data_9D9V # _entry.id 9D9V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9D9V pdb_00009d9v 10.2210/pdb9d9v/pdb WWPDB D_1000287263 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-04-09 ? 2 'Structure model' 1 1 2025-08-27 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9D9V _pdbx_database_status.recvd_initial_deposition_date 2024-08-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email kovallra@uc.edu _pdbx_contact_author.name_first Rhett _pdbx_contact_author.name_last Kovall _pdbx_contact_author.name_mi A _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0520-1613 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yuan, Z.' 1 0000-0002-2295-4505 'Kovall, R.A.' 2 0000-0003-0520-1613 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 4800 _citation.page_last 4800 _citation.title 'The ALX4 dimer structure provides insight into how disease alleles impact function.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-025-59728-9 _citation.pdbx_database_id_PubMed 40410151 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cain, B.' 1 0009-0006-1767-3019 primary 'Yuan, Z.' 2 ? primary 'Thoman, E.' 3 ? primary 'Kovall, R.A.' 4 0000-0003-0520-1613 primary 'Gebelein, B.' 5 0000-0001-9791-9061 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Homeobox protein aristaless-like 4' 9689.976 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 6 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPAAASNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERWSHPQFEK _entity_poly.pdbx_seq_one_letter_code_can GPAAASNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERWSHPQFEK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 ALA n 1 4 ALA n 1 5 ALA n 1 6 SER n 1 7 ASN n 1 8 LYS n 1 9 GLY n 1 10 LYS n 1 11 LYS n 1 12 ARG n 1 13 ARG n 1 14 ASN n 1 15 ARG n 1 16 THR n 1 17 THR n 1 18 PHE n 1 19 THR n 1 20 SER n 1 21 TYR n 1 22 GLN n 1 23 LEU n 1 24 GLU n 1 25 GLU n 1 26 LEU n 1 27 GLU n 1 28 LYS n 1 29 VAL n 1 30 PHE n 1 31 GLN n 1 32 LYS n 1 33 THR n 1 34 HIS n 1 35 TYR n 1 36 PRO n 1 37 ASP n 1 38 VAL n 1 39 TYR n 1 40 ALA n 1 41 ARG n 1 42 GLU n 1 43 GLN n 1 44 LEU n 1 45 ALA n 1 46 MET n 1 47 ARG n 1 48 THR n 1 49 ASP n 1 50 LEU n 1 51 THR n 1 52 GLU n 1 53 ALA n 1 54 ARG n 1 55 VAL n 1 56 GLN n 1 57 VAL n 1 58 TRP n 1 59 PHE n 1 60 GLN n 1 61 ASN n 1 62 ARG n 1 63 ARG n 1 64 ALA n 1 65 LYS n 1 66 TRP n 1 67 ARG n 1 68 LYS n 1 69 ARG n 1 70 GLU n 1 71 ARG n 1 72 TRP n 1 73 SER n 1 74 HIS n 1 75 PRO n 1 76 GLN n 1 77 PHE n 1 78 GLU n 1 79 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 79 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ALX4, KIAA1788' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 204 ? ? ? A . n A 1 2 PRO 2 205 ? ? ? A . n A 1 3 ALA 3 206 ? ? ? A . n A 1 4 ALA 4 207 ? ? ? A . n A 1 5 ALA 5 208 ? ? ? A . n A 1 6 SER 6 209 ? ? ? A . n A 1 7 ASN 7 210 ? ? ? A . n A 1 8 LYS 8 211 ? ? ? A . n A 1 9 GLY 9 212 ? ? ? A . n A 1 10 LYS 10 213 ? ? ? A . n A 1 11 LYS 11 214 ? ? ? A . n A 1 12 ARG 12 215 ? ? ? A . n A 1 13 ARG 13 216 ? ? ? A . n A 1 14 ASN 14 217 ? ? ? A . n A 1 15 ARG 15 218 218 ARG ARG A . n A 1 16 THR 16 219 219 THR THR A . n A 1 17 THR 17 220 220 THR THR A . n A 1 18 PHE 18 221 221 PHE PHE A . n A 1 19 THR 19 222 222 THR THR A . n A 1 20 SER 20 223 223 SER SER A . n A 1 21 TYR 21 224 224 TYR TYR A . n A 1 22 GLN 22 225 225 GLN GLN A . n A 1 23 LEU 23 226 226 LEU LEU A . n A 1 24 GLU 24 227 227 GLU GLU A . n A 1 25 GLU 25 228 228 GLU GLU A . n A 1 26 LEU 26 229 229 LEU LEU A . n A 1 27 GLU 27 230 230 GLU GLU A . n A 1 28 LYS 28 231 231 LYS LYS A . n A 1 29 VAL 29 232 232 VAL VAL A . n A 1 30 PHE 30 233 233 PHE PHE A . n A 1 31 GLN 31 234 234 GLN GLN A . n A 1 32 LYS 32 235 235 LYS LYS A . n A 1 33 THR 33 236 236 THR THR A . n A 1 34 HIS 34 237 237 HIS HIS A . n A 1 35 TYR 35 238 238 TYR TYR A . n A 1 36 PRO 36 239 239 PRO PRO A . n A 1 37 ASP 37 240 240 ASP ASP A . n A 1 38 VAL 38 241 241 VAL VAL A . n A 1 39 TYR 39 242 242 TYR TYR A . n A 1 40 ALA 40 243 243 ALA ALA A . n A 1 41 ARG 41 244 244 ARG ARG A . n A 1 42 GLU 42 245 245 GLU GLU A . n A 1 43 GLN 43 246 246 GLN GLN A . n A 1 44 LEU 44 247 247 LEU LEU A . n A 1 45 ALA 45 248 248 ALA ALA A . n A 1 46 MET 46 249 249 MET MET A . n A 1 47 ARG 47 250 250 ARG ARG A . n A 1 48 THR 48 251 251 THR THR A . n A 1 49 ASP 49 252 252 ASP ASP A . n A 1 50 LEU 50 253 253 LEU LEU A . n A 1 51 THR 51 254 254 THR THR A . n A 1 52 GLU 52 255 255 GLU GLU A . n A 1 53 ALA 53 256 256 ALA ALA A . n A 1 54 ARG 54 257 257 ARG ARG A . n A 1 55 VAL 55 258 258 VAL VAL A . n A 1 56 GLN 56 259 259 GLN GLN A . n A 1 57 VAL 57 260 260 VAL VAL A . n A 1 58 TRP 58 261 261 TRP TRP A . n A 1 59 PHE 59 262 262 PHE PHE A . n A 1 60 GLN 60 263 263 GLN GLN A . n A 1 61 ASN 61 264 264 ASN ASN A . n A 1 62 ARG 62 265 265 ARG ARG A . n A 1 63 ARG 63 266 266 ARG ARG A . n A 1 64 ALA 64 267 267 ALA ALA A . n A 1 65 LYS 65 268 268 LYS LYS A . n A 1 66 TRP 66 269 269 TRP TRP A . n A 1 67 ARG 67 270 270 ARG ARG A . n A 1 68 LYS 68 271 271 LYS LYS A . n A 1 69 ARG 69 272 272 ARG ARG A . n A 1 70 GLU 70 273 273 GLU GLU A . n A 1 71 ARG 71 274 274 ARG ARG A . n A 1 72 TRP 72 275 275 TRP TRP A . n A 1 73 SER 73 276 276 SER SER A . n A 1 74 HIS 74 277 277 HIS HIS A . n A 1 75 PRO 75 278 278 PRO PRO A . n A 1 76 GLN 76 279 279 GLN GLN A . n A 1 77 PHE 77 280 280 PHE PHE A . n A 1 78 GLU 78 281 ? ? ? A . n A 1 79 LYS 79 282 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 301 1 EDO EDO A . C 2 EDO 1 302 2 EDO EDO A . D 2 EDO 1 303 3 EDO EDO A . E 2 EDO 1 304 4 EDO EDO A . F 2 EDO 1 305 5 EDO EDO A . G 2 EDO 1 306 6 EDO EDO A . H 3 HOH 1 401 1 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 218 ? CG ? A ARG 15 CG 2 1 Y 1 A ARG 218 ? CD ? A ARG 15 CD 3 1 Y 1 A ARG 218 ? NE ? A ARG 15 NE 4 1 Y 1 A ARG 218 ? CZ ? A ARG 15 CZ 5 1 Y 1 A ARG 218 ? NH1 ? A ARG 15 NH1 6 1 Y 1 A ARG 218 ? NH2 ? A ARG 15 NH2 7 1 Y 1 A PHE 280 ? CG ? A PHE 77 CG 8 1 Y 1 A PHE 280 ? CD1 ? A PHE 77 CD1 9 1 Y 1 A PHE 280 ? CD2 ? A PHE 77 CD2 10 1 Y 1 A PHE 280 ? CE1 ? A PHE 77 CE1 11 1 Y 1 A PHE 280 ? CE2 ? A PHE 77 CE2 12 1 Y 1 A PHE 280 ? CZ ? A PHE 77 CZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(dev_4788: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? pointless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9D9V _cell.details ? _cell.formula_units_Z ? _cell.length_a 95.780 _cell.length_a_esd ? _cell.length_b 95.780 _cell.length_b_esd ? _cell.length_c 95.780 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9D9V _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9D9V _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.78 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67.45 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M MgCl2, 0.1M KCl, 0.1M PIPES pH=7.0, 20% PEG Smear Medium' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 277 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-12-08 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97872 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97872 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9D9V _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.39 _reflns.d_resolution_low 67.73 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5957 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.83 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.122 _reflns.pdbx_Rpim_I_all 0.026 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 130519 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.119 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.39 _reflns_shell.d_res_low 2.48 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 12377 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 626 _reflns_shell.percent_possible_obs 100.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 19.8 _reflns_shell.pdbx_chi_squared 0.75 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.3 _reflns_shell.pdbx_Rrim_I_all 2.884 _reflns_shell.pdbx_Rpim_I_all 0.646 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.495 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.810 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9D9V _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.39 _refine.ls_d_res_low 33.86 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5952 _refine.ls_number_reflns_R_free 596 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.97 _refine.ls_percent_reflns_R_free 10.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2177 _refine.ls_R_factor_R_free 0.2486 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2141 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.91 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.43 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.39 _refine_hist.d_res_low 33.86 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 578 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 553 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 586 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.016 ? 779 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 8.936 ? 79 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 77 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.014 ? 98 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.39 2.63 . . 147 1326 100.00 . . . . 0.3460 . . . . . . . . . . . 0.3784 'X-RAY DIFFRACTION' 2.63 3.01 . . 145 1322 100.00 . . . . 0.2750 . . . . . . . . . . . 0.3713 'X-RAY DIFFRACTION' 3.01 3.79 . . 148 1337 100.00 . . . . 0.2674 . . . . . . . . . . . 0.2899 'X-RAY DIFFRACTION' 3.80 33.86 . . 156 1371 100.00 . . . . 0.1656 . . . . . . . . . . . 0.1994 # _struct.entry_id 9D9V _struct.title 'X-Ray structure of ALX4 homeodomain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9D9V _struct_keywords.text 'ALX4, paired-like homeodomain, transcription factor, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ALX4_HUMAN _struct_ref.pdbx_db_accession Q9H161 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRER _struct_ref.pdbx_align_begin 209 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9D9V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H161 _struct_ref_seq.db_align_beg 209 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 274 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 209 _struct_ref_seq.pdbx_auth_seq_align_end 274 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9D9V GLY A 1 ? UNP Q9H161 ? ? 'expression tag' 204 1 1 9D9V PRO A 2 ? UNP Q9H161 ? ? 'expression tag' 205 2 1 9D9V ALA A 3 ? UNP Q9H161 ? ? 'expression tag' 206 3 1 9D9V ALA A 4 ? UNP Q9H161 ? ? 'expression tag' 207 4 1 9D9V ALA A 5 ? UNP Q9H161 ? ? 'expression tag' 208 5 1 9D9V TRP A 72 ? UNP Q9H161 ? ? 'expression tag' 275 6 1 9D9V SER A 73 ? UNP Q9H161 ? ? 'expression tag' 276 7 1 9D9V HIS A 74 ? UNP Q9H161 ? ? 'expression tag' 277 8 1 9D9V PRO A 75 ? UNP Q9H161 ? ? 'expression tag' 278 9 1 9D9V GLN A 76 ? UNP Q9H161 ? ? 'expression tag' 279 10 1 9D9V PHE A 77 ? UNP Q9H161 ? ? 'expression tag' 280 11 1 9D9V GLU A 78 ? UNP Q9H161 ? ? 'expression tag' 281 12 1 9D9V LYS A 79 ? UNP Q9H161 ? ? 'expression tag' 282 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 19 ? THR A 33 ? THR A 222 THR A 236 1 ? 15 HELX_P HELX_P2 AA2 ASP A 37 ? ASP A 49 ? ASP A 240 ASP A 252 1 ? 13 HELX_P HELX_P3 AA3 THR A 51 ? TRP A 72 ? THR A 254 TRP A 275 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9D9V _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 204 ? A GLY 1 2 1 Y 1 A PRO 205 ? A PRO 2 3 1 Y 1 A ALA 206 ? A ALA 3 4 1 Y 1 A ALA 207 ? A ALA 4 5 1 Y 1 A ALA 208 ? A ALA 5 6 1 Y 1 A SER 209 ? A SER 6 7 1 Y 1 A ASN 210 ? A ASN 7 8 1 Y 1 A LYS 211 ? A LYS 8 9 1 Y 1 A GLY 212 ? A GLY 9 10 1 Y 1 A LYS 213 ? A LYS 10 11 1 Y 1 A LYS 214 ? A LYS 11 12 1 Y 1 A ARG 215 ? A ARG 12 13 1 Y 1 A ARG 216 ? A ARG 13 14 1 Y 1 A ASN 217 ? A ASN 14 15 1 Y 1 A GLU 281 ? A GLU 78 16 1 Y 1 A LYS 282 ? A LYS 79 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 EDO C1 C N N 74 EDO O1 O N N 75 EDO C2 C N N 76 EDO O2 O N N 77 EDO H11 H N N 78 EDO H12 H N N 79 EDO HO1 H N N 80 EDO H21 H N N 81 EDO H22 H N N 82 EDO HO2 H N N 83 GLN N N N N 84 GLN CA C N S 85 GLN C C N N 86 GLN O O N N 87 GLN CB C N N 88 GLN CG C N N 89 GLN CD C N N 90 GLN OE1 O N N 91 GLN NE2 N N N 92 GLN OXT O N N 93 GLN H H N N 94 GLN H2 H N N 95 GLN HA H N N 96 GLN HB2 H N N 97 GLN HB3 H N N 98 GLN HG2 H N N 99 GLN HG3 H N N 100 GLN HE21 H N N 101 GLN HE22 H N N 102 GLN HXT H N N 103 GLU N N N N 104 GLU CA C N S 105 GLU C C N N 106 GLU O O N N 107 GLU CB C N N 108 GLU CG C N N 109 GLU CD C N N 110 GLU OE1 O N N 111 GLU OE2 O N N 112 GLU OXT O N N 113 GLU H H N N 114 GLU H2 H N N 115 GLU HA H N N 116 GLU HB2 H N N 117 GLU HB3 H N N 118 GLU HG2 H N N 119 GLU HG3 H N N 120 GLU HE2 H N N 121 GLU HXT H N N 122 GLY N N N N 123 GLY CA C N N 124 GLY C C N N 125 GLY O O N N 126 GLY OXT O N N 127 GLY H H N N 128 GLY H2 H N N 129 GLY HA2 H N N 130 GLY HA3 H N N 131 GLY HXT H N N 132 HIS N N N N 133 HIS CA C N S 134 HIS C C N N 135 HIS O O N N 136 HIS CB C N N 137 HIS CG C Y N 138 HIS ND1 N Y N 139 HIS CD2 C Y N 140 HIS CE1 C Y N 141 HIS NE2 N Y N 142 HIS OXT O N N 143 HIS H H N N 144 HIS H2 H N N 145 HIS HA H N N 146 HIS HB2 H N N 147 HIS HB3 H N N 148 HIS HD1 H N N 149 HIS HD2 H N N 150 HIS HE1 H N N 151 HIS HE2 H N N 152 HIS HXT H N N 153 HOH O O N N 154 HOH H1 H N N 155 HOH H2 H N N 156 LEU N N N N 157 LEU CA C N S 158 LEU C C N N 159 LEU O O N N 160 LEU CB C N N 161 LEU CG C N N 162 LEU CD1 C N N 163 LEU CD2 C N N 164 LEU OXT O N N 165 LEU H H N N 166 LEU H2 H N N 167 LEU HA H N N 168 LEU HB2 H N N 169 LEU HB3 H N N 170 LEU HG H N N 171 LEU HD11 H N N 172 LEU HD12 H N N 173 LEU HD13 H N N 174 LEU HD21 H N N 175 LEU HD22 H N N 176 LEU HD23 H N N 177 LEU HXT H N N 178 LYS N N N N 179 LYS CA C N S 180 LYS C C N N 181 LYS O O N N 182 LYS CB C N N 183 LYS CG C N N 184 LYS CD C N N 185 LYS CE C N N 186 LYS NZ N N N 187 LYS OXT O N N 188 LYS H H N N 189 LYS H2 H N N 190 LYS HA H N N 191 LYS HB2 H N N 192 LYS HB3 H N N 193 LYS HG2 H N N 194 LYS HG3 H N N 195 LYS HD2 H N N 196 LYS HD3 H N N 197 LYS HE2 H N N 198 LYS HE3 H N N 199 LYS HZ1 H N N 200 LYS HZ2 H N N 201 LYS HZ3 H N N 202 LYS HXT H N N 203 MET N N N N 204 MET CA C N S 205 MET C C N N 206 MET O O N N 207 MET CB C N N 208 MET CG C N N 209 MET SD S N N 210 MET CE C N N 211 MET OXT O N N 212 MET H H N N 213 MET H2 H N N 214 MET HA H N N 215 MET HB2 H N N 216 MET HB3 H N N 217 MET HG2 H N N 218 MET HG3 H N N 219 MET HE1 H N N 220 MET HE2 H N N 221 MET HE3 H N N 222 MET HXT H N N 223 PHE N N N N 224 PHE CA C N S 225 PHE C C N N 226 PHE O O N N 227 PHE CB C N N 228 PHE CG C Y N 229 PHE CD1 C Y N 230 PHE CD2 C Y N 231 PHE CE1 C Y N 232 PHE CE2 C Y N 233 PHE CZ C Y N 234 PHE OXT O N N 235 PHE H H N N 236 PHE H2 H N N 237 PHE HA H N N 238 PHE HB2 H N N 239 PHE HB3 H N N 240 PHE HD1 H N N 241 PHE HD2 H N N 242 PHE HE1 H N N 243 PHE HE2 H N N 244 PHE HZ H N N 245 PHE HXT H N N 246 PRO N N N N 247 PRO CA C N S 248 PRO C C N N 249 PRO O O N N 250 PRO CB C N N 251 PRO CG C N N 252 PRO CD C N N 253 PRO OXT O N N 254 PRO H H N N 255 PRO HA H N N 256 PRO HB2 H N N 257 PRO HB3 H N N 258 PRO HG2 H N N 259 PRO HG3 H N N 260 PRO HD2 H N N 261 PRO HD3 H N N 262 PRO HXT H N N 263 SER N N N N 264 SER CA C N S 265 SER C C N N 266 SER O O N N 267 SER CB C N N 268 SER OG O N N 269 SER OXT O N N 270 SER H H N N 271 SER H2 H N N 272 SER HA H N N 273 SER HB2 H N N 274 SER HB3 H N N 275 SER HG H N N 276 SER HXT H N N 277 THR N N N N 278 THR CA C N S 279 THR C C N N 280 THR O O N N 281 THR CB C N R 282 THR OG1 O N N 283 THR CG2 C N N 284 THR OXT O N N 285 THR H H N N 286 THR H2 H N N 287 THR HA H N N 288 THR HB H N N 289 THR HG1 H N N 290 THR HG21 H N N 291 THR HG22 H N N 292 THR HG23 H N N 293 THR HXT H N N 294 TRP N N N N 295 TRP CA C N S 296 TRP C C N N 297 TRP O O N N 298 TRP CB C N N 299 TRP CG C Y N 300 TRP CD1 C Y N 301 TRP CD2 C Y N 302 TRP NE1 N Y N 303 TRP CE2 C Y N 304 TRP CE3 C Y N 305 TRP CZ2 C Y N 306 TRP CZ3 C Y N 307 TRP CH2 C Y N 308 TRP OXT O N N 309 TRP H H N N 310 TRP H2 H N N 311 TRP HA H N N 312 TRP HB2 H N N 313 TRP HB3 H N N 314 TRP HD1 H N N 315 TRP HE1 H N N 316 TRP HE3 H N N 317 TRP HZ2 H N N 318 TRP HZ3 H N N 319 TRP HH2 H N N 320 TRP HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 EDO C1 O1 sing N N 70 EDO C1 C2 sing N N 71 EDO C1 H11 sing N N 72 EDO C1 H12 sing N N 73 EDO O1 HO1 sing N N 74 EDO C2 O2 sing N N 75 EDO C2 H21 sing N N 76 EDO C2 H22 sing N N 77 EDO O2 HO2 sing N N 78 GLN N CA sing N N 79 GLN N H sing N N 80 GLN N H2 sing N N 81 GLN CA C sing N N 82 GLN CA CB sing N N 83 GLN CA HA sing N N 84 GLN C O doub N N 85 GLN C OXT sing N N 86 GLN CB CG sing N N 87 GLN CB HB2 sing N N 88 GLN CB HB3 sing N N 89 GLN CG CD sing N N 90 GLN CG HG2 sing N N 91 GLN CG HG3 sing N N 92 GLN CD OE1 doub N N 93 GLN CD NE2 sing N N 94 GLN NE2 HE21 sing N N 95 GLN NE2 HE22 sing N N 96 GLN OXT HXT sing N N 97 GLU N CA sing N N 98 GLU N H sing N N 99 GLU N H2 sing N N 100 GLU CA C sing N N 101 GLU CA CB sing N N 102 GLU CA HA sing N N 103 GLU C O doub N N 104 GLU C OXT sing N N 105 GLU CB CG sing N N 106 GLU CB HB2 sing N N 107 GLU CB HB3 sing N N 108 GLU CG CD sing N N 109 GLU CG HG2 sing N N 110 GLU CG HG3 sing N N 111 GLU CD OE1 doub N N 112 GLU CD OE2 sing N N 113 GLU OE2 HE2 sing N N 114 GLU OXT HXT sing N N 115 GLY N CA sing N N 116 GLY N H sing N N 117 GLY N H2 sing N N 118 GLY CA C sing N N 119 GLY CA HA2 sing N N 120 GLY CA HA3 sing N N 121 GLY C O doub N N 122 GLY C OXT sing N N 123 GLY OXT HXT sing N N 124 HIS N CA sing N N 125 HIS N H sing N N 126 HIS N H2 sing N N 127 HIS CA C sing N N 128 HIS CA CB sing N N 129 HIS CA HA sing N N 130 HIS C O doub N N 131 HIS C OXT sing N N 132 HIS CB CG sing N N 133 HIS CB HB2 sing N N 134 HIS CB HB3 sing N N 135 HIS CG ND1 sing Y N 136 HIS CG CD2 doub Y N 137 HIS ND1 CE1 doub Y N 138 HIS ND1 HD1 sing N N 139 HIS CD2 NE2 sing Y N 140 HIS CD2 HD2 sing N N 141 HIS CE1 NE2 sing Y N 142 HIS CE1 HE1 sing N N 143 HIS NE2 HE2 sing N N 144 HIS OXT HXT sing N N 145 HOH O H1 sing N N 146 HOH O H2 sing N N 147 LEU N CA sing N N 148 LEU N H sing N N 149 LEU N H2 sing N N 150 LEU CA C sing N N 151 LEU CA CB sing N N 152 LEU CA HA sing N N 153 LEU C O doub N N 154 LEU C OXT sing N N 155 LEU CB CG sing N N 156 LEU CB HB2 sing N N 157 LEU CB HB3 sing N N 158 LEU CG CD1 sing N N 159 LEU CG CD2 sing N N 160 LEU CG HG sing N N 161 LEU CD1 HD11 sing N N 162 LEU CD1 HD12 sing N N 163 LEU CD1 HD13 sing N N 164 LEU CD2 HD21 sing N N 165 LEU CD2 HD22 sing N N 166 LEU CD2 HD23 sing N N 167 LEU OXT HXT sing N N 168 LYS N CA sing N N 169 LYS N H sing N N 170 LYS N H2 sing N N 171 LYS CA C sing N N 172 LYS CA CB sing N N 173 LYS CA HA sing N N 174 LYS C O doub N N 175 LYS C OXT sing N N 176 LYS CB CG sing N N 177 LYS CB HB2 sing N N 178 LYS CB HB3 sing N N 179 LYS CG CD sing N N 180 LYS CG HG2 sing N N 181 LYS CG HG3 sing N N 182 LYS CD CE sing N N 183 LYS CD HD2 sing N N 184 LYS CD HD3 sing N N 185 LYS CE NZ sing N N 186 LYS CE HE2 sing N N 187 LYS CE HE3 sing N N 188 LYS NZ HZ1 sing N N 189 LYS NZ HZ2 sing N N 190 LYS NZ HZ3 sing N N 191 LYS OXT HXT sing N N 192 MET N CA sing N N 193 MET N H sing N N 194 MET N H2 sing N N 195 MET CA C sing N N 196 MET CA CB sing N N 197 MET CA HA sing N N 198 MET C O doub N N 199 MET C OXT sing N N 200 MET CB CG sing N N 201 MET CB HB2 sing N N 202 MET CB HB3 sing N N 203 MET CG SD sing N N 204 MET CG HG2 sing N N 205 MET CG HG3 sing N N 206 MET SD CE sing N N 207 MET CE HE1 sing N N 208 MET CE HE2 sing N N 209 MET CE HE3 sing N N 210 MET OXT HXT sing N N 211 PHE N CA sing N N 212 PHE N H sing N N 213 PHE N H2 sing N N 214 PHE CA C sing N N 215 PHE CA CB sing N N 216 PHE CA HA sing N N 217 PHE C O doub N N 218 PHE C OXT sing N N 219 PHE CB CG sing N N 220 PHE CB HB2 sing N N 221 PHE CB HB3 sing N N 222 PHE CG CD1 doub Y N 223 PHE CG CD2 sing Y N 224 PHE CD1 CE1 sing Y N 225 PHE CD1 HD1 sing N N 226 PHE CD2 CE2 doub Y N 227 PHE CD2 HD2 sing N N 228 PHE CE1 CZ doub Y N 229 PHE CE1 HE1 sing N N 230 PHE CE2 CZ sing Y N 231 PHE CE2 HE2 sing N N 232 PHE CZ HZ sing N N 233 PHE OXT HXT sing N N 234 PRO N CA sing N N 235 PRO N CD sing N N 236 PRO N H sing N N 237 PRO CA C sing N N 238 PRO CA CB sing N N 239 PRO CA HA sing N N 240 PRO C O doub N N 241 PRO C OXT sing N N 242 PRO CB CG sing N N 243 PRO CB HB2 sing N N 244 PRO CB HB3 sing N N 245 PRO CG CD sing N N 246 PRO CG HG2 sing N N 247 PRO CG HG3 sing N N 248 PRO CD HD2 sing N N 249 PRO CD HD3 sing N N 250 PRO OXT HXT sing N N 251 SER N CA sing N N 252 SER N H sing N N 253 SER N H2 sing N N 254 SER CA C sing N N 255 SER CA CB sing N N 256 SER CA HA sing N N 257 SER C O doub N N 258 SER C OXT sing N N 259 SER CB OG sing N N 260 SER CB HB2 sing N N 261 SER CB HB3 sing N N 262 SER OG HG sing N N 263 SER OXT HXT sing N N 264 THR N CA sing N N 265 THR N H sing N N 266 THR N H2 sing N N 267 THR CA C sing N N 268 THR CA CB sing N N 269 THR CA HA sing N N 270 THR C O doub N N 271 THR C OXT sing N N 272 THR CB OG1 sing N N 273 THR CB CG2 sing N N 274 THR CB HB sing N N 275 THR OG1 HG1 sing N N 276 THR CG2 HG21 sing N N 277 THR CG2 HG22 sing N N 278 THR CG2 HG23 sing N N 279 THR OXT HXT sing N N 280 TRP N CA sing N N 281 TRP N H sing N N 282 TRP N H2 sing N N 283 TRP CA C sing N N 284 TRP CA CB sing N N 285 TRP CA HA sing N N 286 TRP C O doub N N 287 TRP C OXT sing N N 288 TRP CB CG sing N N 289 TRP CB HB2 sing N N 290 TRP CB HB3 sing N N 291 TRP CG CD1 doub Y N 292 TRP CG CD2 sing Y N 293 TRP CD1 NE1 sing Y N 294 TRP CD1 HD1 sing N N 295 TRP CD2 CE2 doub Y N 296 TRP CD2 CE3 sing Y N 297 TRP NE1 CE2 sing Y N 298 TRP NE1 HE1 sing N N 299 TRP CE2 CZ2 sing Y N 300 TRP CE3 CZ3 doub Y N 301 TRP CE3 HE3 sing N N 302 TRP CZ2 CH2 doub Y N 303 TRP CZ2 HZ2 sing N N 304 TRP CZ3 CH2 sing Y N 305 TRP CZ3 HZ3 sing N N 306 TRP CH2 HH2 sing N N 307 TRP OXT HXT sing N N 308 TYR N CA sing N N 309 TYR N H sing N N 310 TYR N H2 sing N N 311 TYR CA C sing N N 312 TYR CA CB sing N N 313 TYR CA HA sing N N 314 TYR C O doub N N 315 TYR C OXT sing N N 316 TYR CB CG sing N N 317 TYR CB HB2 sing N N 318 TYR CB HB3 sing N N 319 TYR CG CD1 doub Y N 320 TYR CG CD2 sing Y N 321 TYR CD1 CE1 sing Y N 322 TYR CD1 HD1 sing N N 323 TYR CD2 CE2 doub Y N 324 TYR CD2 HD2 sing N N 325 TYR CE1 CZ doub Y N 326 TYR CE1 HE1 sing N N 327 TYR CE2 CZ sing Y N 328 TYR CE2 HE2 sing N N 329 TYR CZ OH sing N N 330 TYR OH HH sing N N 331 TYR OXT HXT sing N N 332 VAL N CA sing N N 333 VAL N H sing N N 334 VAL N H2 sing N N 335 VAL CA C sing N N 336 VAL CA CB sing N N 337 VAL CA HA sing N N 338 VAL C O doub N N 339 VAL C OXT sing N N 340 VAL CB CG1 sing N N 341 VAL CB CG2 sing N N 342 VAL CB HB sing N N 343 VAL CG1 HG11 sing N N 344 VAL CG1 HG12 sing N N 345 VAL CG1 HG13 sing N N 346 VAL CG2 HG21 sing N N 347 VAL CG2 HG22 sing N N 348 VAL CG2 HG23 sing N N 349 VAL OXT HXT sing N N 350 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Center for Advancing Translational Sciences (NIH/NCATS)' 'United States' 1R03TR004875 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 5R01GM079428 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1fjl _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9D9V _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.010441 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010441 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010441 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #