 134 158 ? ? ? A . n A 1 135 ILE 135 159 ? ? ? A . n A 1 136 GLY 136 160 ? ? ? A . n A 1 137 ASP 137 161 161 ASP ASP A . n A 1 138 ARG 138 162 162 ARG ARG A . n A 1 139 ILE 139 163 163 ILE ILE A . n A 1 140 MET 140 164 164 MET MET A . n A 1 141 LYS 141 165 165 LYS LYS A . n A 1 142 LEU 142 166 166 LEU LEU A . n A 1 143 ASN 143 167 167 ASN ASN A . n A 1 144 THR 144 168 168 THR THR A . n A 1 145 GLU 145 169 169 GLU GLU A . n A 1 146 ILE 146 170 170 ILE ILE A . n A 1 147 ARG 147 171 171 ARG ARG A . n A 1 148 ASP 148 172 172 ASP ASP A . n A 1 149 VAL 149 173 173 VAL VAL A . n A 1 150 GLY 150 174 174 GLY GLY A . n A 1 151 PRO 151 175 175 PRO PRO A . n A 1 152 LEU 152 176 176 LEU LEU A . n A 1 153 SER 153 177 177 SER SER A . n A 1 154 LYS 154 178 178 LYS LYS A . n A 1 155 LYS 155 179 179 LYS LYS A . n A 1 156 GLY 156 180 180 GLY GLY A . n A 1 157 PHE 157 181 181 PHE PHE A . n A 1 158 TYR 158 182 182 TYR TYR A . n A 1 159 LEU 159 183 183 LEU LEU A . n A 1 160 ALA 160 184 184 ALA ALA A . n A 1 161 PHE 161 185 185 PHE PHE A . n A 1 162 GLN 162 186 186 GLN GLN A . n A 1 163 ASP 163 187 187 ASP ASP A . n A 1 164 VAL 164 188 188 VAL VAL A . n A 1 165 GLY 165 189 189 GLY GLY A . n A 1 166 ALA 166 190 190 ALA ALA A . n A 1 167 CYS 167 191 191 CYS CYS A . n A 1 168 ILE 168 192 192 ILE ILE A . n A 1 169 ALA 169 193 193 ALA ALA A . n A 1 170 LEU 170 194 194 LEU LEU A . n A 1 171 VAL 171 195 195 VAL VAL A . n A 1 172 SER 172 196 196 SER SER A . n A 1 173 VAL 173 197 197 VAL VAL A . n A 1 174 ARG 174 198 198 ARG ARG A . n A 1 175 VAL 175 199 199 VAL VAL A . n A 1 176 PHE 176 200 200 PHE PHE A . n A 1 177 TYR 177 201 201 TYR TYR A . n A 1 178 LYS 178 202 202 LYS LYS A . n A 1 179 LYS 179 203 203 LYS LYS A . n A 1 180 ALA 180 204 204 ALA ALA A . n A 1 181 PRO 181 205 ? ? ? A . n A 1 182 LEU 182 206 ? ? ? A . n A 1 183 THR 183 207 ? ? ? A . n A 1 184 VAL 184 208 ? ? ? A . n A 1 185 ARG 185 209 ? ? ? A . n B 2 1 BAL 1 5 5 BAL BAL B . n B 2 2 PRO 2 6 6 PRO PRO B . n B 2 3 TYR 3 7 7 TYR TYR B . n B 2 4 NLE 4 8 8 NLE NLE B . n B 2 5 VAL 5 9 9 VAL VAL B . n B 2 6 TYR 6 10 10 TYR TYR B . n B 2 7 ARG 7 11 11 ARG ARG B . n B 2 8 A1A0X 8 18 12 A1A0X LIG B . n B 2 9 GLU 9 19 13 GLU GLU B . n B 2 10 TRP 10 20 14 TRP TRP B . n B 2 11 SER 11 21 15 SER SER B . n B 2 12 PRO 12 22 16 PRO PRO B . n B 2 13 NH2 13 23 17 NH2 NH2 B . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 A1A0X ? ? A1A0X ? ? 'SUBJECT OF INVESTIGATION' ? 2 NH2 ? ? NH2 ? ? 'SUBJECT OF INVESTIGATION' ? 3 NLE ? ? NLE ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CL 1 301 3 CL CL A . D 4 HOH 1 401 20 HOH HOH A . D 4 HOH 2 402 1 HOH HOH A . D 4 HOH 3 403 47 HOH HOH A . D 4 HOH 4 404 43 HOH HOH A . D 4 HOH 5 405 22 HOH HOH A . D 4 HOH 6 406 52 HOH HOH A . D 4 HOH 7 407 24 HOH HOH A . D 4 HOH 8 408 29 HOH HOH A . D 4 HOH 9 409 9 HOH HOH A . D 4 HOH 10 410 7 HOH HOH A . D 4 HOH 11 411 12 HOH HOH A . D 4 HOH 12 412 3 HOH HOH A . D 4 HOH 13 413 54 HOH HOH A . D 4 HOH 14 414 5 HOH HOH A . D 4 HOH 15 415 33 HOH HOH A . D 4 HOH 16 416 36 HOH HOH A . D 4 HOH 17 417 38 HOH HOH A . D 4 HOH 18 418 8 HOH HOH A . D 4 HOH 19 419 44 HOH HOH A . D 4 HOH 20 420 11 HOH HOH A . D 4 HOH 21 421 34 HOH HOH A . D 4 HOH 22 422 17 HOH HOH A . D 4 HOH 23 423 39 HOH HOH A . D 4 HOH 24 424 28 HOH HOH A . D 4 HOH 25 425 6 HOH HOH A . D 4 HOH 26 426 37 HOH HOH A . D 4 HOH 27 427 18 HOH HOH A . D 4 HOH 28 428 23 HOH HOH A . D 4 HOH 29 429 35 HOH HOH A . D 4 HOH 30 430 4 HOH HOH A . D 4 HOH 31 431 2 HOH HOH A . D 4 HOH 32 432 14 HOH HOH A . D 4 HOH 33 433 10 HOH HOH A . D 4 HOH 34 434 25 HOH HOH A . D 4 HOH 35 435 19 HOH HOH A . D 4 HOH 36 436 26 HOH HOH A . D 4 HOH 37 437 49 HOH HOH A . D 4 HOH 38 438 16 HOH HOH A . D 4 HOH 39 439 40 HOH HOH A . D 4 HOH 40 440 42 HOH HOH A . D 4 HOH 41 441 21 HOH HOH A . D 4 HOH 42 442 45 HOH HOH A . D 4 HOH 43 443 55 HOH HOH A . D 4 HOH 44 444 41 HOH HOH A . D 4 HOH 45 445 15 HOH HOH A . D 4 HOH 46 446 48 HOH HOH A . D 4 HOH 47 447 27 HOH HOH A . D 4 HOH 48 448 46 HOH HOH A . D 4 HOH 49 449 32 HOH HOH A . E 4 HOH 1 101 31 HOH HOH B . E 4 HOH 2 102 13 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9CY8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 113.059 _cell.length_a_esd ? _cell.length_b 128.053 _cell.length_b_esd ? _cell.length_c 34.907 _cell.length_c_esd ? _cell.volume 505367.633 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9CY8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 21 _symmetry.space_group_name_Hall 'C 2 2' _symmetry.space_group_name_H-M 'C 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9CY8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.69 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Citric acid, pH 3.5, and 25% (w/v) PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-04-16 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.953 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.953 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 47.19 _reflns.entry_id 9CY8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 36.15 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15002 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.80 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.60 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1754 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.59 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 669 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.901 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 50.11 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9CY8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 36.15 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9171 _refine.ls_number_reflns_R_free 453 _refine.ls_number_reflns_R_work 8718 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.86 _refine.ls_percent_reflns_R_free 4.94 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2155 _refine.ls_R_factor_R_free 0.2568 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2132 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.6928 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2650 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 36.15 _refine_hist.number_atoms_solvent 51 _refine_hist.number_atoms_total 1558 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1460 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 47 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0058 ? 1536 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.6991 ? 2073 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0477 ? 222 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0037 ? 264 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.0328 ? 568 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.50 2.86 . . 145 2833 99.73 . . . . 0.2695 . . . . . . . . . . . 0.3048 'X-RAY DIFFRACTION' 2.86 3.60 . . 144 2867 100.00 . . . . 0.2245 . . . . . . . . . . . 0.2449 'X-RAY DIFFRACTION' 3.61 36.15 . . 164 3018 99.87 . . . . 0.1943 . . . . . . . . . . . 0.2503 # _struct.entry_id 9CY8 _struct.title 'Constrained b-hairpins targeting the EphA4 ligand binding domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9CY8 _struct_keywords.text 'receptor tyrosine kinase EphA4, LIPID BINDING PROTEIN' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP EPHA4_HUMAN P54764 ? 1 ;NEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDC NSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDV GACIALVSVRVFYKKCPLTVR ; 29 2 PDB 9CY8 9CY8 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9CY8 A 5 ? 185 ? P54764 29 ? 209 ? 29 209 2 2 9CY8 B 1 ? 13 ? 9CY8 5 ? 23 ? 5 23 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9CY8 GLY A 1 ? UNP P54764 ? ? 'expression tag' 25 1 1 9CY8 SER A 2 ? UNP P54764 ? ? 'expression tag' 26 2 1 9CY8 HIS A 3 ? UNP P54764 ? ? 'expression tag' 27 3 1 9CY8 MET A 4 ? UNP P54764 ? ? 'expression tag' 28 4 1 9CY8 ALA A 180 ? UNP P54764 CYS 204 conflict 204 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1620 ? 1 MORE -18 ? 1 'SSA (A^2)' 10000 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 14 ? GLU A 18 ? SER A 38 GLU A 42 5 ? 5 HELX_P HELX_P2 AA2 ASP A 83 ? LEU A 87 ? ASP A 107 LEU A 111 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 167 SG ? ? A CYS 73 A CYS 191 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 84 SG ? ? ? 1_555 A CYS 94 SG ? ? A CYS 108 A CYS 118 1_555 ? ? ? ? ? ? ? 2.035 ? ? covale1 covale both ? B BAL 1 C ? ? ? 1_555 B PRO 2 N ? ? B BAL 5 B PRO 6 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale2 covale both ? B TYR 3 C ? ? ? 1_555 B NLE 4 N ? ? B TYR 7 B NLE 8 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? B NLE 4 C ? ? ? 1_555 B VAL 5 N ? ? B NLE 8 B VAL 9 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? B ARG 7 C ? ? ? 1_555 B A1A0X 8 N09 ? ? B ARG 11 B A1A0X 18 1_555 ? ? ? ? ? ? ? 1.431 ? ? covale5 covale both ? B A1A0X 8 C06 ? ? ? 1_555 B GLU 9 N ? ? B A1A0X 18 B GLU 19 1_555 ? ? ? ? ? ? ? 1.430 ? ? covale6 covale both ? B PRO 12 C ? ? ? 1_555 B NH2 13 N ? ? B PRO 22 B NH2 23 1_555 ? ? ? ? ? ? ? 1.329 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NLE B 4 ? . . . . NLE B 8 ? 1_555 . . . . . . . LEU 1 NLE Norleucine 'Named protein modification' 2 BAL B 1 ? . . . . BAL B 5 ? 1_555 . . . . . . . ? 1 BAL None 'Non-standard residue' 3 A1A0X B 8 ? . . . . A1A0X B 18 ? 1_555 . . . . . . . ? 1 A1A0X None 'Non-standard residue' 4 NH2 B 13 ? PRO B 12 ? NH2 B 23 ? 1_555 PRO B 22 ? 1_555 . . PRO 13 NH2 None 'Terminal amidation' 5 CYS A 49 ? CYS A 167 ? CYS A 73 ? 1_555 CYS A 191 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 84 ? CYS A 94 ? CYS A 108 ? 1_555 CYS A 118 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 SER 24 A . ? SER 48 A PRO 25 A ? PRO 49 A 1 4.44 2 GLY 150 A . ? GLY 174 A PRO 151 A ? PRO 175 A 1 -0.50 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? AA3 ? 4 ? AA4 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 6 ? ASP A 11 ? GLU A 30 ASP A 35 AA1 2 CYS A 167 ? LYS A 178 ? CYS A 191 LYS A 202 AA1 3 ARG A 44 ? CYS A 49 ? ARG A 68 CYS A 73 AA1 4 GLU A 31 ? SER A 34 ? GLU A 55 SER A 58 AA2 1 GLU A 6 ? ASP A 11 ? GLU A 30 ASP A 35 AA2 2 CYS A 167 ? LYS A 178 ? CYS A 191 LYS A 202 AA2 3 VAL A 73 ? LEU A 81 ? VAL A 97 LEU A 105 AA2 4 MET A 140 ? VAL A 149 ? MET A 164 VAL A 173 AA2 5 PHE A 130 ? VAL A 133 ? PHE A 154 VAL A 157 AA3 1 ILE A 22 ? SER A 24 ? ILE A 46 SER A 48 AA3 2 ASN A 58 ? ARG A 61 ? ASN A 82 ARG A 85 AA3 3 GLY A 156 ? ASP A 163 ? GLY A 180 ASP A 187 AA3 4 ILE A 65 ? THR A 66 ? ILE A 89 THR A 90 AA4 1 ILE A 22 ? SER A 24 ? ILE A 46 SER A 48 AA4 2 ASN A 58 ? ARG A 61 ? ASN A 82 ARG A 85 AA4 3 GLY A 156 ? ASP A 163 ? GLY A 180 ASP A 187 AA4 4 THR A 97 ? SER A 105 ? THR A 121 SER A 129 AA4 5 VAL A 119 ? ALA A 125 ? VAL A 143 ALA A 149 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 10 ? N LEU A 34 O VAL A 175 ? O VAL A 199 AA1 2 3 O LEU A 170 ? O LEU A 194 N TYR A 46 ? N TYR A 70 AA1 3 4 O GLN A 47 ? O GLN A 71 N GLU A 31 ? N GLU A 55 AA2 1 2 N LEU A 10 ? N LEU A 34 O VAL A 175 ? O VAL A 199 AA2 2 3 O PHE A 176 ? O PHE A 200 N TYR A 74 ? N TYR A 98 AA2 3 4 N ILE A 75 ? N ILE A 99 O ARG A 147 ? O ARG A 171 AA2 4 5 O LEU A 142 ? O LEU A 166 N THR A 131 ? N THR A 155 AA3 1 2 N SER A 24 ? N SER A 48 O TRP A 59 ? O TRP A 83 AA3 2 3 N ASN A 58 ? N ASN A 82 O ASP A 163 ? O ASP A 187 AA3 3 4 O PHE A 157 ? O PHE A 181 N ILE A 65 ? N ILE A 89 AA4 1 2 N SER A 24 ? N SER A 48 O TRP A 59 ? O TRP A 83 AA4 2 3 N ASN A 58 ? N ASN A 82 O ASP A 163 ? O ASP A 187 AA4 3 4 O ALA A 160 ? O ALA A 184 N TYR A 101 ? N TYR A 125 AA4 4 5 N LEU A 100 ? N LEU A 124 O ILE A 121 ? O ILE A 145 # _pdbx_entry_details.entry_id 9CY8 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 73 ? ? -157.17 62.84 2 1 ASN A 74 ? ? -95.61 54.02 3 1 ASN A 81 ? ? -151.99 77.03 4 1 GLU A 92 ? ? 47.17 -117.11 5 1 PHE A 136 ? ? -155.23 56.40 6 1 ASP A 151 ? ? -117.46 -138.95 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 422 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z 8 -x+1/2,-y+1/2,z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 61 ? A ASP 37 2 1 Y 1 A GLU 62 ? A GLU 38 3 1 Y 1 A LYS 63 ? A LYS 39 4 1 Y 1 A ASN 64 ? A ASN 40 5 1 Y 1 A ASP 158 ? A ASP 134 6 1 Y 1 A ILE 159 ? A ILE 135 7 1 Y 1 A GLY 160 ? A GLY 136 8 1 Y 1 A PRO 205 ? A PRO 181 9 1 Y 1 A LEU 206 ? A LEU 182 10 1 Y 1 A THR 207 ? A THR 183 11 1 Y 1 A VAL 208 ? A VAL 184 12 1 Y 1 A ARG 209 ? A ARG 185 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1A0X C01 C N N 1 A1A0X C02 C Y N 2 A1A0X C04 C Y N 3 A1A0X C05 C Y N 4 A1A0X C06 C N N 5 A1A0X C08 C Y N 6 A1A0X N09 N N N 7 A1A0X O07 O N N 8 A1A0X S03 S Y N 9 A1A0X H011 H N N 10 A1A0X H012 H N N 11 A1A0X H013 H N N 12 A1A0X H041 H N N 13 A1A0X H092 H N N 14 A1A0X H091 H N N 15 A1A0X O1 O N N 16 A1A0X H1 H N N 17 ALA N N N N 18 ALA CA C N S 19 ALA C C N N 20 ALA O O N N 21 ALA CB C N N 22 ALA OXT O N N 23 ALA H H N N 24 ALA H2 H N N 25 ALA HA H N N 26 ALA HB1 H N N 27 ALA HB2 H N N 28 ALA HB3 H N N 29 ALA HXT H N N 30 ARG N N N N 31 ARG CA C N S 32 ARG C C N N 33 ARG O O N N 34 ARG CB C N N 35 ARG CG C N N 36 ARG CD C N N 37 ARG NE N N N 38 ARG CZ C N N 39 ARG NH1 N N N 40 ARG NH2 N N N 41 ARG OXT O N N 42 ARG H H N N 43 ARG H2 H N N 44 ARG HA H N N 45 ARG HB2 H N N 46 ARG HB3 H N N 47 ARG HG2 H N N 48 ARG HG3 H N N 49 ARG HD2 H N N 50 ARG HD3 H N N 51 ARG HE H N N 52 ARG HH11 H N N 53 ARG HH12 H N N 54 ARG HH21 H N N 55 ARG HH22 H N N 56 ARG HXT H N N 57 ASN N N N N 58 ASN CA C N S 59 ASN C C N N 60 ASN O O N N 61 ASN CB C N N 62 ASN CG C N N 63 ASN OD1 O N N 64 ASN ND2 N N N 65 ASN OXT O N N 66 ASN H H N N 67 ASN H2 H N N 68 ASN HA H N N 69 ASN HB2 H N N 70 ASN HB3 H N N 71 ASN HD21 H N N 72 ASN HD22 H N N 73 ASN HXT H N N 74 ASP N N N N 75 ASP CA C N S 76 ASP C C N N 77 ASP O O N N 78 ASP CB C N N 79 ASP CG C N N 80 ASP OD1 O N N 81 ASP OD2 O N N 82 ASP OXT O N N 83 ASP H H N N 84 ASP H2 H N N 85 ASP HA H N N 86 ASP HB2 H N N 87 ASP HB3 H N N 88 ASP HD2 H N N 89 ASP HXT H N N 90 BAL N N N N 91 BAL CB C N N 92 BAL CA C N N 93 BAL C C N N 94 BAL O O N N 95 BAL OXT O N N 96 BAL H H N N 97 BAL H2 H N N 98 BAL HB3 H N N 99 BAL HB2 H N N 100 BAL HA1 H N N 101 BAL HA2 H N N 102 BAL HXT H N N 103 CL CL CL N N 104 CYS N N N N 105 CYS CA C N R 106 CYS C C N N 107 CYS O O N N 108 CYS CB C N N 109 CYS SG S N N 110 CYS OXT O N N 111 CYS H H N N 112 CYS H2 H N N 113 CYS HA H N N 114 CYS HB2 H N N 115 CYS HB3 H N N 116 CYS HG H N N 117 CYS HXT H N N 118 GLN N N N N 119 GLN CA C N S 120 GLN C C N N 121 GLN O O N N 122 GLN CB C N N 123 GLN CG C N N 124 GLN CD C N N 125 GLN OE1 O N N 126 GLN NE2 N N N 127 GLN OXT O N N 128 GLN H H N N 129 GLN H2 H N N 130 GLN HA H N N 131 GLN HB2 H N N 132 GLN HB3 H N N 133 GLN HG2 H N N 134 GLN HG3 H N N 135 GLN HE21 H N N 136 GLN HE22 H N N 137 GLN HXT H N N 138 GLU N N N N 139 GLU CA C N S 140 GLU C C N N 141 GLU O O N N 142 GLU CB C N N 143 GLU CG C N N 144 GLU CD C N N 145 GLU OE1 O N N 146 GLU OE2 O N N 147 GLU OXT O N N 148 GLU H H N N 149 GLU H2 H N N 150 GLU HA H N N 151 GLU HB2 H N N 152 GLU HB3 H N N 153 GLU HG2 H N N 154 GLU HG3 H N N 155 GLU HE2 H N N 156 GLU HXT H N N 157 GLY N N N N 158 GLY CA C N N 159 GLY C C N N 160 GLY O O N N 161 GLY OXT O N N 162 GLY H H N N 163 GLY H2 H N N 164 GLY HA2 H N N 165 GLY HA3 H N N 166 GLY HXT H N N 167 HIS N N N N 168 HIS CA C N S 169 HIS C C N N 170 HIS O O N N 171 HIS CB C N N 172 HIS CG C Y N 173 HIS ND1 N Y N 174 HIS CD2 C Y N 175 HIS CE1 C Y N 176 HIS NE2 N Y N 177 HIS OXT O N N 178 HIS H H N N 179 HIS H2 H N N 180 HIS HA H N N 181 HIS HB2 H N N 182 HIS HB3 H N N 183 HIS HD1 H N N 184 HIS HD2 H N N 185 HIS HE1 H N N 186 HIS HE2 H N N 187 HIS HXT H N N 188 HOH O O N N 189 HOH H1 H N N 190 HOH H2 H N N 191 ILE N N N N 192 ILE CA C N S 193 ILE C C N N 194 ILE O O N N 195 ILE CB C N S 196 ILE CG1 C N N 197 ILE CG2 C N N 198 ILE CD1 C N N 199 ILE OXT O N N 200 ILE H H N N 201 ILE H2 H N N 202 ILE HA H N N 203 ILE HB H N N 204 ILE HG12 H N N 205 ILE HG13 H N N 206 ILE HG21 H N N 207 ILE HG22 H N N 208 ILE HG23 H N N 209 ILE HD11 H N N 210 ILE HD12 H N N 211 ILE HD13 H N N 212 ILE HXT H N N 213 LEU N N N N 214 LEU CA C N S 215 LEU C C N N 216 LEU O O N N 217 LEU CB C N N 218 LEU CG C N N 219 LEU CD1 C N N 220 LEU CD2 C N N 221 LEU OXT O N N 222 LEU H H N N 223 LEU H2 H N N 224 LEU HA H N N 225 LEU HB2 H N N 226 LEU HB3 H N N 227 LEU HG H N N 228 LEU HD11 H N N 229 LEU HD12 H N N 230 LEU HD13 H N N 231 LEU HD21 H N N 232 LEU HD22 H N N 233 LEU HD23 H N N 234 LEU HXT H N N 235 LYS N N N N 236 LYS CA C N S 237 LYS C C N N 238 LYS O O N N 239 LYS CB C N N 240 LYS CG C N N 241 LYS CD C N N 242 LYS CE C N N 243 LYS NZ N N N 244 LYS OXT O N N 245 LYS H H N N 246 LYS H2 H N N 247 LYS HA H N N 248 LYS HB2 H N N 249 LYS HB3 H N N 250 LYS HG2 H N N 251 LYS HG3 H N N 252 LYS HD2 H N N 253 LYS HD3 H N N 254 LYS HE2 H N N 255 LYS HE3 H N N 256 LYS HZ1 H N N 257 LYS HZ2 H N N 258 LYS HZ3 H N N 259 LYS HXT H N N 260 MET N N N N 261 MET CA C N S 262 MET C C N N 263 MET O O N N 264 MET CB C N N 265 MET CG C N N 266 MET SD S N N 267 MET CE C N N 268 MET OXT O N N 269 MET H H N N 270 MET H2 H N N 271 MET HA H N N 272 MET HB2 H N N 273 MET HB3 H N N 274 MET HG2 H N N 275 MET HG3 H N N 276 MET HE1 H N N 277 MET HE2 H N N 278 MET HE3 H N N 279 MET HXT H N N 280 NH2 N N N N 281 NH2 HN1 H N N 282 NH2 HN2 H N N 283 NLE N N N N 284 NLE CA C N S 285 NLE C C N N 286 NLE O O N N 287 NLE OXT O N N 288 NLE CB C N N 289 NLE CG C N N 290 NLE CD C N N 291 NLE CE C N N 292 NLE H H N N 293 NLE H2 H N N 294 NLE HA H N N 295 NLE HXT H N N 296 NLE HB2 H N N 297 NLE HB3 H N N 298 NLE HG2 H N N 299 NLE HG3 H N N 300 NLE HD2 H N N 301 NLE HD3 H N N 302 NLE HE1 H N N 303 NLE HE2 H N N 304 NLE HE3 H N N 305 PHE N N N N 306 PHE CA C N S 307 PHE C C N N 308 PHE O O N N 309 PHE CB C N N 310 PHE CG C Y N 311 PHE CD1 C Y N 312 PHE CD2 C Y N 313 PHE CE1 C Y N 314 PHE CE2 C Y N 315 PHE CZ C Y N 316 PHE OXT O N N 317 PHE H H N N 318 PHE H2 H N N 319 PHE HA H N N 320 PHE HB2 H N N 321 PHE HB3 H N N 322 PHE HD1 H N N 323 PHE HD2 H N N 324 PHE HE1 H N N 325 PHE HE2 H N N 326 PHE HZ H N N 327 PHE HXT H N N 328 PRO N N N N 329 PRO CA C N S 330 PRO C C N N 331 PRO O O N N 332 PRO CB C N N 333 PRO CG C N N 334 PRO CD C N N 335 PRO OXT O N N 336 PRO H H N N 337 PRO HA H N N 338 PRO HB2 H N N 339 PRO HB3 H N N 340 PRO HG2 H N N 341 PRO HG3 H N N 342 PRO HD2 H N N 343 PRO HD3 H N N 344 PRO HXT H N N 345 SER N N N N 346 SER CA C N S 347 SER C C N N 348 SER O O N N 349 SER CB C N N 350 SER OG O N N 351 SER OXT O N N 352 SER H H N N 353 SER H2 H N N 354 SER HA H N N 355 SER HB2 H N N 356 SER HB3 H N N 357 SER HG H N N 358 SER HXT H N N 359 THR N N N N 360 THR CA C N S 361 THR C C N N 362 THR O O N N 363 THR CB C N R 364 THR OG1 O N N 365 THR CG2 C N N 366 THR OXT O N N 367 THR H H N N 368 THR H2 H N N 369 THR HA H N N 370 THR HB H N N 371 THR HG1 H N N 372 THR HG21 H N N 373 THR HG22 H N N 374 THR HG23 H N N 375 THR HXT H N N 376 TRP N N N N 377 TRP CA C N S 378 TRP C C N N 379 TRP O O N N 380 TRP CB C N N 381 TRP CG C Y N 382 TRP CD1 C Y N 383 TRP CD2 C Y N 384 TRP NE1 N Y N 385 TRP CE2 C Y N 386 TRP CE3 C Y N 387 TRP CZ2 C Y N 388 TRP CZ3 C Y N 389 TRP CH2 C Y N 390 TRP OXT O N N 391 TRP H H N N 392 TRP H2 H N N 393 TRP HA H N N 394 TRP HB2 H N N 395 TRP HB3 H N N 396 TRP HD1 H N N 397 TRP HE1 H N N 398 TRP HE3 H N N 399 TRP HZ2 H N N 400 TRP HZ3 H N N 401 TRP HH2 H N N 402 TRP HXT H N N 403 TYR N N N N 404 TYR CA C N S 405 TYR C C N N 406 TYR O O N N 407 TYR CB C N N 408 TYR CG C Y N 409 TYR CD1 C Y N 410 TYR CD2 C Y N 411 TYR CE1 C Y N 412 TYR CE2 C Y N 413 TYR CZ C Y N 414 TYR OH O N N 415 TYR OXT O N N 416 TYR H H N N 417 TYR H2 H N N 418 TYR HA H N N 419 TYR HB2 H N N 420 TYR HB3 H N N 421 TYR HD1 H N N 422 TYR HD2 H N N 423 TYR HE1 H N N 424 TYR HE2 H N N 425 TYR HH H N N 426 TYR HXT H N N 427 VAL N N N N 428 VAL CA C N S 429 VAL C C N N 430 VAL O O N N 431 VAL CB C N N 432 VAL CG1 C N N 433 VAL CG2 C N N 434 VAL OXT O N N 435 VAL H H N N 436 VAL H2 H N N 437 VAL HA H N N 438 VAL HB H N N 439 VAL HG11 H N N 440 VAL HG12 H N N 441 VAL HG13 H N N 442 VAL HG21 H N N 443 VAL HG22 H N N 444 VAL HG23 H N N 445 VAL HXT H N N 446 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1A0X C02 C01 sing N N 1 A1A0X S03 C02 sing Y N 2 A1A0X C04 S03 sing Y N 3 A1A0X C05 C04 doub Y N 4 A1A0X O07 C06 doub N N 5 A1A0X C06 C05 sing N N 6 A1A0X C08 C05 sing Y N 7 A1A0X N09 C08 sing N N 8 A1A0X C02 C08 doub Y N 9 A1A0X C01 H011 sing N N 10 A1A0X C01 H012 sing N N 11 A1A0X C01 H013 sing N N 12 A1A0X C04 H041 sing N N 13 A1A0X N09 H092 sing N N 14 A1A0X N09 H091 sing N N 15 A1A0X C06 O1 sing N N 16 A1A0X O1 H1 sing N N 17 ALA N CA sing N N 18 ALA N H sing N N 19 ALA N H2 sing N N 20 ALA CA C sing N N 21 ALA CA CB sing N N 22 ALA CA HA sing N N 23 ALA C O doub N N 24 ALA C OXT sing N N 25 ALA CB HB1 sing N N 26 ALA CB HB2 sing N N 27 ALA CB HB3 sing N N 28 ALA OXT HXT sing N N 29 ARG N CA sing N N 30 ARG N H sing N N 31 ARG N H2 sing N N 32 ARG CA C sing N N 33 ARG CA CB sing N N 34 ARG CA HA sing N N 35 ARG C O doub N N 36 ARG C OXT sing N N 37 ARG CB CG sing N N 38 ARG CB HB2 sing N N 39 ARG CB HB3 sing N N 40 ARG CG CD sing N N 41 ARG CG HG2 sing N N 42 ARG CG HG3 sing N N 43 ARG CD NE sing N N 44 ARG CD HD2 sing N N 45 ARG CD HD3 sing N N 46 ARG NE CZ sing N N 47 ARG NE HE sing N N 48 ARG CZ NH1 sing N N 49 ARG CZ NH2 doub N N 50 ARG NH1 HH11 sing N N 51 ARG NH1 HH12 sing N N 52 ARG NH2 HH21 sing N N 53 ARG NH2 HH22 sing N N 54 ARG OXT HXT sing N N 55 ASN N CA sing N N 56 ASN N H sing N N 57 ASN N H2 sing N N 58 ASN CA C sing N N 59 ASN CA CB sing N N 60 ASN CA HA sing N N 61 ASN C O doub N N 62 ASN C OXT sing N N 63 ASN CB CG sing N N 64 ASN CB HB2 sing N N 65 ASN CB HB3 sing N N 66 ASN CG OD1 doub N N 67 ASN CG ND2 sing N N 68 ASN ND2 HD21 sing N N 69 ASN ND2 HD22 sing N N 70 ASN OXT HXT sing N N 71 ASP N CA sing N N 72 ASP N H sing N N 73 ASP N H2 sing N N 74 ASP CA C sing N N 75 ASP CA CB sing N N 76 ASP CA HA sing N N 77 ASP C O doub N N 78 ASP C OXT sing N N 79 ASP CB CG sing N N 80 ASP CB HB2 sing N N 81 ASP CB HB3 sing N N 82 ASP CG OD1 doub N N 83 ASP CG OD2 sing N N 84 ASP OD2 HD2 sing N N 85 ASP OXT HXT sing N N 86 BAL N CB sing N N 87 BAL N H sing N N 88 BAL N H2 sing N N 89 BAL CB CA sing N N 90 BAL CB HB3 sing N N 91 BAL CB HB2 sing N N 92 BAL CA C sing N N 93 BAL CA HA1 sing N N 94 BAL CA HA2 sing N N 95 BAL C O doub N N 96 BAL C OXT sing N N 97 BAL OXT HXT sing N N 98 CYS N CA sing N N 99 CYS N H sing N N 100 CYS N H2 sing N N 101 CYS CA C sing N N 102 CYS CA CB sing N N 103 CYS CA HA sing N N 104 CYS C O doub N N 105 CYS C OXT sing N N 106 CYS CB SG sing N N 107 CYS CB HB2 sing N N 108 CYS CB HB3 sing N N 109 CYS SG HG sing N N 110 CYS OXT HXT sing N N 111 GLN N CA sing N N 112 GLN N H sing N N 113 GLN N H2 sing N N 114 GLN CA C sing N N 115 GLN CA CB sing N N 116 GLN CA HA sing N N 117 GLN C O doub N N 118 GLN C OXT sing N N 119 GLN CB CG sing N N 120 GLN CB HB2 sing N N 121 GLN CB HB3 sing N N 122 GLN CG CD sing N N 123 GLN CG HG2 sing N N 124 GLN CG HG3 sing N N 125 GLN CD OE1 doub N N 126 GLN CD NE2 sing N N 127 GLN NE2 HE21 sing N N 128 GLN NE2 HE22 sing N N 129 GLN OXT HXT sing N N 130 GLU N CA sing N N 131 GLU N H sing N N 132 GLU N H2 sing N N 133 GLU CA C sing N N 134 GLU CA CB sing N N 135 GLU CA HA sing N N 136 GLU C O doub N N 137 GLU C OXT sing N N 138 GLU CB CG sing N N 139 GLU CB HB2 sing N N 140 GLU CB HB3 sing N N 141 GLU CG CD sing N N 142 GLU CG HG2 sing N N 143 GLU CG HG3 sing N N 144 GLU CD OE1 doub N N 145 GLU CD OE2 sing N N 146 GLU OE2 HE2 sing N N 147 GLU OXT HXT sing N N 148 GLY N CA sing N N 149 GLY N H sing N N 150 GLY N H2 sing N N 151 GLY CA C sing N N 152 GLY CA HA2 sing N N 153 GLY CA HA3 sing N N 154 GLY C O doub N N 155 GLY C OXT sing N N 156 GLY OXT HXT sing N N 157 HIS N CA sing N N 158 HIS N H sing N N 159 HIS N H2 sing N N 160 HIS CA C sing N N 161 HIS CA CB sing N N 162 HIS CA HA sing N N 163 HIS C O doub N N 164 HIS C OXT sing N N 165 HIS CB CG sing N N 166 HIS CB HB2 sing N N 167 HIS CB HB3 sing N N 168 HIS CG ND1 sing Y N 169 HIS CG CD2 doub Y N 170 HIS ND1 CE1 doub Y N 171 HIS ND1 HD1 sing N N 172 HIS CD2 NE2 sing Y N 173 HIS CD2 HD2 sing N N 174 HIS CE1 NE2 sing Y N 175 HIS CE1 HE1 sing N N 176 HIS NE2 HE2 sing N N 177 HIS OXT HXT sing N N 178 HOH O H1 sing N N 179 HOH O H2 sing N N 180 ILE N CA sing N N 181 ILE N H sing N N 182 ILE N H2 sing N N 183 ILE CA C sing N N 184 ILE CA CB sing N N 185 ILE CA HA sing N N 186 ILE C O doub N N 187 ILE C OXT sing N N 188 ILE CB CG1 sing N N 189 ILE CB CG2 sing N N 190 ILE CB HB sing N N 191 ILE CG1 CD1 sing N N 192 ILE CG1 HG12 sing N N 193 ILE CG1 HG13 sing N N 194 ILE CG2 HG21 sing N N 195 ILE CG2 HG22 sing N N 196 ILE CG2 HG23 sing N N 197 ILE CD1 HD11 sing N N 198 ILE CD1 HD12 sing N N 199 ILE CD1 HD13 sing N N 200 ILE OXT HXT sing N N 201 LEU N CA sing N N 202 LEU N H sing N N 203 LEU N H2 sing N N 204 LEU CA C sing N N 205 LEU CA CB sing N N 206 LEU CA HA sing N N 207 LEU C O doub N N 208 LEU C OXT sing N N 209 LEU CB CG sing N N 210 LEU CB HB2 sing N N 211 LEU CB HB3 sing N N 212 LEU CG CD1 sing N N 213 LEU CG CD2 sing N N 214 LEU CG HG sing N N 215 LEU CD1 HD11 sing N N 216 LEU CD1 HD12 sing N N 217 LEU CD1 HD13 sing N N 218 LEU CD2 HD21 sing N N 219 LEU CD2 HD22 sing N N 220 LEU CD2 HD23 sing N N 221 LEU OXT HXT sing N N 222 LYS N CA sing N N 223 LYS N H sing N N 224 LYS N H2 sing N N 225 LYS CA C sing N N 226 LYS CA CB sing N N 227 LYS CA HA sing N N 228 LYS C O doub N N 229 LYS C OXT sing N N 230 LYS CB CG sing N N 231 LYS CB HB2 sing N N 232 LYS CB HB3 sing N N 233 LYS CG CD sing N N 234 LYS CG HG2 sing N N 235 LYS CG HG3 sing N N 236 LYS CD CE sing N N 237 LYS CD HD2 sing N N 238 LYS CD HD3 sing N N 239 LYS CE NZ sing N N 240 LYS CE HE2 sing N N 241 LYS CE HE3 sing N N 242 LYS NZ HZ1 sing N N 243 LYS NZ HZ2 sing N N 244 LYS NZ HZ3 sing N N 245 LYS OXT HXT sing N N 246 MET N CA sing N N 247 MET N H sing N N 248 MET N H2 sing N N 249 MET CA C sing N N 250 MET CA CB sing N N 251 MET CA HA sing N N 252 MET C O doub N N 253 MET C OXT sing N N 254 MET CB CG sing N N 255 MET CB HB2 sing N N 256 MET CB HB3 sing N N 257 MET CG SD sing N N 258 MET CG HG2 sing N N 259 MET CG HG3 sing N N 260 MET SD CE sing N N 261 MET CE HE1 sing N N 262 MET CE HE2 sing N N 263 MET CE HE3 sing N N 264 MET OXT HXT sing N N 265 NH2 N HN1 sing N N 266 NH2 N HN2 sing N N 267 NLE N CA sing N N 268 NLE N H sing N N 269 NLE N H2 sing N N 270 NLE CA C sing N N 271 NLE CA CB sing N N 272 NLE CA HA sing N N 273 NLE C O doub N N 274 NLE C OXT sing N N 275 NLE OXT HXT sing N N 276 NLE CB CG sing N N 277 NLE CB HB2 sing N N 278 NLE CB HB3 sing N N 279 NLE CG CD sing N N 280 NLE CG HG2 sing N N 281 NLE CG HG3 sing N N 282 NLE CD CE sing N N 283 NLE CD HD2 sing N N 284 NLE CD HD3 sing N N 285 NLE CE HE1 sing N N 286 NLE CE HE2 sing N N 287 NLE CE HE3 sing N N 288 PHE N CA sing N N 289 PHE N H sing N N 290 PHE N H2 sing N N 291 PHE CA C sing N N 292 PHE CA CB sing N N 293 PHE CA HA sing N N 294 PHE C O doub N N 295 PHE C OXT sing N N 296 PHE CB CG sing N N 297 PHE CB HB2 sing N N 298 PHE CB HB3 sing N N 299 PHE CG CD1 doub Y N 300 PHE CG CD2 sing Y N 301 PHE CD1 CE1 sing Y N 302 PHE CD1 HD1 sing N N 303 PHE CD2 CE2 doub Y N 304 PHE CD2 HD2 sing N N 305 PHE CE1 CZ doub Y N 306 PHE CE1 HE1 sing N N 307 PHE CE2 CZ sing Y N 308 PHE CE2 HE2 sing N N 309 PHE CZ HZ sing N N 310 PHE OXT HXT sing N N 311 PRO N CA sing N N 312 PRO N CD sing N N 313 PRO N H sing N N 314 PRO CA C sing N N 315 PRO CA CB sing N N 316 PRO CA HA sing N N 317 PRO C O doub N N 318 PRO C OXT sing N N 319 PRO CB CG sing N N 320 PRO CB HB2 sing N N 321 PRO CB HB3 sing N N 322 PRO CG CD sing N N 323 PRO CG HG2 sing N N 324 PRO CG HG3 sing N N 325 PRO CD HD2 sing N N 326 PRO CD HD3 sing N N 327 PRO OXT HXT sing N N 328 SER N CA sing N N 329 SER N H sing N N 330 SER N H2 sing N N 331 SER CA C sing N N 332 SER CA CB sing N N 333 SER CA HA sing N N 334 SER C O doub N N 335 SER C OXT sing N N 336 SER CB OG sing N N 337 SER CB HB2 sing N N 338 SER CB HB3 sing N N 339 SER OG HG sing N N 340 SER OXT HXT sing N N 341 THR N CA sing N N 342 THR N H sing N N 343 THR N H2 sing N N 344 THR CA C sing N N 345 THR CA CB sing N N 346 THR CA HA sing N N 347 THR C O doub N N 348 THR C OXT sing N N 349 THR CB OG1 sing N N 350 THR CB CG2 sing N N 351 THR CB HB sing N N 352 THR OG1 HG1 sing N N 353 THR CG2 HG21 sing N N 354 THR CG2 HG22 sing N N 355 THR CG2 HG23 sing N N 356 THR OXT HXT sing N N 357 TRP N CA sing N N 358 TRP N H sing N N 359 TRP N H2 sing N N 360 TRP CA C sing N N 361 TRP CA CB sing N N 362 TRP CA HA sing N N 363 TRP C O doub N N 364 TRP C OXT sing N N 365 TRP CB CG sing N N 366 TRP CB HB2 sing N N 367 TRP CB HB3 sing N N 368 TRP CG CD1 doub Y N 369 TRP CG CD2 sing Y N 370 TRP CD1 NE1 sing Y N 371 TRP CD1 HD1 sing N N 372 TRP CD2 CE2 doub Y N 373 TRP CD2 CE3 sing Y N 374 TRP NE1 CE2 sing Y N 375 TRP NE1 HE1 sing N N 376 TRP CE2 CZ2 sing Y N 377 TRP CE3 CZ3 doub Y N 378 TRP CE3 HE3 sing N N 379 TRP CZ2 CH2 doub Y N 380 TRP CZ2 HZ2 sing N N 381 TRP CZ3 CH2 sing Y N 382 TRP CZ3 HZ3 sing N N 383 TRP CH2 HH2 sing N N 384 TRP OXT HXT sing N N 385 TYR N CA sing N N 386 TYR N H sing N N 387 TYR N H2 sing N N 388 TYR CA C sing N N 389 TYR CA CB sing N N 390 TYR CA HA sing N N 391 TYR C O doub N N 392 TYR C OXT sing N N 393 TYR CB CG sing N N 394 TYR CB HB2 sing N N 395 TYR CB HB3 sing N N 396 TYR CG CD1 doub Y N 397 TYR CG CD2 sing Y N 398 TYR CD1 CE1 sing Y N 399 TYR CD1 HD1 sing N N 400 TYR CD2 CE2 doub Y N 401 TYR CD2 HD2 sing N N 402 TYR CE1 CZ doub Y N 403 TYR CE1 HE1 sing N N 404 TYR CE2 CZ sing Y N 405 TYR CE2 HE2 sing N N 406 TYR CZ OH sing N N 407 TYR OH HH sing N N 408 TYR OXT HXT sing N N 409 VAL N CA sing N N 410 VAL N H sing N N 411 VAL N H2 sing N N 412 VAL CA C sing N N 413 VAL CA CB sing N N 414 VAL CA HA sing N N 415 VAL C O doub N N 416 VAL C OXT sing N N 417 VAL CB CG1 sing N N 418 VAL CB CG2 sing N N 419 VAL CB HB sing N N 420 VAL CG1 HG11 sing N N 421 VAL CG1 HG12 sing N N 422 VAL CG1 HG13 sing N N 423 VAL CG2 HG21 sing N N 424 VAL CG2 HG22 sing N N 425 VAL CG2 HG23 sing N N 426 VAL OXT HXT sing N N 427 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Cancer Institute (NIH/NCI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6vbx _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 2 2 2' _space_group.name_Hall 'C 2 2' _space_group.IT_number 21 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9CY8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.008845 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007809 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.028648 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #