data_9D9T # _entry.id 9D9T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9D9T pdb_00009d9t 10.2210/pdb9d9t/pdb WWPDB D_1000287586 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-02-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9D9T _pdbx_database_status.recvd_initial_deposition_date 2024-08-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email vprasad@bcm.edu _pdbx_contact_author.name_first B.V.V _pdbx_contact_author.name_last Prasad _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1172-2071 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pham, S.H.' 1 0000-0001-6642-8796 'Neetu, N.' 2 ? 'Sankaran, B.' 3 0000-0002-3266-8131 'Prasad, B.V.V.' 4 0000-0002-1172-2071 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Virol. _citation.journal_id_ASTM JOVIAM _citation.journal_id_CSD 0825 _citation.journal_id_ISSN 1098-5514 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first e0175724 _citation.page_last e0175724 _citation.title 'Conformational flexibility is a critical factor in designing broad-spectrum human norovirus protease inhibitors.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/jvi.01757-24 _citation.pdbx_database_id_PubMed 39873493 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pham, S.' 1 ? primary 'Zhao, B.' 2 ? primary 'Neetu, N.' 3 ? primary 'Sankaran, B.' 4 ? primary 'Patil, K.' 5 ? primary 'Ramani, S.' 6 0000-0001-5631-8534 primary 'Song, Y.' 7 ? primary 'Estes, M.K.' 8 0000-0002-4813-4249 primary 'Palzkill, T.' 9 ? primary 'Prasad, B.V.V.' 10 0000-0002-1172-2071 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidase C37' 19398.352 1 ? R112A ? ? 2 non-polymer syn ;4-{2-(4-FLUORO-BENZYL)-6-METHYL-5-[(5-METHYL-ISOXAZOLE-3-CARBONYL)-AMINO]-4-OXO-HEPTANOYLAMINO}-5-(2-OXO-PYRROLIDIN-3-YL)-PENTANOIC ACID ETHYL ESTER ; 600.678 1 ? ? ? ? 3 non-polymer syn 'IODIDE ION' 126.904 5 ? ? ? ? 4 water nat water 18.015 52 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPAPPSIWSRIVNFGSGWGFWVSPSLFITSTHVIPQSAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAP EGTVATLLIKRPTGELMPLAARMGTHATMKIQGATVGGQMGMLLTGSNAKSMDLGTTPGDCGCPYIYKRGNDYVVIGVHT AAARGGNTVICATQGSEGEATLE ; _entity_poly.pdbx_seq_one_letter_code_can ;GPAPPSIWSRIVNFGSGWGFWVSPSLFITSTHVIPQSAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAP EGTVATLLIKRPTGELMPLAARMGTHATMKIQGATVGGQMGMLLTGSNAKSMDLGTTPGDCGCPYIYKRGNDYVVIGVHT AAARGGNTVICATQGSEGEATLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;4-{2-(4-FLUORO-BENZYL)-6-METHYL-5-[(5-METHYL-ISOXAZOLE-3-CARBONYL)-AMINO]-4-OXO-HEPTANOYLAMINO}-5-(2-OXO-PYRROLIDIN-3-YL)-PENTANOIC ACID ETHYL ESTER ; AG7 3 'IODIDE ION' IOD 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 ALA n 1 4 PRO n 1 5 PRO n 1 6 SER n 1 7 ILE n 1 8 TRP n 1 9 SER n 1 10 ARG n 1 11 ILE n 1 12 VAL n 1 13 ASN n 1 14 PHE n 1 15 GLY n 1 16 SER n 1 17 GLY n 1 18 TRP n 1 19 GLY n 1 20 PHE n 1 21 TRP n 1 22 VAL n 1 23 SER n 1 24 PRO n 1 25 SER n 1 26 LEU n 1 27 PHE n 1 28 ILE n 1 29 THR n 1 30 SER n 1 31 THR n 1 32 HIS n 1 33 VAL n 1 34 ILE n 1 35 PRO n 1 36 GLN n 1 37 SER n 1 38 ALA n 1 39 LYS n 1 40 GLU n 1 41 PHE n 1 42 PHE n 1 43 GLY n 1 44 VAL n 1 45 PRO n 1 46 ILE n 1 47 LYS n 1 48 GLN n 1 49 ILE n 1 50 GLN n 1 51 ILE n 1 52 HIS n 1 53 LYS n 1 54 SER n 1 55 GLY n 1 56 GLU n 1 57 PHE n 1 58 CYS n 1 59 ARG n 1 60 LEU n 1 61 ARG n 1 62 PHE n 1 63 PRO n 1 64 LYS n 1 65 PRO n 1 66 ILE n 1 67 ARG n 1 68 THR n 1 69 ASP n 1 70 VAL n 1 71 THR n 1 72 GLY n 1 73 MET n 1 74 ILE n 1 75 LEU n 1 76 GLU n 1 77 GLU n 1 78 GLY n 1 79 ALA n 1 80 PRO n 1 81 GLU n 1 82 GLY n 1 83 THR n 1 84 VAL n 1 85 ALA n 1 86 THR n 1 87 LEU n 1 88 LEU n 1 89 ILE n 1 90 LYS n 1 91 ARG n 1 92 PRO n 1 93 THR n 1 94 GLY n 1 95 GLU n 1 96 LEU n 1 97 MET n 1 98 PRO n 1 99 LEU n 1 100 ALA n 1 101 ALA n 1 102 ARG n 1 103 MET n 1 104 GLY n 1 105 THR n 1 106 HIS n 1 107 ALA n 1 108 THR n 1 109 MET n 1 110 LYS n 1 111 ILE n 1 112 GLN n 1 113 GLY n 1 114 ALA n 1 115 THR n 1 116 VAL n 1 117 GLY n 1 118 GLY n 1 119 GLN n 1 120 MET n 1 121 GLY n 1 122 MET n 1 123 LEU n 1 124 LEU n 1 125 THR n 1 126 GLY n 1 127 SER n 1 128 ASN n 1 129 ALA n 1 130 LYS n 1 131 SER n 1 132 MET n 1 133 ASP n 1 134 LEU n 1 135 GLY n 1 136 THR n 1 137 THR n 1 138 PRO n 1 139 GLY n 1 140 ASP n 1 141 CYS n 1 142 GLY n 1 143 CYS n 1 144 PRO n 1 145 TYR n 1 146 ILE n 1 147 TYR n 1 148 LYS n 1 149 ARG n 1 150 GLY n 1 151 ASN n 1 152 ASP n 1 153 TYR n 1 154 VAL n 1 155 VAL n 1 156 ILE n 1 157 GLY n 1 158 VAL n 1 159 HIS n 1 160 THR n 1 161 ALA n 1 162 ALA n 1 163 ALA n 1 164 ARG n 1 165 GLY n 1 166 GLY n 1 167 ASN n 1 168 THR n 1 169 VAL n 1 170 ILE n 1 171 CYS n 1 172 ALA n 1 173 THR n 1 174 GLN n 1 175 GLY n 1 176 SER n 1 177 GLU n 1 178 GLY n 1 179 GLU n 1 180 ALA n 1 181 THR n 1 182 LEU n 1 183 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 183 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name Norovirus _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 142786 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight AG7 non-polymer . ;4-{2-(4-FLUORO-BENZYL)-6-METHYL-5-[(5-METHYL-ISOXAZOLE-3-CARBONYL)-AMINO]-4-OXO-HEPTANOYLAMINO}-5-(2-OXO-PYRROLIDIN-3-YL)-PENTANOIC ACID ETHYL ESTER ; 'RUPINTRIVIR, bound form' 'C31 H41 F N4 O7' 600.678 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IOD non-polymer . 'IODIDE ION' ? 'I -1' 126.904 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 PRO 2 0 ? ? ? A . n A 1 3 ALA 3 1 ? ? ? A . n A 1 4 PRO 4 2 ? ? ? A . n A 1 5 PRO 5 3 ? ? ? A . n A 1 6 SER 6 4 4 SER SER A . n A 1 7 ILE 7 5 5 ILE ILE A . n A 1 8 TRP 8 6 6 TRP TRP A . n A 1 9 SER 9 7 7 SER SER A . n A 1 10 ARG 10 8 8 ARG ARG A . n A 1 11 ILE 11 9 9 ILE ILE A . n A 1 12 VAL 12 10 10 VAL VAL A . n A 1 13 ASN 13 11 11 ASN ASN A . n A 1 14 PHE 14 12 12 PHE PHE A . n A 1 15 GLY 15 13 13 GLY GLY A . n A 1 16 SER 16 14 14 SER SER A . n A 1 17 GLY 17 15 15 GLY GLY A . n A 1 18 TRP 18 16 16 TRP TRP A . n A 1 19 GLY 19 17 17 GLY GLY A . n A 1 20 PHE 20 18 18 PHE PHE A . n A 1 21 TRP 21 19 19 TRP TRP A . n A 1 22 VAL 22 20 20 VAL VAL A . n A 1 23 SER 23 21 21 SER SER A . n A 1 24 PRO 24 22 22 PRO PRO A . n A 1 25 SER 25 23 23 SER SER A . n A 1 26 LEU 26 24 24 LEU LEU A . n A 1 27 PHE 27 25 25 PHE PHE A . n A 1 28 ILE 28 26 26 ILE ILE A . n A 1 29 THR 29 27 27 THR THR A . n A 1 30 SER 30 28 28 SER SER A . n A 1 31 THR 31 29 29 THR THR A . n A 1 32 HIS 32 30 30 HIS HIS A . n A 1 33 VAL 33 31 31 VAL VAL A . n A 1 34 ILE 34 32 32 ILE ILE A . n A 1 35 PRO 35 33 33 PRO PRO A . n A 1 36 GLN 36 34 34 GLN GLN A . n A 1 37 SER 37 35 35 SER SER A . n A 1 38 ALA 38 36 36 ALA ALA A . n A 1 39 LYS 39 37 37 LYS LYS A . n A 1 40 GLU 40 38 38 GLU GLU A . n A 1 41 PHE 41 39 39 PHE PHE A . n A 1 42 PHE 42 40 40 PHE PHE A . n A 1 43 GLY 43 41 41 GLY GLY A . n A 1 44 VAL 44 42 42 VAL VAL A . n A 1 45 PRO 45 43 43 PRO PRO A . n A 1 46 ILE 46 44 44 ILE ILE A . n A 1 47 LYS 47 45 45 LYS LYS A . n A 1 48 GLN 48 46 46 GLN GLN A . n A 1 49 ILE 49 47 47 ILE ILE A . n A 1 50 GLN 50 48 48 GLN GLN A . n A 1 51 ILE 51 49 49 ILE ILE A . n A 1 52 HIS 52 50 50 HIS HIS A . n A 1 53 LYS 53 51 51 LYS LYS A . n A 1 54 SER 54 52 52 SER SER A . n A 1 55 GLY 55 53 53 GLY GLY A . n A 1 56 GLU 56 54 54 GLU GLU A . n A 1 57 PHE 57 55 55 PHE PHE A . n A 1 58 CYS 58 56 56 CYS CYS A . n A 1 59 ARG 59 57 57 ARG ARG A . n A 1 60 LEU 60 58 58 LEU LEU A . n A 1 61 ARG 61 59 59 ARG ARG A . n A 1 62 PHE 62 60 60 PHE PHE A . n A 1 63 PRO 63 61 61 PRO PRO A . n A 1 64 LYS 64 62 62 LYS LYS A . n A 1 65 PRO 65 63 63 PRO PRO A . n A 1 66 ILE 66 64 64 ILE ILE A . n A 1 67 ARG 67 65 65 ARG ARG A . n A 1 68 THR 68 66 66 THR THR A . n A 1 69 ASP 69 67 67 ASP ASP A . n A 1 70 VAL 70 68 68 VAL VAL A . n A 1 71 THR 71 69 69 THR THR A . n A 1 72 GLY 72 70 70 GLY GLY A . n A 1 73 MET 73 71 71 MET MET A . n A 1 74 ILE 74 72 72 ILE ILE A . n A 1 75 LEU 75 73 73 LEU LEU A . n A 1 76 GLU 76 74 74 GLU GLU A . n A 1 77 GLU 77 75 75 GLU GLU A . n A 1 78 GLY 78 76 76 GLY GLY A . n A 1 79 ALA 79 77 77 ALA ALA A . n A 1 80 PRO 80 78 78 PRO PRO A . n A 1 81 GLU 81 79 79 GLU GLU A . n A 1 82 GLY 82 80 80 GLY GLY A . n A 1 83 THR 83 81 81 THR THR A . n A 1 84 VAL 84 82 82 VAL VAL A . n A 1 85 ALA 85 83 83 ALA ALA A . n A 1 86 THR 86 84 84 THR THR A . n A 1 87 LEU 87 85 85 LEU LEU A . n A 1 88 LEU 88 86 86 LEU LEU A . n A 1 89 ILE 89 87 87 ILE ILE A . n A 1 90 LYS 90 88 88 LYS LYS A . n A 1 91 ARG 91 89 89 ARG ARG A . n A 1 92 PRO 92 90 90 PRO PRO A . n A 1 93 THR 93 91 91 THR THR A . n A 1 94 GLY 94 92 92 GLY GLY A . n A 1 95 GLU 95 93 93 GLU GLU A . n A 1 96 LEU 96 94 94 LEU LEU A . n A 1 97 MET 97 95 95 MET MET A . n A 1 98 PRO 98 96 96 PRO PRO A . n A 1 99 LEU 99 97 97 LEU LEU A . n A 1 100 ALA 100 98 98 ALA ALA A . n A 1 101 ALA 101 99 99 ALA ALA A . n A 1 102 ARG 102 100 100 ARG ARG A . n A 1 103 MET 103 101 101 MET MET A . n A 1 104 GLY 104 102 102 GLY GLY A . n A 1 105 THR 105 103 103 THR THR A . n A 1 106 HIS 106 104 104 HIS HIS A . n A 1 107 ALA 107 105 105 ALA ALA A . n A 1 108 THR 108 106 106 THR THR A . n A 1 109 MET 109 107 107 MET MET A . n A 1 110 LYS 110 108 108 LYS LYS A . n A 1 111 ILE 111 109 109 ILE ILE A . n A 1 112 GLN 112 110 110 GLN GLN A . n A 1 113 GLY 113 111 111 GLY GLY A . n A 1 114 ALA 114 112 112 ALA ALA A . n A 1 115 THR 115 113 113 THR THR A . n A 1 116 VAL 116 114 114 VAL VAL A . n A 1 117 GLY 117 115 115 GLY GLY A . n A 1 118 GLY 118 116 116 GLY GLY A . n A 1 119 GLN 119 117 117 GLN GLN A . n A 1 120 MET 120 118 118 MET MET A . n A 1 121 GLY 121 119 119 GLY GLY A . n A 1 122 MET 122 120 120 MET MET A . n A 1 123 LEU 123 121 121 LEU LEU A . n A 1 124 LEU 124 122 122 LEU LEU A . n A 1 125 THR 125 123 123 THR THR A . n A 1 126 GLY 126 124 ? ? ? A . n A 1 127 SER 127 125 ? ? ? A . n A 1 128 ASN 128 126 ? ? ? A . n A 1 129 ALA 129 127 ? ? ? A . n A 1 130 LYS 130 128 ? ? ? A . n A 1 131 SER 131 129 ? ? ? A . n A 1 132 MET 132 130 ? ? ? A . n A 1 133 ASP 133 131 ? ? ? A . n A 1 134 LEU 134 132 ? ? ? A . n A 1 135 GLY 135 133 133 GLY GLY A . n A 1 136 THR 136 134 134 THR THR A . n A 1 137 THR 137 135 135 THR THR A . n A 1 138 PRO 138 136 136 PRO PRO A . n A 1 139 GLY 139 137 137 GLY GLY A . n A 1 140 ASP 140 138 138 ASP ASP A . n A 1 141 CYS 141 139 139 CYS CYS A . n A 1 142 GLY 142 140 140 GLY GLY A . n A 1 143 CYS 143 141 141 CYS CYS A . n A 1 144 PRO 144 142 142 PRO PRO A . n A 1 145 TYR 145 143 143 TYR TYR A . n A 1 146 ILE 146 144 144 ILE ILE A . n A 1 147 TYR 147 145 145 TYR TYR A . n A 1 148 LYS 148 146 146 LYS LYS A . n A 1 149 ARG 149 147 147 ARG ARG A . n A 1 150 GLY 150 148 148 GLY GLY A . n A 1 151 ASN 151 149 149 ASN ASN A . n A 1 152 ASP 152 150 150 ASP ASP A . n A 1 153 TYR 153 151 151 TYR TYR A . n A 1 154 VAL 154 152 152 VAL VAL A . n A 1 155 VAL 155 153 153 VAL VAL A . n A 1 156 ILE 156 154 154 ILE ILE A . n A 1 157 GLY 157 155 155 GLY GLY A . n A 1 158 VAL 158 156 156 VAL VAL A . n A 1 159 HIS 159 157 157 HIS HIS A . n A 1 160 THR 160 158 158 THR THR A . n A 1 161 ALA 161 159 159 ALA ALA A . n A 1 162 ALA 162 160 160 ALA ALA A . n A 1 163 ALA 163 161 161 ALA ALA A . n A 1 164 ARG 164 162 162 ARG ARG A . n A 1 165 GLY 165 163 163 GLY GLY A . n A 1 166 GLY 166 164 164 GLY GLY A . n A 1 167 ASN 167 165 165 ASN ASN A . n A 1 168 THR 168 166 166 THR THR A . n A 1 169 VAL 169 167 167 VAL VAL A . n A 1 170 ILE 170 168 168 ILE ILE A . n A 1 171 CYS 171 169 169 CYS CYS A . n A 1 172 ALA 172 170 170 ALA ALA A . n A 1 173 THR 173 171 171 THR THR A . n A 1 174 GLN 174 172 172 GLN GLN A . n A 1 175 GLY 175 173 ? ? ? A . n A 1 176 SER 176 174 ? ? ? A . n A 1 177 GLU 177 175 ? ? ? A . n A 1 178 GLY 178 176 ? ? ? A . n A 1 179 GLU 179 177 ? ? ? A . n A 1 180 ALA 180 178 ? ? ? A . n A 1 181 THR 181 179 ? ? ? A . n A 1 182 LEU 182 180 ? ? ? A . n A 1 183 GLU 183 181 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id AG7 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id AG7 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 AG7 1 201 201 AG7 AG7 A . C 3 IOD 1 202 1 IOD IOD A . D 3 IOD 1 203 3 IOD IOD A . E 3 IOD 1 204 5 IOD IOD A . F 3 IOD 1 205 6 IOD IOD A . G 3 IOD 1 206 7 IOD IOD A . H 4 HOH 1 301 3 HOH HOH A . H 4 HOH 2 302 276 HOH HOH A . H 4 HOH 3 303 236 HOH HOH A . H 4 HOH 4 304 618 HOH HOH A . H 4 HOH 5 305 109 HOH HOH A . H 4 HOH 6 306 86 HOH HOH A . H 4 HOH 7 307 30 HOH HOH A . H 4 HOH 8 308 40 HOH HOH A . H 4 HOH 9 309 51 HOH HOH A . H 4 HOH 10 310 5 HOH HOH A . H 4 HOH 11 311 161 HOH HOH A . H 4 HOH 12 312 157 HOH HOH A . H 4 HOH 13 313 83 HOH HOH A . H 4 HOH 14 314 90 HOH HOH A . H 4 HOH 15 315 278 HOH HOH A . H 4 HOH 16 316 23 HOH HOH A . H 4 HOH 17 317 29 HOH HOH A . H 4 HOH 18 318 9 HOH HOH A . H 4 HOH 19 319 390 HOH HOH A . H 4 HOH 20 320 504 HOH HOH A . H 4 HOH 21 321 229 HOH HOH A . H 4 HOH 22 322 339 HOH HOH A . H 4 HOH 23 323 7 HOH HOH A . H 4 HOH 24 324 12 HOH HOH A . H 4 HOH 25 325 406 HOH HOH A . H 4 HOH 26 326 263 HOH HOH A . H 4 HOH 27 327 17 HOH HOH A . H 4 HOH 28 328 380 HOH HOH A . H 4 HOH 29 329 167 HOH HOH A . H 4 HOH 30 330 470 HOH HOH A . H 4 HOH 31 331 279 HOH HOH A . H 4 HOH 32 332 1 HOH HOH A . H 4 HOH 33 333 19 HOH HOH A . H 4 HOH 34 334 398 HOH HOH A . H 4 HOH 35 335 21 HOH HOH A . H 4 HOH 36 336 519 HOH HOH A . H 4 HOH 37 337 543 HOH HOH A . H 4 HOH 38 338 69 HOH HOH A . H 4 HOH 39 339 87 HOH HOH A . H 4 HOH 40 340 10 HOH HOH A . H 4 HOH 41 341 551 HOH HOH A . H 4 HOH 42 342 343 HOH HOH A . H 4 HOH 43 343 561 HOH HOH A . H 4 HOH 44 344 394 HOH HOH A . H 4 HOH 45 345 180 HOH HOH A . H 4 HOH 46 346 549 HOH HOH A . H 4 HOH 47 347 447 HOH HOH A . H 4 HOH 48 348 555 HOH HOH A . H 4 HOH 49 349 619 HOH HOH A . H 4 HOH 50 350 332 HOH HOH A . H 4 HOH 51 351 598 HOH HOH A . H 4 HOH 52 352 20 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21rc1_5156 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9D9T _cell.details ? _cell.formula_units_Z ? _cell.length_a 98.350 _cell.length_a_esd ? _cell.length_b 98.350 _cell.length_b_esd ? _cell.length_c 46.280 _cell.length_c_esd ? _cell.volume 387679.387 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9D9T _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9D9T _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.07 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.02 M Magnesium chloride hexahydrate, 0.1M HEPES pH 7.5, 22 % w/v Poly(acrylic acid sodium salt) 5100, 0.2M potassium iodide' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-02-12 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 41.27 _reflns.entry_id 9D9T _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 42.59 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15510 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 87.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.076 _reflns.pdbx_Rpim_I_all 0.016 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.03 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 871 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.231 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.929 _reflns_shell.pdbx_CC_star 0.981 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 45.54 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9D9T _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 42.59 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15508 _refine.ls_number_reflns_R_free 782 _refine.ls_number_reflns_R_work 14726 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 87.69 _refine.ls_percent_reflns_R_free 5.04 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2144 _refine.ls_R_factor_R_free 0.2363 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2132 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.8508 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3019 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 42.59 _refine_hist.number_atoms_solvent 52 _refine_hist.number_atoms_total 1304 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1204 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0049 ? 1277 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7066 ? 1730 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0500 ? 193 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0056 ? 218 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.6104 ? 177 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.00 2.13 . . 147 2747 99.69 . . . . 0.2583 . . . . . . . . . . . 0.3181 'X-RAY DIFFRACTION' 2.13 2.29 . . 91 1654 59.80 . . . . 0.2949 . . . . . . . . . . . 0.3760 'X-RAY DIFFRACTION' 2.29 2.52 . . 138 2732 98.22 . . . . 0.2935 . . . . . . . . . . . 0.3159 'X-RAY DIFFRACTION' 2.52 2.88 . . 122 2312 82.90 . . . . 0.2631 . . . . . . . . . . . 0.3152 'X-RAY DIFFRACTION' 2.88 3.63 . . 136 2625 93.43 . . . . 0.2236 . . . . . . . . . . . 0.2457 'X-RAY DIFFRACTION' 3.64 42.59 . . 148 2656 91.87 . . . . 0.1721 . . . . . . . . . . . 0.1844 # _struct.entry_id 9D9T _struct.title 'Human norovirus GII.4 Sydney protease R112A mutant in complex with rupintrivir' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9D9T _struct_keywords.text 'Viral protease with inhibitor, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code K4L8Z7_9CALI _struct_ref.pdbx_db_accession K4L8Z7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APPSIWSRIVNFGSGWGFWVSPSLFITSTHVIPQSAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGDCGCPYIYKRGNDYVVIGVHTAA ARGGNTVICATQGSEGEATLE ; _struct_ref.pdbx_align_begin 1009 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9D9T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession K4L8Z7 _struct_ref_seq.db_align_beg 1009 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 181 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9D9T GLY A 1 ? UNP K4L8Z7 ? ? 'expression tag' -1 1 1 9D9T PRO A 2 ? UNP K4L8Z7 ? ? 'expression tag' 0 2 1 9D9T ALA A 114 ? UNP K4L8Z7 ARG 1120 'engineered mutation' 112 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'HuNoV GII.4 Sydney protease R112A mutant in complex with Rupintrivir' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 7 ? SER A 9 ? ILE A 5 SER A 7 5 ? 3 HELX_P HELX_P2 AA2 LYS A 47 ? ILE A 49 ? LYS A 45 ILE A 47 5 ? 3 HELX_P HELX_P3 AA3 THR A 137 ? CYS A 141 ? THR A 135 CYS A 139 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 141 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id AG7 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C19 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 139 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id AG7 _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.773 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id AG7 _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 141 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id AG7 _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 139 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C19 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id AG7 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA3 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 11 ? PHE A 14 ? ILE A 9 PHE A 12 AA1 2 GLY A 17 ? TRP A 21 ? GLY A 15 TRP A 19 AA1 3 LEU A 26 ? SER A 30 ? LEU A 24 SER A 28 AA1 4 PHE A 57 ? ARG A 61 ? PHE A 55 ARG A 59 AA1 5 GLN A 50 ? SER A 54 ? GLN A 48 SER A 52 AA2 1 GLU A 40 ? PHE A 41 ? GLU A 38 PHE A 39 AA2 2 VAL A 44 ? PRO A 45 ? VAL A 42 PRO A 43 AA3 1 ILE A 74 ? LEU A 75 ? ILE A 72 LEU A 73 AA3 2 ASP A 152 ? ALA A 162 ? ASP A 150 ALA A 160 AA3 3 THR A 168 ? ALA A 172 ? THR A 166 ALA A 170 AA3 4 ALA A 114 ? LEU A 123 ? ALA A 112 LEU A 121 AA3 5 LEU A 96 ? ILE A 111 ? LEU A 94 ILE A 109 AA3 6 VAL A 84 ? LYS A 90 ? VAL A 82 LYS A 88 AA3 7 PRO A 144 ? ARG A 149 ? PRO A 142 ARG A 147 AA3 8 ASP A 152 ? ALA A 162 ? ASP A 150 ALA A 160 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 14 ? N PHE A 12 O GLY A 17 ? O GLY A 15 AA1 2 3 N PHE A 20 ? N PHE A 18 O ILE A 28 ? O ILE A 26 AA1 3 4 N PHE A 27 ? N PHE A 25 O LEU A 60 ? O LEU A 58 AA1 4 5 O ARG A 61 ? O ARG A 59 N GLN A 50 ? N GLN A 48 AA2 1 2 N PHE A 41 ? N PHE A 39 O VAL A 44 ? O VAL A 42 AA3 1 2 N ILE A 74 ? N ILE A 72 O VAL A 155 ? O VAL A 153 AA3 2 3 N ALA A 161 ? N ALA A 159 O ILE A 170 ? O ILE A 168 AA3 3 4 O CYS A 171 ? O CYS A 169 N GLN A 119 ? N GLN A 117 AA3 4 5 O MET A 120 ? O MET A 118 N GLY A 104 ? N GLY A 102 AA3 5 6 O MET A 97 ? O MET A 95 N ILE A 89 ? N ILE A 87 AA3 6 7 N THR A 86 ? N THR A 84 O ILE A 146 ? O ILE A 144 AA3 7 8 N ARG A 149 ? N ARG A 147 O ASP A 152 ? O ASP A 150 # _pdbx_entry_details.entry_id 9D9T _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 65 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -114.33 _pdbx_validate_torsion.psi 77.40 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id IOD _pdbx_struct_special_symmetry.auth_seq_id 205 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id IOD _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A PRO 0 ? A PRO 2 3 1 Y 1 A ALA 1 ? A ALA 3 4 1 Y 1 A PRO 2 ? A PRO 4 5 1 Y 1 A PRO 3 ? A PRO 5 6 1 Y 1 A GLY 124 ? A GLY 126 7 1 Y 1 A SER 125 ? A SER 127 8 1 Y 1 A ASN 126 ? A ASN 128 9 1 Y 1 A ALA 127 ? A ALA 129 10 1 Y 1 A LYS 128 ? A LYS 130 11 1 Y 1 A SER 129 ? A SER 131 12 1 Y 1 A MET 130 ? A MET 132 13 1 Y 1 A ASP 131 ? A ASP 133 14 1 Y 1 A LEU 132 ? A LEU 134 15 1 Y 1 A GLY 173 ? A GLY 175 16 1 Y 1 A SER 174 ? A SER 176 17 1 Y 1 A GLU 175 ? A GLU 177 18 1 Y 1 A GLY 176 ? A GLY 178 19 1 Y 1 A GLU 177 ? A GLU 179 20 1 Y 1 A ALA 178 ? A ALA 180 21 1 Y 1 A THR 179 ? A THR 181 22 1 Y 1 A LEU 180 ? A LEU 182 23 1 Y 1 A GLU 181 ? A GLU 183 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal AG7 C01 C N N 1 AG7 C02 C N N 2 AG7 O03 O N N 3 AG7 C04 C N R 4 AG7 C05 C N N 5 AG7 C06 C Y N 6 AG7 C07 C Y N 7 AG7 C08 C Y N 8 AG7 C09 C Y N 9 AG7 C10 C Y N 10 AG7 C11 C Y N 11 AG7 N12 N N N 12 AG7 C13 C N R 13 AG7 C14 C N N 14 AG7 C15 C N S 15 AG7 C16 C N N 16 AG7 N17 N N N 17 AG7 O18 O N N 18 AG7 C19 C N N 19 AG7 C20 C N N 20 AG7 C21 C N N 21 AG7 O22 O N N 22 AG7 O23 O N N 23 AG7 C47 C N N 24 AG7 O48 O N N 25 AG7 C50 C N N 26 AG7 C53 C N N 27 AG7 C57 C N S 28 AG7 N58 N N N 29 AG7 C59 C N N 30 AG7 O60 O N N 31 AG7 C78 C N N 32 AG7 C81 C N N 33 AG7 F1 F N N 34 AG7 C82 C N N 35 AG7 C83 C N N 36 AG7 C84 C N N 37 AG7 C1 C Y N 38 AG7 C2 C Y N 39 AG7 C3 C Y N 40 AG7 O4 O Y N 41 AG7 N5 N Y N 42 AG7 C4 C N N 43 AG7 H2 H N N 44 AG7 H3 H N N 45 AG7 H27 H N N 46 AG7 H28 H N N 47 AG7 H29 H N N 48 AG7 H30 H N N 49 AG7 H31 H N N 50 AG7 H33 H N N 51 AG7 H34 H N N 52 AG7 H49 H N N 53 AG7 H91 H N N 54 AG7 H35 H N N 55 AG7 H36 H N N 56 AG7 H94 H N N 57 AG7 H39 H N N 58 AG7 H191 H N N 59 AG7 H192 H N N 60 AG7 H41 H N N 61 AG7 H42 H N N 62 AG7 H51 H N N 63 AG7 H52 H N N 64 AG7 H53 H N N 65 AG7 H54 H N N 66 AG7 H56 H N N 67 AG7 H77 H N N 68 AG7 H61 H N N 69 AG7 H79 H N N 70 AG7 H82 H N N 71 AG7 H84 H N N 72 AG7 H85 H N N 73 AG7 H86 H N N 74 AG7 H87 H N N 75 AG7 H88 H N N 76 AG7 H89 H N N 77 AG7 H90 H N N 78 AG7 H92 H N N 79 AG7 H93 H N N 80 AG7 H8 H N N 81 AG7 H5 H N N 82 AG7 H6 H N N 83 AG7 H7 H N N 84 ALA N N N N 85 ALA CA C N S 86 ALA C C N N 87 ALA O O N N 88 ALA CB C N N 89 ALA OXT O N N 90 ALA H H N N 91 ALA H2 H N N 92 ALA HA H N N 93 ALA HB1 H N N 94 ALA HB2 H N N 95 ALA HB3 H N N 96 ALA HXT H N N 97 ARG N N N N 98 ARG CA C N S 99 ARG C C N N 100 ARG O O N N 101 ARG CB C N N 102 ARG CG C N N 103 ARG CD C N N 104 ARG NE N N N 105 ARG CZ C N N 106 ARG NH1 N N N 107 ARG NH2 N N N 108 ARG OXT O N N 109 ARG H H N N 110 ARG H2 H N N 111 ARG HA H N N 112 ARG HB2 H N N 113 ARG HB3 H N N 114 ARG HG2 H N N 115 ARG HG3 H N N 116 ARG HD2 H N N 117 ARG HD3 H N N 118 ARG HE H N N 119 ARG HH11 H N N 120 ARG HH12 H N N 121 ARG HH21 H N N 122 ARG HH22 H N N 123 ARG HXT H N N 124 ASN N N N N 125 ASN CA C N S 126 ASN C C N N 127 ASN O O N N 128 ASN CB C N N 129 ASN CG C N N 130 ASN OD1 O N N 131 ASN ND2 N N N 132 ASN OXT O N N 133 ASN H H N N 134 ASN H2 H N N 135 ASN HA H N N 136 ASN HB2 H N N 137 ASN HB3 H N N 138 ASN HD21 H N N 139 ASN HD22 H N N 140 ASN HXT H N N 141 ASP N N N N 142 ASP CA C N S 143 ASP C C N N 144 ASP O O N N 145 ASP CB C N N 146 ASP CG C N N 147 ASP OD1 O N N 148 ASP OD2 O N N 149 ASP OXT O N N 150 ASP H H N N 151 ASP H2 H N N 152 ASP HA H N N 153 ASP HB2 H N N 154 ASP HB3 H N N 155 ASP HD2 H N N 156 ASP HXT H N N 157 CYS N N N N 158 CYS CA C N R 159 CYS C C N N 160 CYS O O N N 161 CYS CB C N N 162 CYS SG S N N 163 CYS OXT O N N 164 CYS H H N N 165 CYS H2 H N N 166 CYS HA H N N 167 CYS HB2 H N N 168 CYS HB3 H N N 169 CYS HG H N N 170 CYS HXT H N N 171 GLN N N N N 172 GLN CA C N S 173 GLN C C N N 174 GLN O O N N 175 GLN CB C N N 176 GLN CG C N N 177 GLN CD C N N 178 GLN OE1 O N N 179 GLN NE2 N N N 180 GLN OXT O N N 181 GLN H H N N 182 GLN H2 H N N 183 GLN HA H N N 184 GLN HB2 H N N 185 GLN HB3 H N N 186 GLN HG2 H N N 187 GLN HG3 H N N 188 GLN HE21 H N N 189 GLN HE22 H N N 190 GLN HXT H N N 191 GLU N N N N 192 GLU CA C N S 193 GLU C C N N 194 GLU O O N N 195 GLU CB C N N 196 GLU CG C N N 197 GLU CD C N N 198 GLU OE1 O N N 199 GLU OE2 O N N 200 GLU OXT O N N 201 GLU H H N N 202 GLU H2 H N N 203 GLU HA H N N 204 GLU HB2 H N N 205 GLU HB3 H N N 206 GLU HG2 H N N 207 GLU HG3 H N N 208 GLU HE2 H N N 209 GLU HXT H N N 210 GLY N N N N 211 GLY CA C N N 212 GLY C C N N 213 GLY O O N N 214 GLY OXT O N N 215 GLY H H N N 216 GLY H2 H N N 217 GLY HA2 H N N 218 GLY HA3 H N N 219 GLY HXT H N N 220 HIS N N N N 221 HIS CA C N S 222 HIS C C N N 223 HIS O O N N 224 HIS CB C N N 225 HIS CG C Y N 226 HIS ND1 N Y N 227 HIS CD2 C Y N 228 HIS CE1 C Y N 229 HIS NE2 N Y N 230 HIS OXT O N N 231 HIS H H N N 232 HIS H2 H N N 233 HIS HA H N N 234 HIS HB2 H N N 235 HIS HB3 H N N 236 HIS HD1 H N N 237 HIS HD2 H N N 238 HIS HE1 H N N 239 HIS HE2 H N N 240 HIS HXT H N N 241 HOH O O N N 242 HOH H1 H N N 243 HOH H2 H N N 244 ILE N N N N 245 ILE CA C N S 246 ILE C C N N 247 ILE O O N N 248 ILE CB C N S 249 ILE CG1 C N N 250 ILE CG2 C N N 251 ILE CD1 C N N 252 ILE OXT O N N 253 ILE H H N N 254 ILE H2 H N N 255 ILE HA H N N 256 ILE HB H N N 257 ILE HG12 H N N 258 ILE HG13 H N N 259 ILE HG21 H N N 260 ILE HG22 H N N 261 ILE HG23 H N N 262 ILE HD11 H N N 263 ILE HD12 H N N 264 ILE HD13 H N N 265 ILE HXT H N N 266 IOD I I N N 267 LEU N N N N 268 LEU CA C N S 269 LEU C C N N 270 LEU O O N N 271 LEU CB C N N 272 LEU CG C N N 273 LEU CD1 C N N 274 LEU CD2 C N N 275 LEU OXT O N N 276 LEU H H N N 277 LEU H2 H N N 278 LEU HA H N N 279 LEU HB2 H N N 280 LEU HB3 H N N 281 LEU HG H N N 282 LEU HD11 H N N 283 LEU HD12 H N N 284 LEU HD13 H N N 285 LEU HD21 H N N 286 LEU HD22 H N N 287 LEU HD23 H N N 288 LEU HXT H N N 289 LYS N N N N 290 LYS CA C N S 291 LYS C C N N 292 LYS O O N N 293 LYS CB C N N 294 LYS CG C N N 295 LYS CD C N N 296 LYS CE C N N 297 LYS NZ N N N 298 LYS OXT O N N 299 LYS H H N N 300 LYS H2 H N N 301 LYS HA H N N 302 LYS HB2 H N N 303 LYS HB3 H N N 304 LYS HG2 H N N 305 LYS HG3 H N N 306 LYS HD2 H N N 307 LYS HD3 H N N 308 LYS HE2 H N N 309 LYS HE3 H N N 310 LYS HZ1 H N N 311 LYS HZ2 H N N 312 LYS HZ3 H N N 313 LYS HXT H N N 314 MET N N N N 315 MET CA C N S 316 MET C C N N 317 MET O O N N 318 MET CB C N N 319 MET CG C N N 320 MET SD S N N 321 MET CE C N N 322 MET OXT O N N 323 MET H H N N 324 MET H2 H N N 325 MET HA H N N 326 MET HB2 H N N 327 MET HB3 H N N 328 MET HG2 H N N 329 MET HG3 H N N 330 MET HE1 H N N 331 MET HE2 H N N 332 MET HE3 H N N 333 MET HXT H N N 334 PHE N N N N 335 PHE CA C N S 336 PHE C C N N 337 PHE O O N N 338 PHE CB C N N 339 PHE CG C Y N 340 PHE CD1 C Y N 341 PHE CD2 C Y N 342 PHE CE1 C Y N 343 PHE CE2 C Y N 344 PHE CZ C Y N 345 PHE OXT O N N 346 PHE H H N N 347 PHE H2 H N N 348 PHE HA H N N 349 PHE HB2 H N N 350 PHE HB3 H N N 351 PHE HD1 H N N 352 PHE HD2 H N N 353 PHE HE1 H N N 354 PHE HE2 H N N 355 PHE HZ H N N 356 PHE HXT H N N 357 PRO N N N N 358 PRO CA C N S 359 PRO C C N N 360 PRO O O N N 361 PRO CB C N N 362 PRO CG C N N 363 PRO CD C N N 364 PRO OXT O N N 365 PRO H H N N 366 PRO HA H N N 367 PRO HB2 H N N 368 PRO HB3 H N N 369 PRO HG2 H N N 370 PRO HG3 H N N 371 PRO HD2 H N N 372 PRO HD3 H N N 373 PRO HXT H N N 374 SER N N N N 375 SER CA C N S 376 SER C C N N 377 SER O O N N 378 SER CB C N N 379 SER OG O N N 380 SER OXT O N N 381 SER H H N N 382 SER H2 H N N 383 SER HA H N N 384 SER HB2 H N N 385 SER HB3 H N N 386 SER HG H N N 387 SER HXT H N N 388 THR N N N N 389 THR CA C N S 390 THR C C N N 391 THR O O N N 392 THR CB C N R 393 THR OG1 O N N 394 THR CG2 C N N 395 THR OXT O N N 396 THR H H N N 397 THR H2 H N N 398 THR HA H N N 399 THR HB H N N 400 THR HG1 H N N 401 THR HG21 H N N 402 THR HG22 H N N 403 THR HG23 H N N 404 THR HXT H N N 405 TRP N N N N 406 TRP CA C N S 407 TRP C C N N 408 TRP O O N N 409 TRP CB C N N 410 TRP CG C Y N 411 TRP CD1 C Y N 412 TRP CD2 C Y N 413 TRP NE1 N Y N 414 TRP CE2 C Y N 415 TRP CE3 C Y N 416 TRP CZ2 C Y N 417 TRP CZ3 C Y N 418 TRP CH2 C Y N 419 TRP OXT O N N 420 TRP H H N N 421 TRP H2 H N N 422 TRP HA H N N 423 TRP HB2 H N N 424 TRP HB3 H N N 425 TRP HD1 H N N 426 TRP HE1 H N N 427 TRP HE3 H N N 428 TRP HZ2 H N N 429 TRP HZ3 H N N 430 TRP HH2 H N N 431 TRP HXT H N N 432 TYR N N N N 433 TYR CA C N S 434 TYR C C N N 435 TYR O O N N 436 TYR CB C N N 437 TYR CG C Y N 438 TYR CD1 C Y N 439 TYR CD2 C Y N 440 TYR CE1 C Y N 441 TYR CE2 C Y N 442 TYR CZ C Y N 443 TYR OH O N N 444 TYR OXT O N N 445 TYR H H N N 446 TYR H2 H N N 447 TYR HA H N N 448 TYR HB2 H N N 449 TYR HB3 H N N 450 TYR HD1 H N N 451 TYR HD2 H N N 452 TYR HE1 H N N 453 TYR HE2 H N N 454 TYR HH H N N 455 TYR HXT H N N 456 VAL N N N N 457 VAL CA C N S 458 VAL C C N N 459 VAL O O N N 460 VAL CB C N N 461 VAL CG1 C N N 462 VAL CG2 C N N 463 VAL OXT O N N 464 VAL H H N N 465 VAL H2 H N N 466 VAL HA H N N 467 VAL HB H N N 468 VAL HG11 H N N 469 VAL HG12 H N N 470 VAL HG13 H N N 471 VAL HG21 H N N 472 VAL HG22 H N N 473 VAL HG23 H N N 474 VAL HXT H N N 475 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal AG7 C01 C02 sing N N 1 AG7 C01 O03 doub N N 2 AG7 C01 C57 sing N N 3 AG7 C02 C04 sing N N 4 AG7 C02 H2 sing N N 5 AG7 C02 H3 sing N N 6 AG7 C04 C05 sing N N 7 AG7 C04 C47 sing N N 8 AG7 C04 H27 sing N N 9 AG7 C05 C06 sing N N 10 AG7 C05 H28 sing N N 11 AG7 C05 H29 sing N N 12 AG7 C06 C07 doub Y N 13 AG7 C06 C11 sing Y N 14 AG7 C07 C08 sing Y N 15 AG7 C07 H30 sing N N 16 AG7 C08 C09 doub Y N 17 AG7 C08 H31 sing N N 18 AG7 C09 C10 sing Y N 19 AG7 C09 F1 sing N N 20 AG7 C10 C11 doub Y N 21 AG7 C10 H33 sing N N 22 AG7 C11 H34 sing N N 23 AG7 N12 C13 sing N N 24 AG7 N12 C47 sing N N 25 AG7 N12 H49 sing N N 26 AG7 C13 C14 sing N N 27 AG7 C13 C19 sing N N 28 AG7 C13 H91 sing N N 29 AG7 C14 C15 sing N N 30 AG7 C14 H35 sing N N 31 AG7 C14 H36 sing N N 32 AG7 C15 C16 sing N N 33 AG7 C15 C84 sing N N 34 AG7 C15 H94 sing N N 35 AG7 C16 N17 sing N N 36 AG7 C16 O18 doub N N 37 AG7 N17 C83 sing N N 38 AG7 N17 H39 sing N N 39 AG7 C19 C20 sing N N 40 AG7 C19 H191 sing N N 41 AG7 C19 H192 sing N N 42 AG7 C20 C21 sing N N 43 AG7 C20 H41 sing N N 44 AG7 C20 H42 sing N N 45 AG7 C21 O22 sing N N 46 AG7 C21 O23 doub N N 47 AG7 O22 C50 sing N N 48 AG7 C47 O48 doub N N 49 AG7 C50 C53 sing N N 50 AG7 C50 H51 sing N N 51 AG7 C50 H52 sing N N 52 AG7 C53 H53 sing N N 53 AG7 C53 H54 sing N N 54 AG7 C53 H56 sing N N 55 AG7 C57 N58 sing N N 56 AG7 C57 C78 sing N N 57 AG7 C57 H77 sing N N 58 AG7 N58 C59 sing N N 59 AG7 N58 H61 sing N N 60 AG7 C59 O60 doub N N 61 AG7 C59 C1 sing N N 62 AG7 C78 C81 sing N N 63 AG7 C78 C82 sing N N 64 AG7 C78 H79 sing N N 65 AG7 C81 H82 sing N N 66 AG7 C81 H84 sing N N 67 AG7 C81 H85 sing N N 68 AG7 C82 H86 sing N N 69 AG7 C82 H87 sing N N 70 AG7 C82 H88 sing N N 71 AG7 C83 C84 sing N N 72 AG7 C83 H89 sing N N 73 AG7 C83 H90 sing N N 74 AG7 C84 H92 sing N N 75 AG7 C84 H93 sing N N 76 AG7 C1 C2 sing Y N 77 AG7 C1 N5 doub Y N 78 AG7 C2 C3 doub Y N 79 AG7 C2 H8 sing N N 80 AG7 C3 O4 sing Y N 81 AG7 C3 C4 sing N N 82 AG7 O4 N5 sing Y N 83 AG7 C4 H5 sing N N 84 AG7 C4 H6 sing N N 85 AG7 C4 H7 sing N N 86 ALA N CA sing N N 87 ALA N H sing N N 88 ALA N H2 sing N N 89 ALA CA C sing N N 90 ALA CA CB sing N N 91 ALA CA HA sing N N 92 ALA C O doub N N 93 ALA C OXT sing N N 94 ALA CB HB1 sing N N 95 ALA CB HB2 sing N N 96 ALA CB HB3 sing N N 97 ALA OXT HXT sing N N 98 ARG N CA sing N N 99 ARG N H sing N N 100 ARG N H2 sing N N 101 ARG CA C sing N N 102 ARG CA CB sing N N 103 ARG CA HA sing N N 104 ARG C O doub N N 105 ARG C OXT sing N N 106 ARG CB CG sing N N 107 ARG CB HB2 sing N N 108 ARG CB HB3 sing N N 109 ARG CG CD sing N N 110 ARG CG HG2 sing N N 111 ARG CG HG3 sing N N 112 ARG CD NE sing N N 113 ARG CD HD2 sing N N 114 ARG CD HD3 sing N N 115 ARG NE CZ sing N N 116 ARG NE HE sing N N 117 ARG CZ NH1 sing N N 118 ARG CZ NH2 doub N N 119 ARG NH1 HH11 sing N N 120 ARG NH1 HH12 sing N N 121 ARG NH2 HH21 sing N N 122 ARG NH2 HH22 sing N N 123 ARG OXT HXT sing N N 124 ASN N CA sing N N 125 ASN N H sing N N 126 ASN N H2 sing N N 127 ASN CA C sing N N 128 ASN CA CB sing N N 129 ASN CA HA sing N N 130 ASN C O doub N N 131 ASN C OXT sing N N 132 ASN CB CG sing N N 133 ASN CB HB2 sing N N 134 ASN CB HB3 sing N N 135 ASN CG OD1 doub N N 136 ASN CG ND2 sing N N 137 ASN ND2 HD21 sing N N 138 ASN ND2 HD22 sing N N 139 ASN OXT HXT sing N N 140 ASP N CA sing N N 141 ASP N H sing N N 142 ASP N H2 sing N N 143 ASP CA C sing N N 144 ASP CA CB sing N N 145 ASP CA HA sing N N 146 ASP C O doub N N 147 ASP C OXT sing N N 148 ASP CB CG sing N N 149 ASP CB HB2 sing N N 150 ASP CB HB3 sing N N 151 ASP CG OD1 doub N N 152 ASP CG OD2 sing N N 153 ASP OD2 HD2 sing N N 154 ASP OXT HXT sing N N 155 CYS N CA sing N N 156 CYS N H sing N N 157 CYS N H2 sing N N 158 CYS CA C sing N N 159 CYS CA CB sing N N 160 CYS CA HA sing N N 161 CYS C O doub N N 162 CYS C OXT sing N N 163 CYS CB SG sing N N 164 CYS CB HB2 sing N N 165 CYS CB HB3 sing N N 166 CYS SG HG sing N N 167 CYS OXT HXT sing N N 168 GLN N CA sing N N 169 GLN N H sing N N 170 GLN N H2 sing N N 171 GLN CA C sing N N 172 GLN CA CB sing N N 173 GLN CA HA sing N N 174 GLN C O doub N N 175 GLN C OXT sing N N 176 GLN CB CG sing N N 177 GLN CB HB2 sing N N 178 GLN CB HB3 sing N N 179 GLN CG CD sing N N 180 GLN CG HG2 sing N N 181 GLN CG HG3 sing N N 182 GLN CD OE1 doub N N 183 GLN CD NE2 sing N N 184 GLN NE2 HE21 sing N N 185 GLN NE2 HE22 sing N N 186 GLN OXT HXT sing N N 187 GLU N CA sing N N 188 GLU N H sing N N 189 GLU N H2 sing N N 190 GLU CA C sing N N 191 GLU CA CB sing N N 192 GLU CA HA sing N N 193 GLU C O doub N N 194 GLU C OXT sing N N 195 GLU CB CG sing N N 196 GLU CB HB2 sing N N 197 GLU CB HB3 sing N N 198 GLU CG CD sing N N 199 GLU CG HG2 sing N N 200 GLU CG HG3 sing N N 201 GLU CD OE1 doub N N 202 GLU CD OE2 sing N N 203 GLU OE2 HE2 sing N N 204 GLU OXT HXT sing N N 205 GLY N CA sing N N 206 GLY N H sing N N 207 GLY N H2 sing N N 208 GLY CA C sing N N 209 GLY CA HA2 sing N N 210 GLY CA HA3 sing N N 211 GLY C O doub N N 212 GLY C OXT sing N N 213 GLY OXT HXT sing N N 214 HIS N CA sing N N 215 HIS N H sing N N 216 HIS N H2 sing N N 217 HIS CA C sing N N 218 HIS CA CB sing N N 219 HIS CA HA sing N N 220 HIS C O doub N N 221 HIS C OXT sing N N 222 HIS CB CG sing N N 223 HIS CB HB2 sing N N 224 HIS CB HB3 sing N N 225 HIS CG ND1 sing Y N 226 HIS CG CD2 doub Y N 227 HIS ND1 CE1 doub Y N 228 HIS ND1 HD1 sing N N 229 HIS CD2 NE2 sing Y N 230 HIS CD2 HD2 sing N N 231 HIS CE1 NE2 sing Y N 232 HIS CE1 HE1 sing N N 233 HIS NE2 HE2 sing N N 234 HIS OXT HXT sing N N 235 HOH O H1 sing N N 236 HOH O H2 sing N N 237 ILE N CA sing N N 238 ILE N H sing N N 239 ILE N H2 sing N N 240 ILE CA C sing N N 241 ILE CA CB sing N N 242 ILE CA HA sing N N 243 ILE C O doub N N 244 ILE C OXT sing N N 245 ILE CB CG1 sing N N 246 ILE CB CG2 sing N N 247 ILE CB HB sing N N 248 ILE CG1 CD1 sing N N 249 ILE CG1 HG12 sing N N 250 ILE CG1 HG13 sing N N 251 ILE CG2 HG21 sing N N 252 ILE CG2 HG22 sing N N 253 ILE CG2 HG23 sing N N 254 ILE CD1 HD11 sing N N 255 ILE CD1 HD12 sing N N 256 ILE CD1 HD13 sing N N 257 ILE OXT HXT sing N N 258 LEU N CA sing N N 259 LEU N H sing N N 260 LEU N H2 sing N N 261 LEU CA C sing N N 262 LEU CA CB sing N N 263 LEU CA HA sing N N 264 LEU C O doub N N 265 LEU C OXT sing N N 266 LEU CB CG sing N N 267 LEU CB HB2 sing N N 268 LEU CB HB3 sing N N 269 LEU CG CD1 sing N N 270 LEU CG CD2 sing N N 271 LEU CG HG sing N N 272 LEU CD1 HD11 sing N N 273 LEU CD1 HD12 sing N N 274 LEU CD1 HD13 sing N N 275 LEU CD2 HD21 sing N N 276 LEU CD2 HD22 sing N N 277 LEU CD2 HD23 sing N N 278 LEU OXT HXT sing N N 279 LYS N CA sing N N 280 LYS N H sing N N 281 LYS N H2 sing N N 282 LYS CA C sing N N 283 LYS CA CB sing N N 284 LYS CA HA sing N N 285 LYS C O doub N N 286 LYS C OXT sing N N 287 LYS CB CG sing N N 288 LYS CB HB2 sing N N 289 LYS CB HB3 sing N N 290 LYS CG CD sing N N 291 LYS CG HG2 sing N N 292 LYS CG HG3 sing N N 293 LYS CD CE sing N N 294 LYS CD HD2 sing N N 295 LYS CD HD3 sing N N 296 LYS CE NZ sing N N 297 LYS CE HE2 sing N N 298 LYS CE HE3 sing N N 299 LYS NZ HZ1 sing N N 300 LYS NZ HZ2 sing N N 301 LYS NZ HZ3 sing N N 302 LYS OXT HXT sing N N 303 MET N CA sing N N 304 MET N H sing N N 305 MET N H2 sing N N 306 MET CA C sing N N 307 MET CA CB sing N N 308 MET CA HA sing N N 309 MET C O doub N N 310 MET C OXT sing N N 311 MET CB CG sing N N 312 MET CB HB2 sing N N 313 MET CB HB3 sing N N 314 MET CG SD sing N N 315 MET CG HG2 sing N N 316 MET CG HG3 sing N N 317 MET SD CE sing N N 318 MET CE HE1 sing N N 319 MET CE HE2 sing N N 320 MET CE HE3 sing N N 321 MET OXT HXT sing N N 322 PHE N CA sing N N 323 PHE N H sing N N 324 PHE N H2 sing N N 325 PHE CA C sing N N 326 PHE CA CB sing N N 327 PHE CA HA sing N N 328 PHE C O doub N N 329 PHE C OXT sing N N 330 PHE CB CG sing N N 331 PHE CB HB2 sing N N 332 PHE CB HB3 sing N N 333 PHE CG CD1 doub Y N 334 PHE CG CD2 sing Y N 335 PHE CD1 CE1 sing Y N 336 PHE CD1 HD1 sing N N 337 PHE CD2 CE2 doub Y N 338 PHE CD2 HD2 sing N N 339 PHE CE1 CZ doub Y N 340 PHE CE1 HE1 sing N N 341 PHE CE2 CZ sing Y N 342 PHE CE2 HE2 sing N N 343 PHE CZ HZ sing N N 344 PHE OXT HXT sing N N 345 PRO N CA sing N N 346 PRO N CD sing N N 347 PRO N H sing N N 348 PRO CA C sing N N 349 PRO CA CB sing N N 350 PRO CA HA sing N N 351 PRO C O doub N N 352 PRO C OXT sing N N 353 PRO CB CG sing N N 354 PRO CB HB2 sing N N 355 PRO CB HB3 sing N N 356 PRO CG CD sing N N 357 PRO CG HG2 sing N N 358 PRO CG HG3 sing N N 359 PRO CD HD2 sing N N 360 PRO CD HD3 sing N N 361 PRO OXT HXT sing N N 362 SER N CA sing N N 363 SER N H sing N N 364 SER N H2 sing N N 365 SER CA C sing N N 366 SER CA CB sing N N 367 SER CA HA sing N N 368 SER C O doub N N 369 SER C OXT sing N N 370 SER CB OG sing N N 371 SER CB HB2 sing N N 372 SER CB HB3 sing N N 373 SER OG HG sing N N 374 SER OXT HXT sing N N 375 THR N CA sing N N 376 THR N H sing N N 377 THR N H2 sing N N 378 THR CA C sing N N 379 THR CA CB sing N N 380 THR CA HA sing N N 381 THR C O doub N N 382 THR C OXT sing N N 383 THR CB OG1 sing N N 384 THR CB CG2 sing N N 385 THR CB HB sing N N 386 THR OG1 HG1 sing N N 387 THR CG2 HG21 sing N N 388 THR CG2 HG22 sing N N 389 THR CG2 HG23 sing N N 390 THR OXT HXT sing N N 391 TRP N CA sing N N 392 TRP N H sing N N 393 TRP N H2 sing N N 394 TRP CA C sing N N 395 TRP CA CB sing N N 396 TRP CA HA sing N N 397 TRP C O doub N N 398 TRP C OXT sing N N 399 TRP CB CG sing N N 400 TRP CB HB2 sing N N 401 TRP CB HB3 sing N N 402 TRP CG CD1 doub Y N 403 TRP CG CD2 sing Y N 404 TRP CD1 NE1 sing Y N 405 TRP CD1 HD1 sing N N 406 TRP CD2 CE2 doub Y N 407 TRP CD2 CE3 sing Y N 408 TRP NE1 CE2 sing Y N 409 TRP NE1 HE1 sing N N 410 TRP CE2 CZ2 sing Y N 411 TRP CE3 CZ3 doub Y N 412 TRP CE3 HE3 sing N N 413 TRP CZ2 CH2 doub Y N 414 TRP CZ2 HZ2 sing N N 415 TRP CZ3 CH2 sing Y N 416 TRP CZ3 HZ3 sing N N 417 TRP CH2 HH2 sing N N 418 TRP OXT HXT sing N N 419 TYR N CA sing N N 420 TYR N H sing N N 421 TYR N H2 sing N N 422 TYR CA C sing N N 423 TYR CA CB sing N N 424 TYR CA HA sing N N 425 TYR C O doub N N 426 TYR C OXT sing N N 427 TYR CB CG sing N N 428 TYR CB HB2 sing N N 429 TYR CB HB3 sing N N 430 TYR CG CD1 doub Y N 431 TYR CG CD2 sing Y N 432 TYR CD1 CE1 sing Y N 433 TYR CD1 HD1 sing N N 434 TYR CD2 CE2 doub Y N 435 TYR CD2 HD2 sing N N 436 TYR CE1 CZ doub Y N 437 TYR CE1 HE1 sing N N 438 TYR CE2 CZ sing Y N 439 TYR CE2 HE2 sing N N 440 TYR CZ OH sing N N 441 TYR OH HH sing N N 442 TYR OXT HXT sing N N 443 VAL N CA sing N N 444 VAL N H sing N N 445 VAL N H2 sing N N 446 VAL CA C sing N N 447 VAL CA CB sing N N 448 VAL CA HA sing N N 449 VAL C O doub N N 450 VAL C OXT sing N N 451 VAL CB CG1 sing N N 452 VAL CB CG2 sing N N 453 VAL CB HB sing N N 454 VAL CG1 HG11 sing N N 455 VAL CG1 HG12 sing N N 456 VAL CG1 HG13 sing N N 457 VAL CG2 HG21 sing N N 458 VAL CG2 HG22 sing N N 459 VAL CG2 HG23 sing N N 460 VAL OXT HXT sing N N 461 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 'P01 AI057788' 1 'Robert A. Welch Foundation' 'United States' Q-1279 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6NIR _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9D9T _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.010168 _atom_sites.fract_transf_matrix[1][2] 0.005870 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011741 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021608 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? F ? ? 8.95735 ? ? ? 7.27484 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? I ? ? 40.26819 12.56501 ? ? 1.42647 27.02115 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_