data_9D86 # _entry.id 9D86 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9D86 pdb_00009d86 10.2210/pdb9d86/pdb WWPDB D_1000287397 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-12-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9D86 _pdbx_database_status.recvd_initial_deposition_date 2024-08-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email bruner@chem.ufl.edu _pdbx_contact_author.name_first Steven _pdbx_contact_author.name_last Bruner _pdbx_contact_author.name_mi D. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0522-480X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hu, Y.' 1 ? 'Bruner, S.D.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Mechanism of Catalysis and Substrate Binding of Epoxyqueuosine Reductase in the Biosynthetic Pathway to Queuosine-Modified tRNA.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.4c00524 _citation.pdbx_database_id_PubMed 39644232 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hu, Y.' 1 ? primary 'Jaroch, M.' 2 ? primary 'Sun, G.' 3 ? primary 'Dedon, P.C.' 4 0000-0003-0011-3067 primary 'de Crecy-Lagard, V.' 5 0000-0002-9955-3785 primary 'Bruner, S.D.' 6 0000-0002-0522-480X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epoxyqueuosine reductase QueH' 22532.809 1 1.17.99.6 C9S ? ? 2 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640 1 ? ? ? ? 3 water nat water 18.015 35 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Queuosine biosynthesis protein QueH' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGTVLIHVSCAPDLLTTIFHVRDAEFFFYNPNIQPLSEYEKRREAVDKVANHFSLNVRYGEYSTEEIRKWYTAVKDYKDL GEGSKRCERCISFLLERTAQEARKRGHESFSTTLLASPRKNLPMIENIGKTIEEKYGVKFFFKNFRKGGAYQEGVRLSKE LGIYRQNYCGCVFSLLERREKHAEISRKRGHM ; _entity_poly.pdbx_seq_one_letter_code_can ;MGTVLIHVSCAPDLLTTIFHVRDAEFFFYNPNIQPLSEYEKRREAVDKVANHFSLNVRYGEYSTEEIRKWYTAVKDYKDL GEGSKRCERCISFLLERTAQEARKRGHESFSTTLLASPRKNLPMIENIGKTIEEKYGVKFFFKNFRKGGAYQEGVRLSKE LGIYRQNYCGCVFSLLERREKHAEISRKRGHM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IRON/SULFUR CLUSTER' SF4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 THR n 1 4 VAL n 1 5 LEU n 1 6 ILE n 1 7 HIS n 1 8 VAL n 1 9 SER n 1 10 CYS n 1 11 ALA n 1 12 PRO n 1 13 ASP n 1 14 LEU n 1 15 LEU n 1 16 THR n 1 17 THR n 1 18 ILE n 1 19 PHE n 1 20 HIS n 1 21 VAL n 1 22 ARG n 1 23 ASP n 1 24 ALA n 1 25 GLU n 1 26 PHE n 1 27 PHE n 1 28 PHE n 1 29 TYR n 1 30 ASN n 1 31 PRO n 1 32 ASN n 1 33 ILE n 1 34 GLN n 1 35 PRO n 1 36 LEU n 1 37 SER n 1 38 GLU n 1 39 TYR n 1 40 GLU n 1 41 LYS n 1 42 ARG n 1 43 ARG n 1 44 GLU n 1 45 ALA n 1 46 VAL n 1 47 ASP n 1 48 LYS n 1 49 VAL n 1 50 ALA n 1 51 ASN n 1 52 HIS n 1 53 PHE n 1 54 SER n 1 55 LEU n 1 56 ASN n 1 57 VAL n 1 58 ARG n 1 59 TYR n 1 60 GLY n 1 61 GLU n 1 62 TYR n 1 63 SER n 1 64 THR n 1 65 GLU n 1 66 GLU n 1 67 ILE n 1 68 ARG n 1 69 LYS n 1 70 TRP n 1 71 TYR n 1 72 THR n 1 73 ALA n 1 74 VAL n 1 75 LYS n 1 76 ASP n 1 77 TYR n 1 78 LYS n 1 79 ASP n 1 80 LEU n 1 81 GLY n 1 82 GLU n 1 83 GLY n 1 84 SER n 1 85 LYS n 1 86 ARG n 1 87 CYS n 1 88 GLU n 1 89 ARG n 1 90 CYS n 1 91 ILE n 1 92 SER n 1 93 PHE n 1 94 LEU n 1 95 LEU n 1 96 GLU n 1 97 ARG n 1 98 THR n 1 99 ALA n 1 100 GLN n 1 101 GLU n 1 102 ALA n 1 103 ARG n 1 104 LYS n 1 105 ARG n 1 106 GLY n 1 107 HIS n 1 108 GLU n 1 109 SER n 1 110 PHE n 1 111 SER n 1 112 THR n 1 113 THR n 1 114 LEU n 1 115 LEU n 1 116 ALA n 1 117 SER n 1 118 PRO n 1 119 ARG n 1 120 LYS n 1 121 ASN n 1 122 LEU n 1 123 PRO n 1 124 MET n 1 125 ILE n 1 126 GLU n 1 127 ASN n 1 128 ILE n 1 129 GLY n 1 130 LYS n 1 131 THR n 1 132 ILE n 1 133 GLU n 1 134 GLU n 1 135 LYS n 1 136 TYR n 1 137 GLY n 1 138 VAL n 1 139 LYS n 1 140 PHE n 1 141 PHE n 1 142 PHE n 1 143 LYS n 1 144 ASN n 1 145 PHE n 1 146 ARG n 1 147 LYS n 1 148 GLY n 1 149 GLY n 1 150 ALA n 1 151 TYR n 1 152 GLN n 1 153 GLU n 1 154 GLY n 1 155 VAL n 1 156 ARG n 1 157 LEU n 1 158 SER n 1 159 LYS n 1 160 GLU n 1 161 LEU n 1 162 GLY n 1 163 ILE n 1 164 TYR n 1 165 ARG n 1 166 GLN n 1 167 ASN n 1 168 TYR n 1 169 CYS n 1 170 GLY n 1 171 CYS n 1 172 VAL n 1 173 PHE n 1 174 SER n 1 175 LEU n 1 176 LEU n 1 177 GLU n 1 178 ARG n 1 179 ARG n 1 180 GLU n 1 181 LYS n 1 182 HIS n 1 183 ALA n 1 184 GLU n 1 185 ILE n 1 186 SER n 1 187 ARG n 1 188 LYS n 1 189 ARG n 1 190 GLY n 1 191 HIS n 1 192 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 192 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'queH, TM_0731' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima MSB8' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SF4 non-polymer . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4' 351.640 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 MET 124 124 124 MET MET A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 CYS 169 169 169 CYS CYS A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 CYS 171 171 171 CYS CYS A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 ARG 178 178 178 ARG ARG A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 LYS 181 181 ? ? ? A . n A 1 182 HIS 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 GLU 184 184 ? ? ? A . n A 1 185 ILE 185 185 ? ? ? A . n A 1 186 SER 186 186 ? ? ? A . n A 1 187 ARG 187 187 ? ? ? A . n A 1 188 LYS 188 188 ? ? ? A . n A 1 189 ARG 189 189 ? ? ? A . n A 1 190 GLY 190 190 ? ? ? A . n A 1 191 HIS 191 191 ? ? ? A . n A 1 192 MET 192 192 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id SF4 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id SF4 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SF4 1 201 201 SF4 SF4 A . C 3 HOH 1 301 21 HOH HOH A . C 3 HOH 2 302 38 HOH HOH A . C 3 HOH 3 303 26 HOH HOH A . C 3 HOH 4 304 37 HOH HOH A . C 3 HOH 5 305 16 HOH HOH A . C 3 HOH 6 306 35 HOH HOH A . C 3 HOH 7 307 9 HOH HOH A . C 3 HOH 8 308 24 HOH HOH A . C 3 HOH 9 309 27 HOH HOH A . C 3 HOH 10 310 30 HOH HOH A . C 3 HOH 11 311 13 HOH HOH A . C 3 HOH 12 312 3 HOH HOH A . C 3 HOH 13 313 14 HOH HOH A . C 3 HOH 14 314 22 HOH HOH A . C 3 HOH 15 315 4 HOH HOH A . C 3 HOH 16 316 7 HOH HOH A . C 3 HOH 17 317 2 HOH HOH A . C 3 HOH 18 318 5 HOH HOH A . C 3 HOH 19 319 1 HOH HOH A . C 3 HOH 20 320 19 HOH HOH A . C 3 HOH 21 321 28 HOH HOH A . C 3 HOH 22 322 29 HOH HOH A . C 3 HOH 23 323 10 HOH HOH A . C 3 HOH 24 324 8 HOH HOH A . C 3 HOH 25 325 18 HOH HOH A . C 3 HOH 26 326 17 HOH HOH A . C 3 HOH 27 327 34 HOH HOH A . C 3 HOH 28 328 23 HOH HOH A . C 3 HOH 29 329 11 HOH HOH A . C 3 HOH 30 330 12 HOH HOH A . C 3 HOH 31 331 6 HOH HOH A . C 3 HOH 32 332 15 HOH HOH A . C 3 HOH 33 333 25 HOH HOH A . C 3 HOH 34 334 32 HOH HOH A . C 3 HOH 35 335 31 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9D86 _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.742 _cell.length_a_esd ? _cell.length_b 104.970 _cell.length_b_esd ? _cell.length_c 73.678 _cell.length_c_esd ? _cell.volume 407905.555 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9D86 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9D86 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.64 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Bis-Tris-HCl pH5.5, 0.2 M lithium sulfate monohydrate, 25% (w/v) polyethylene glycerol (PEG) 3350, 10 mM CaCl2 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-12-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.03321 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.03321 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 38.34 _reflns.entry_id 9D86 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.88 _reflns.d_resolution_low 30.15 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16852 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.69 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.51 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.88 _reflns_shell.d_res_low 1.951 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1608 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.605 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 46.62 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9D86 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.88 _refine.ls_d_res_low 30.15 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16851 _refine.ls_number_reflns_R_free 822 _refine.ls_number_reflns_R_work 16029 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.73 _refine.ls_percent_reflns_R_free 4.88 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2077 _refine.ls_R_factor_R_free 0.2534 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2056 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.8796 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2878 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.88 _refine_hist.d_res_low 30.15 _refine_hist.number_atoms_solvent 35 _refine_hist.number_atoms_total 1515 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1472 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0096 ? 1516 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0258 ? 2043 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0571 ? 214 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0115 ? 261 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 5.4411 ? 203 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.88 2.00 . . 129 2574 98.47 . . . . 0.3249 . . . . . . . . . . . 0.4044 'X-RAY DIFFRACTION' 2.00 2.16 . . 132 2653 100.00 . . . . 0.2412 . . . . . . . . . . . 0.2932 'X-RAY DIFFRACTION' 2.16 2.37 . . 140 2648 100.00 . . . . 0.2314 . . . . . . . . . . . 0.2531 'X-RAY DIFFRACTION' 2.37 2.72 . . 157 2637 100.00 . . . . 0.2263 . . . . . . . . . . . 0.2722 'X-RAY DIFFRACTION' 2.72 3.42 . . 125 2702 100.00 . . . . 0.2190 . . . . . . . . . . . 0.2721 'X-RAY DIFFRACTION' 3.42 30.15 . . 139 2815 99.90 . . . . 0.1782 . . . . . . . . . . . 0.2226 # _struct.entry_id 9D86 _struct.title 'Crystal structure of epoxyqueuosine reductase QueH C9S mutant from Thermotoga maritima' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9D86 _struct_keywords.text 'Queuosine Biosynthesis, Epoxyqueuosine Reductase, Metalloenzyme, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code QUEH_THEMA _struct_ref.pdbx_db_accession Q9WZJ0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGTVLIHVCCAPDLLTTIFHVRDAEFFFYNPNIQPLSEYEKRREAVDKVANHFSLNVRYGEYSTEEIRKWYTAVKDYKDL GEGSKRCERCISFLLERTAQEARKRGHESFSTTLLASPRKNLPMIENIGKTIEEKYGVKFFFKNFRKGGAYQEGVRLSKE LGIYRQNYCGCVFSLLERREKHAEISRKRGHM ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9D86 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 192 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9WZJ0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 192 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 192 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9D86 _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 9 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9WZJ0 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 9 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 9 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 10 ? PHE A 19 ? CYS A 10 PHE A 19 1 ? 10 HELX_P HELX_P2 AA2 PRO A 35 ? SER A 54 ? PRO A 35 SER A 54 1 ? 20 HELX_P HELX_P3 AA3 SER A 63 ? LYS A 75 ? SER A 63 LYS A 75 1 ? 13 HELX_P HELX_P4 AA4 ASP A 76 ? LYS A 78 ? ASP A 76 LYS A 78 5 ? 3 HELX_P HELX_P5 AA5 SER A 84 ? GLY A 106 ? SER A 84 GLY A 106 1 ? 23 HELX_P HELX_P6 AA6 LEU A 114 ? SER A 117 ? LEU A 114 SER A 117 5 ? 4 HELX_P HELX_P7 AA7 ASN A 121 ? GLY A 137 ? ASN A 121 GLY A 137 1 ? 17 HELX_P HELX_P8 AA8 GLY A 149 ? GLY A 162 ? GLY A 149 GLY A 162 1 ? 14 HELX_P HELX_P9 AA9 CYS A 171 ? GLU A 180 ? CYS A 171 GLU A 180 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 87 SG ? ? ? 1_555 B SF4 . FE2 ? ? A CYS 87 A SF4 201 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc2 metalc ? ? A CYS 90 SG ? ? ? 1_555 B SF4 . FE3 ? ? A CYS 90 A SF4 201 1_555 ? ? ? ? ? ? ? 2.284 ? ? metalc3 metalc ? ? A CYS 169 SG ? ? ? 1_555 B SF4 . FE1 ? ? A CYS 169 A SF4 201 1_555 ? ? ? ? ? ? ? 2.269 ? ? metalc4 metalc ? ? A CYS 171 SG ? ? ? 1_555 B SF4 . FE4 ? ? A CYS 171 A SF4 201 1_555 ? ? ? ? ? ? ? 2.260 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 87 ? A CYS 87 ? 1_555 FE2 ? B SF4 . ? A SF4 201 ? 1_555 S1 ? B SF4 . ? A SF4 201 ? 1_555 122.3 ? 2 SG ? A CYS 87 ? A CYS 87 ? 1_555 FE2 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 113.0 ? 3 S1 ? B SF4 . ? A SF4 201 ? 1_555 FE2 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 103.3 ? 4 SG ? A CYS 87 ? A CYS 87 ? 1_555 FE2 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 105.9 ? 5 S1 ? B SF4 . ? A SF4 201 ? 1_555 FE2 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 105.4 ? 6 S3 ? B SF4 . ? A SF4 201 ? 1_555 FE2 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 105.6 ? 7 SG ? A CYS 90 ? A CYS 90 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S1 ? B SF4 . ? A SF4 201 ? 1_555 109.0 ? 8 SG ? A CYS 90 ? A CYS 90 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S2 ? B SF4 . ? A SF4 201 ? 1_555 117.1 ? 9 S1 ? B SF4 . ? A SF4 201 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S2 ? B SF4 . ? A SF4 201 ? 1_555 105.2 ? 10 SG ? A CYS 90 ? A CYS 90 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 112.6 ? 11 S1 ? B SF4 . ? A SF4 201 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 106.4 ? 12 S2 ? B SF4 . ? A SF4 201 ? 1_555 FE3 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 105.8 ? 13 SG ? A CYS 169 ? A CYS 169 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S2 ? B SF4 . ? A SF4 201 ? 1_555 116.8 ? 14 SG ? A CYS 169 ? A CYS 169 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 107.6 ? 15 S2 ? B SF4 . ? A SF4 201 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 104.5 ? 16 SG ? A CYS 169 ? A CYS 169 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 116.0 ? 17 S2 ? B SF4 . ? A SF4 201 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 105.8 ? 18 S3 ? B SF4 . ? A SF4 201 ? 1_555 FE1 ? B SF4 . ? A SF4 201 ? 1_555 S4 ? B SF4 . ? A SF4 201 ? 1_555 104.8 ? 19 SG ? A CYS 171 ? A CYS 171 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S1 ? B SF4 . ? A SF4 201 ? 1_555 120.9 ? 20 SG ? A CYS 171 ? A CYS 171 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S2 ? B SF4 . ? A SF4 201 ? 1_555 107.2 ? 21 S1 ? B SF4 . ? A SF4 201 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S2 ? B SF4 . ? A SF4 201 ? 1_555 105.6 ? 22 SG ? A CYS 171 ? A CYS 171 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 112.6 ? 23 S1 ? B SF4 . ? A SF4 201 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 103.9 ? 24 S2 ? B SF4 . ? A SF4 201 ? 1_555 FE4 ? B SF4 . ? A SF4 201 ? 1_555 S3 ? B SF4 . ? A SF4 201 ? 1_555 105.5 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 34 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 34 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 35 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 35 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.11 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 57 ? TYR A 59 ? VAL A 57 TYR A 59 AA1 2 ALA A 24 ? PHE A 28 ? ALA A 24 PHE A 28 AA1 3 VAL A 4 ? VAL A 8 ? VAL A 4 VAL A 8 AA1 4 SER A 109 ? THR A 112 ? SER A 109 THR A 112 AA1 5 LYS A 139 ? PHE A 140 ? LYS A 139 PHE A 140 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 58 ? O ARG A 58 N PHE A 26 ? N PHE A 26 AA1 2 3 O GLU A 25 ? O GLU A 25 N ILE A 6 ? N ILE A 6 AA1 3 4 N HIS A 7 ? N HIS A 7 O SER A 111 ? O SER A 111 AA1 4 5 N PHE A 110 ? N PHE A 110 O LYS A 139 ? O LYS A 139 # _pdbx_entry_details.entry_id 9D86 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 96 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OH _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 TYR _pdbx_validate_close_contact.auth_seq_id_2 136 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 30 ? ? -153.90 63.04 2 1 SER A 111 ? ? -161.15 -167.57 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A LYS 181 ? A LYS 181 4 1 Y 1 A HIS 182 ? A HIS 182 5 1 Y 1 A ALA 183 ? A ALA 183 6 1 Y 1 A GLU 184 ? A GLU 184 7 1 Y 1 A ILE 185 ? A ILE 185 8 1 Y 1 A SER 186 ? A SER 186 9 1 Y 1 A ARG 187 ? A ARG 187 10 1 Y 1 A LYS 188 ? A LYS 188 11 1 Y 1 A ARG 189 ? A ARG 189 12 1 Y 1 A GLY 190 ? A GLY 190 13 1 Y 1 A HIS 191 ? A HIS 191 14 1 Y 1 A MET 192 ? A MET 192 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SF4 FE1 FE N N 304 SF4 FE2 FE N N 305 SF4 FE3 FE N N 306 SF4 FE4 FE N N 307 SF4 S1 S N N 308 SF4 S2 S N N 309 SF4 S3 S N N 310 SF4 S4 S N N 311 THR N N N N 312 THR CA C N S 313 THR C C N N 314 THR O O N N 315 THR CB C N R 316 THR OG1 O N N 317 THR CG2 C N N 318 THR OXT O N N 319 THR H H N N 320 THR H2 H N N 321 THR HA H N N 322 THR HB H N N 323 THR HG1 H N N 324 THR HG21 H N N 325 THR HG22 H N N 326 THR HG23 H N N 327 THR HXT H N N 328 TRP N N N N 329 TRP CA C N S 330 TRP C C N N 331 TRP O O N N 332 TRP CB C N N 333 TRP CG C Y N 334 TRP CD1 C Y N 335 TRP CD2 C Y N 336 TRP NE1 N Y N 337 TRP CE2 C Y N 338 TRP CE3 C Y N 339 TRP CZ2 C Y N 340 TRP CZ3 C Y N 341 TRP CH2 C Y N 342 TRP OXT O N N 343 TRP H H N N 344 TRP H2 H N N 345 TRP HA H N N 346 TRP HB2 H N N 347 TRP HB3 H N N 348 TRP HD1 H N N 349 TRP HE1 H N N 350 TRP HE3 H N N 351 TRP HZ2 H N N 352 TRP HZ3 H N N 353 TRP HH2 H N N 354 TRP HXT H N N 355 TYR N N N N 356 TYR CA C N S 357 TYR C C N N 358 TYR O O N N 359 TYR CB C N N 360 TYR CG C Y N 361 TYR CD1 C Y N 362 TYR CD2 C Y N 363 TYR CE1 C Y N 364 TYR CE2 C Y N 365 TYR CZ C Y N 366 TYR OH O N N 367 TYR OXT O N N 368 TYR H H N N 369 TYR H2 H N N 370 TYR HA H N N 371 TYR HB2 H N N 372 TYR HB3 H N N 373 TYR HD1 H N N 374 TYR HD2 H N N 375 TYR HE1 H N N 376 TYR HE2 H N N 377 TYR HH H N N 378 TYR HXT H N N 379 VAL N N N N 380 VAL CA C N S 381 VAL C C N N 382 VAL O O N N 383 VAL CB C N N 384 VAL CG1 C N N 385 VAL CG2 C N N 386 VAL OXT O N N 387 VAL H H N N 388 VAL H2 H N N 389 VAL HA H N N 390 VAL HB H N N 391 VAL HG11 H N N 392 VAL HG12 H N N 393 VAL HG13 H N N 394 VAL HG21 H N N 395 VAL HG22 H N N 396 VAL HG23 H N N 397 VAL HXT H N N 398 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SF4 FE1 S2 sing N N 290 SF4 FE1 S3 sing N N 291 SF4 FE1 S4 sing N N 292 SF4 FE2 S1 sing N N 293 SF4 FE2 S3 sing N N 294 SF4 FE2 S4 sing N N 295 SF4 FE3 S1 sing N N 296 SF4 FE3 S2 sing N N 297 SF4 FE3 S4 sing N N 298 SF4 FE4 S1 sing N N 299 SF4 FE4 S2 sing N N 300 SF4 FE4 S3 sing N N 301 THR N CA sing N N 302 THR N H sing N N 303 THR N H2 sing N N 304 THR CA C sing N N 305 THR CA CB sing N N 306 THR CA HA sing N N 307 THR C O doub N N 308 THR C OXT sing N N 309 THR CB OG1 sing N N 310 THR CB CG2 sing N N 311 THR CB HB sing N N 312 THR OG1 HG1 sing N N 313 THR CG2 HG21 sing N N 314 THR CG2 HG22 sing N N 315 THR CG2 HG23 sing N N 316 THR OXT HXT sing N N 317 TRP N CA sing N N 318 TRP N H sing N N 319 TRP N H2 sing N N 320 TRP CA C sing N N 321 TRP CA CB sing N N 322 TRP CA HA sing N N 323 TRP C O doub N N 324 TRP C OXT sing N N 325 TRP CB CG sing N N 326 TRP CB HB2 sing N N 327 TRP CB HB3 sing N N 328 TRP CG CD1 doub Y N 329 TRP CG CD2 sing Y N 330 TRP CD1 NE1 sing Y N 331 TRP CD1 HD1 sing N N 332 TRP CD2 CE2 doub Y N 333 TRP CD2 CE3 sing Y N 334 TRP NE1 CE2 sing Y N 335 TRP NE1 HE1 sing N N 336 TRP CE2 CZ2 sing Y N 337 TRP CE3 CZ3 doub Y N 338 TRP CE3 HE3 sing N N 339 TRP CZ2 CH2 doub Y N 340 TRP CZ2 HZ2 sing N N 341 TRP CZ3 CH2 sing Y N 342 TRP CZ3 HZ3 sing N N 343 TRP CH2 HH2 sing N N 344 TRP OXT HXT sing N N 345 TYR N CA sing N N 346 TYR N H sing N N 347 TYR N H2 sing N N 348 TYR CA C sing N N 349 TYR CA CB sing N N 350 TYR CA HA sing N N 351 TYR C O doub N N 352 TYR C OXT sing N N 353 TYR CB CG sing N N 354 TYR CB HB2 sing N N 355 TYR CB HB3 sing N N 356 TYR CG CD1 doub Y N 357 TYR CG CD2 sing Y N 358 TYR CD1 CE1 sing Y N 359 TYR CD1 HD1 sing N N 360 TYR CD2 CE2 doub Y N 361 TYR CD2 HD2 sing N N 362 TYR CE1 CZ doub Y N 363 TYR CE1 HE1 sing N N 364 TYR CE2 CZ sing Y N 365 TYR CE2 HE2 sing N N 366 TYR CZ OH sing N N 367 TYR OH HH sing N N 368 TYR OXT HXT sing N N 369 VAL N CA sing N N 370 VAL N H sing N N 371 VAL N H2 sing N N 372 VAL CA C sing N N 373 VAL CA CB sing N N 374 VAL CA HA sing N N 375 VAL C O doub N N 376 VAL C OXT sing N N 377 VAL CB CG1 sing N N 378 VAL CB CG2 sing N N 379 VAL CB HB sing N N 380 VAL CG1 HG11 sing N N 381 VAL CG1 HG12 sing N N 382 VAL CG1 HG13 sing N N 383 VAL CG2 HG21 sing N N 384 VAL CG2 HG22 sing N N 385 VAL CG2 HG23 sing N N 386 VAL OXT HXT sing N N 387 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM70641 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7LC5 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9D86 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.018960 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009527 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013573 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? FE ? ? 20.90327 4.99816 ? ? 2.55100 38.46870 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_