data_9DCJ # _entry.id 9DCJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.412 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9DCJ pdb_00009dcj 10.2210/pdb9dcj/pdb WWPDB D_1000286101 ? ? BMRB 31198 ? 10.13018/BMR31198 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-09-24 ? 2 'Structure model' 1 1 2026-04-08 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9DCJ _pdbx_database_status.recvd_initial_deposition_date 2024-08-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Pentameric Structure of MERS-CoV Envelope Protein Transmembrane Domain Determined by Solid-State NMR' _pdbx_database_related.db_id 31198 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email meihong@mit.edu _pdbx_contact_author.name_first Mei _pdbx_contact_author.name_last Hong _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5255-5858 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sucec, I.' 1 0000-0002-1192-7800 'Hong, M.' 2 0000-0001-5255-5858 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first eadx1788 _citation.page_last eadx1788 _citation.title 'Ion channel structure and function of the MERS coronavirus E protein.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.adx1788 _citation.pdbx_database_id_PubMed 40632851 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sucec, I.' 1 0000-0002-1192-7800 primary 'Xia, B.' 2 0000-0002-6154-2415 primary 'Somberg, N.H.' 3 0000-0002-5222-0334 primary 'Wang, Y.' 4 ? primary 'Jo, H.' 5 0000-0002-4863-0779 primary 'Li, S.' 6 ? primary 'Perrone, B.' 7 ? primary 'Gao, Z.' 8 0000-0001-8931-5508 primary 'Hong, M.' 9 0000-0001-5255-5858 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Envelope small membrane protein' _entity.formula_weight 4309.228 _entity.pdbx_number_of_molecules 5 _entity.pdbx_ec ? _entity.pdbx_mutation 'C23S, C30S' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'E protein,sM protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MLPFVQERIGLFIVNFFIFTVVSAITLLVSMAFLTATR _entity_poly.pdbx_seq_one_letter_code_can MLPFVQERIGLFIVNFFIFTVVSAITLLVSMAFLTATR _entity_poly.pdbx_strand_id A,B,C,D,E _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 PRO n 1 4 PHE n 1 5 VAL n 1 6 GLN n 1 7 GLU n 1 8 ARG n 1 9 ILE n 1 10 GLY n 1 11 LEU n 1 12 PHE n 1 13 ILE n 1 14 VAL n 1 15 ASN n 1 16 PHE n 1 17 PHE n 1 18 ILE n 1 19 PHE n 1 20 THR n 1 21 VAL n 1 22 VAL n 1 23 SER n 1 24 ALA n 1 25 ILE n 1 26 THR n 1 27 LEU n 1 28 LEU n 1 29 VAL n 1 30 SER n 1 31 MET n 1 32 ALA n 1 33 PHE n 1 34 LEU n 1 35 THR n 1 36 ALA n 1 37 THR n 1 38 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 38 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'E, sM, 4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'isolate United Kingdom/H123990006/2012' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Betacoronavirus England 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1263720 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ARG 38 38 38 ARG ARG A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 LEU 2 2 2 LEU LEU B . n B 1 3 PRO 3 3 3 PRO PRO B . n B 1 4 PHE 4 4 4 PHE PHE B . n B 1 5 VAL 5 5 5 VAL VAL B . n B 1 6 GLN 6 6 6 GLN GLN B . n B 1 7 GLU 7 7 7 GLU GLU B . n B 1 8 ARG 8 8 8 ARG ARG B . n B 1 9 ILE 9 9 9 ILE ILE B . n B 1 10 GLY 10 10 10 GLY GLY B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 PHE 12 12 12 PHE PHE B . n B 1 13 ILE 13 13 13 ILE ILE B . n B 1 14 VAL 14 14 14 VAL VAL B . n B 1 15 ASN 15 15 15 ASN ASN B . n B 1 16 PHE 16 16 16 PHE PHE B . n B 1 17 PHE 17 17 17 PHE PHE B . n B 1 18 ILE 18 18 18 ILE ILE B . n B 1 19 PHE 19 19 19 PHE PHE B . n B 1 20 THR 20 20 20 THR THR B . n B 1 21 VAL 21 21 21 VAL VAL B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 SER 23 23 23 SER SER B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 ILE 25 25 25 ILE ILE B . n B 1 26 THR 26 26 26 THR THR B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 SER 30 30 30 SER SER B . n B 1 31 MET 31 31 31 MET MET B . n B 1 32 ALA 32 32 32 ALA ALA B . n B 1 33 PHE 33 33 33 PHE PHE B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 THR 35 35 35 THR THR B . n B 1 36 ALA 36 36 36 ALA ALA B . n B 1 37 THR 37 37 37 THR THR B . n B 1 38 ARG 38 38 38 ARG ARG B . n C 1 1 MET 1 1 1 MET MET C . n C 1 2 LEU 2 2 2 LEU LEU C . n C 1 3 PRO 3 3 3 PRO PRO C . n C 1 4 PHE 4 4 4 PHE PHE C . n C 1 5 VAL 5 5 5 VAL VAL C . n C 1 6 GLN 6 6 6 GLN GLN C . n C 1 7 GLU 7 7 7 GLU GLU C . n C 1 8 ARG 8 8 8 ARG ARG C . n C 1 9 ILE 9 9 9 ILE ILE C . n C 1 10 GLY 10 10 10 GLY GLY C . n C 1 11 LEU 11 11 11 LEU LEU C . n C 1 12 PHE 12 12 12 PHE PHE C . n C 1 13 ILE 13 13 13 ILE ILE C . n C 1 14 VAL 14 14 14 VAL VAL C . n C 1 15 ASN 15 15 15 ASN ASN C . n C 1 16 PHE 16 16 16 PHE PHE C . n C 1 17 PHE 17 17 17 PHE PHE C . n C 1 18 ILE 18 18 18 ILE ILE C . n C 1 19 PHE 19 19 19 PHE PHE C . n C 1 20 THR 20 20 20 THR THR C . n C 1 21 VAL 21 21 21 VAL VAL C . n C 1 22 VAL 22 22 22 VAL VAL C . n C 1 23 SER 23 23 23 SER SER C . n C 1 24 ALA 24 24 24 ALA ALA C . n C 1 25 ILE 25 25 25 ILE ILE C . n C 1 26 THR 26 26 26 THR THR C . n C 1 27 LEU 27 27 27 LEU LEU C . n C 1 28 LEU 28 28 28 LEU LEU C . n C 1 29 VAL 29 29 29 VAL VAL C . n C 1 30 SER 30 30 30 SER SER C . n C 1 31 MET 31 31 31 MET MET C . n C 1 32 ALA 32 32 32 ALA ALA C . n C 1 33 PHE 33 33 33 PHE PHE C . n C 1 34 LEU 34 34 34 LEU LEU C . n C 1 35 THR 35 35 35 THR THR C . n C 1 36 ALA 36 36 36 ALA ALA C . n C 1 37 THR 37 37 37 THR THR C . n C 1 38 ARG 38 38 38 ARG ARG C . n D 1 1 MET 1 1 1 MET MET D . n D 1 2 LEU 2 2 2 LEU LEU D . n D 1 3 PRO 3 3 3 PRO PRO D . n D 1 4 PHE 4 4 4 PHE PHE D . n D 1 5 VAL 5 5 5 VAL VAL D . n D 1 6 GLN 6 6 6 GLN GLN D . n D 1 7 GLU 7 7 7 GLU GLU D . n D 1 8 ARG 8 8 8 ARG ARG D . n D 1 9 ILE 9 9 9 ILE ILE D . n D 1 10 GLY 10 10 10 GLY GLY D . n D 1 11 LEU 11 11 11 LEU LEU D . n D 1 12 PHE 12 12 12 PHE PHE D . n D 1 13 ILE 13 13 13 ILE ILE D . n D 1 14 VAL 14 14 14 VAL VAL D . n D 1 15 ASN 15 15 15 ASN ASN D . n D 1 16 PHE 16 16 16 PHE PHE D . n D 1 17 PHE 17 17 17 PHE PHE D . n D 1 18 ILE 18 18 18 ILE ILE D . n D 1 19 PHE 19 19 19 PHE PHE D . n D 1 20 THR 20 20 20 THR THR D . n D 1 21 VAL 21 21 21 VAL VAL D . n D 1 22 VAL 22 22 22 VAL VAL D . n D 1 23 SER 23 23 23 SER SER D . n D 1 24 ALA 24 24 24 ALA ALA D . n D 1 25 ILE 25 25 25 ILE ILE D . n D 1 26 THR 26 26 26 THR THR D . n D 1 27 LEU 27 27 27 LEU LEU D . n D 1 28 LEU 28 28 28 LEU LEU D . n D 1 29 VAL 29 29 29 VAL VAL D . n D 1 30 SER 30 30 30 SER SER D . n D 1 31 MET 31 31 31 MET MET D . n D 1 32 ALA 32 32 32 ALA ALA D . n D 1 33 PHE 33 33 33 PHE PHE D . n D 1 34 LEU 34 34 34 LEU LEU D . n D 1 35 THR 35 35 35 THR THR D . n D 1 36 ALA 36 36 36 ALA ALA D . n D 1 37 THR 37 37 37 THR THR D . n D 1 38 ARG 38 38 38 ARG ARG D . n E 1 1 MET 1 1 1 MET MET E . n E 1 2 LEU 2 2 2 LEU LEU E . n E 1 3 PRO 3 3 3 PRO PRO E . n E 1 4 PHE 4 4 4 PHE PHE E . n E 1 5 VAL 5 5 5 VAL VAL E . n E 1 6 GLN 6 6 6 GLN GLN E . n E 1 7 GLU 7 7 7 GLU GLU E . n E 1 8 ARG 8 8 8 ARG ARG E . n E 1 9 ILE 9 9 9 ILE ILE E . n E 1 10 GLY 10 10 10 GLY GLY E . n E 1 11 LEU 11 11 11 LEU LEU E . n E 1 12 PHE 12 12 12 PHE PHE E . n E 1 13 ILE 13 13 13 ILE ILE E . n E 1 14 VAL 14 14 14 VAL VAL E . n E 1 15 ASN 15 15 15 ASN ASN E . n E 1 16 PHE 16 16 16 PHE PHE E . n E 1 17 PHE 17 17 17 PHE PHE E . n E 1 18 ILE 18 18 18 ILE ILE E . n E 1 19 PHE 19 19 19 PHE PHE E . n E 1 20 THR 20 20 20 THR THR E . n E 1 21 VAL 21 21 21 VAL VAL E . n E 1 22 VAL 22 22 22 VAL VAL E . n E 1 23 SER 23 23 23 SER SER E . n E 1 24 ALA 24 24 24 ALA ALA E . n E 1 25 ILE 25 25 25 ILE ILE E . n E 1 26 THR 26 26 26 THR THR E . n E 1 27 LEU 27 27 27 LEU LEU E . n E 1 28 LEU 28 28 28 LEU LEU E . n E 1 29 VAL 29 29 29 VAL VAL E . n E 1 30 SER 30 30 30 SER SER E . n E 1 31 MET 31 31 31 MET MET E . n E 1 32 ALA 32 32 32 ALA ALA E . n E 1 33 PHE 33 33 33 PHE PHE E . n E 1 34 LEU 34 34 34 LEU LEU E . n E 1 35 THR 35 35 35 THR THR E . n E 1 36 ALA 36 36 36 ALA ALA E . n E 1 37 THR 37 37 37 THR THR E . n E 1 38 ARG 38 38 38 ARG ARG E . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9DCJ _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLID-STATE NMR' _exptl.method_details ? # _struct.entry_id 9DCJ _struct.title 'Pentameric Structure of MERS-CoV Envelope Protein Transmembrane Domain Determined by Solid-State NMR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9DCJ _struct_keywords.text 'viroporin, MERS-CoV, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VEMP_MERS1 _struct_ref.pdbx_db_accession K9N5R3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATR _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9DCJ A 1 ? 38 ? K9N5R3 1 ? 38 ? 1 38 2 1 9DCJ B 1 ? 38 ? K9N5R3 1 ? 38 ? 1 38 3 1 9DCJ C 1 ? 38 ? K9N5R3 1 ? 38 ? 1 38 4 1 9DCJ D 1 ? 38 ? K9N5R3 1 ? 38 ? 1 38 5 1 9DCJ E 1 ? 38 ? K9N5R3 1 ? 38 ? 1 38 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9DCJ SER A 23 ? UNP K9N5R3 CYS 23 'engineered mutation' 23 1 1 9DCJ SER A 30 ? UNP K9N5R3 CYS 30 'engineered mutation' 30 2 2 9DCJ SER B 23 ? UNP K9N5R3 CYS 23 'engineered mutation' 23 3 2 9DCJ SER B 30 ? UNP K9N5R3 CYS 30 'engineered mutation' 30 4 3 9DCJ SER C 23 ? UNP K9N5R3 CYS 23 'engineered mutation' 23 5 3 9DCJ SER C 30 ? UNP K9N5R3 CYS 30 'engineered mutation' 30 6 4 9DCJ SER D 23 ? UNP K9N5R3 CYS 23 'engineered mutation' 23 7 4 9DCJ SER D 30 ? UNP K9N5R3 CYS 30 'engineered mutation' 30 8 5 9DCJ SER E 23 ? UNP K9N5R3 CYS 23 'engineered mutation' 23 9 5 9DCJ SER E 30 ? UNP K9N5R3 CYS 30 'engineered mutation' 30 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details pentameric _pdbx_struct_assembly.oligomeric_count 5 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 7 ? ARG A 38 ? GLU A 7 ARG A 38 1 ? 32 HELX_P HELX_P2 AA2 GLU B 7 ? ARG B 38 ? GLU B 7 ARG B 38 1 ? 32 HELX_P HELX_P3 AA3 GLU C 7 ? ARG C 38 ? GLU C 7 ARG C 38 1 ? 32 HELX_P HELX_P4 AA4 GLU D 7 ? ARG D 38 ? GLU D 7 ARG D 38 1 ? 32 HELX_P HELX_P5 AA5 GLU E 7 ? ARG E 38 ? GLU E 7 ARG E 38 1 ? 32 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9DCJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 3 ? ? -74.46 -169.90 2 1 PHE A 4 ? ? 60.44 81.13 3 1 GLU A 7 ? ? -130.90 -36.01 4 1 PRO B 3 ? ? -74.48 -169.82 5 1 PHE B 4 ? ? 60.37 81.12 6 1 GLU B 7 ? ? -130.91 -35.97 7 1 PRO C 3 ? ? -74.40 -169.94 8 1 PHE C 4 ? ? 60.50 81.11 9 1 GLU C 7 ? ? -130.84 -36.00 10 1 PRO D 3 ? ? -74.44 -169.89 11 1 PHE D 4 ? ? 60.41 81.08 12 1 GLU D 7 ? ? -130.89 -36.01 13 1 PRO E 3 ? ? -74.41 -169.86 14 1 PHE E 4 ? ? 60.39 81.16 15 1 GLU E 7 ? ? -130.89 -35.98 16 2 PHE A 4 ? ? -160.68 -57.91 17 2 PHE B 4 ? ? -160.60 -58.07 18 2 PHE C 4 ? ? -160.65 -58.01 19 2 PHE D 4 ? ? -160.69 -57.97 20 2 PHE E 4 ? ? -160.60 -58.10 21 3 LEU A 2 ? ? 59.66 76.13 22 3 GLU A 7 ? ? -146.56 -38.41 23 3 LEU B 2 ? ? 59.70 76.14 24 3 GLU B 7 ? ? -146.46 -38.48 25 3 LEU C 2 ? ? 59.76 76.14 26 3 GLU C 7 ? ? -146.56 -38.50 27 3 LEU D 2 ? ? 59.67 76.08 28 3 GLU D 7 ? ? -146.56 -38.45 29 3 LEU E 2 ? ? 59.55 76.15 30 3 GLU E 7 ? ? -146.62 -38.49 31 4 VAL A 5 ? ? 64.07 141.83 32 4 GLN A 6 ? ? 60.67 158.48 33 4 GLU A 7 ? ? -141.50 39.80 34 4 ARG A 8 ? ? 59.98 89.85 35 4 VAL B 5 ? ? 64.07 141.82 36 4 GLN B 6 ? ? 60.76 158.35 37 4 GLU B 7 ? ? -141.43 39.92 38 4 ARG B 8 ? ? 59.90 89.83 39 4 VAL C 5 ? ? 64.01 141.84 40 4 GLN C 6 ? ? 60.73 158.50 41 4 GLU C 7 ? ? -141.58 39.83 42 4 ARG C 8 ? ? 60.03 89.82 43 4 VAL D 5 ? ? 63.99 141.87 44 4 GLN D 6 ? ? 60.74 158.50 45 4 GLU D 7 ? ? -141.64 39.84 46 4 ARG D 8 ? ? 60.05 89.76 47 4 VAL E 5 ? ? 63.98 141.82 48 4 GLN E 6 ? ? 60.69 158.50 49 4 GLU E 7 ? ? -141.58 39.78 50 4 ARG E 8 ? ? 59.99 89.81 51 5 GLU A 7 ? ? 60.78 -172.64 52 5 GLU B 7 ? ? 60.77 -172.73 53 5 GLU C 7 ? ? 60.94 -172.68 54 5 GLU D 7 ? ? 60.82 -172.72 55 5 GLU E 7 ? ? 60.81 -172.72 56 6 LEU A 2 ? ? -168.98 -60.83 57 6 PHE A 4 ? ? -154.17 -52.44 58 6 GLN A 6 ? ? 61.00 99.96 59 6 ARG A 8 ? ? 57.99 92.61 60 6 LEU B 2 ? ? -168.92 -60.92 61 6 PHE B 4 ? ? -154.20 -52.42 62 6 GLN B 6 ? ? 60.99 99.96 63 6 ARG B 8 ? ? 57.98 92.55 64 6 LEU C 2 ? ? -169.00 -60.85 65 6 PHE C 4 ? ? -154.26 -52.41 66 6 GLN C 6 ? ? 60.95 100.02 67 6 ARG C 8 ? ? 58.04 92.62 68 6 LEU D 2 ? ? -168.93 -60.94 69 6 PHE D 4 ? ? -154.14 -52.38 70 6 GLN D 6 ? ? 61.06 99.91 71 6 ARG D 8 ? ? 57.99 92.66 72 6 LEU E 2 ? ? -168.95 -60.89 73 6 PHE E 4 ? ? -154.22 -52.36 74 6 GLN E 6 ? ? 60.99 99.89 75 6 ARG E 8 ? ? 58.05 92.64 76 7 PHE A 4 ? ? -66.44 85.81 77 7 VAL A 5 ? ? 62.93 78.18 78 7 GLN A 6 ? ? -170.03 77.93 79 7 ARG A 8 ? ? 56.19 91.80 80 7 PHE B 4 ? ? -66.49 85.85 81 7 VAL B 5 ? ? 62.86 78.18 82 7 GLN B 6 ? ? -170.00 77.95 83 7 ARG B 8 ? ? 56.28 91.71 84 7 PHE C 4 ? ? -66.47 85.85 85 7 VAL C 5 ? ? 62.79 78.15 86 7 GLN C 6 ? ? -169.94 78.03 87 7 ARG C 8 ? ? 56.21 91.76 88 7 PHE D 4 ? ? -66.46 85.81 89 7 VAL D 5 ? ? 62.89 78.19 90 7 GLN D 6 ? ? -169.99 78.01 91 7 ARG D 8 ? ? 56.28 91.78 92 7 PHE E 4 ? ? -66.54 85.91 93 7 VAL E 5 ? ? 62.91 78.11 94 7 GLN E 6 ? ? -169.98 78.04 95 7 ARG E 8 ? ? 56.23 91.81 96 8 LEU A 2 ? ? -171.70 -52.92 97 8 PRO A 3 ? ? -57.99 173.52 98 8 PHE A 4 ? ? -137.06 -56.07 99 8 VAL A 5 ? ? -154.88 72.96 100 8 GLN A 6 ? ? -154.21 39.28 101 8 ARG A 8 ? ? 58.88 88.23 102 8 LEU B 2 ? ? -171.74 -52.86 103 8 PRO B 3 ? ? -58.05 173.65 104 8 PHE B 4 ? ? -137.12 -56.11 105 8 VAL B 5 ? ? -154.84 72.87 106 8 GLN B 6 ? ? -154.17 39.25 107 8 ARG B 8 ? ? 58.93 88.23 108 8 LEU C 2 ? ? -171.76 -52.98 109 8 PRO C 3 ? ? -58.06 173.62 110 8 PHE C 4 ? ? -137.14 -56.12 111 8 VAL C 5 ? ? -154.85 73.03 112 8 GLN C 6 ? ? -154.24 39.26 113 8 ARG C 8 ? ? 58.77 88.23 114 8 LEU D 2 ? ? -171.72 -52.78 115 8 PRO D 3 ? ? -58.12 173.52 116 8 PHE D 4 ? ? -137.08 -56.01 117 8 VAL D 5 ? ? -154.86 72.82 118 8 GLN D 6 ? ? -154.04 39.06 119 8 ARG D 8 ? ? 58.86 88.28 120 8 LEU E 2 ? ? -171.82 -52.97 121 8 PRO E 3 ? ? -58.10 173.66 122 8 PHE E 4 ? ? -137.14 -56.05 123 8 VAL E 5 ? ? -154.83 72.88 124 8 GLN E 6 ? ? -154.14 39.22 125 8 ARG E 8 ? ? 58.69 88.38 126 9 PHE A 4 ? ? 60.49 167.48 127 9 GLN A 6 ? ? -154.96 -51.41 128 9 PHE B 4 ? ? 60.61 167.42 129 9 GLN B 6 ? ? -154.94 -51.42 130 9 PHE C 4 ? ? 60.55 167.47 131 9 GLN C 6 ? ? -154.96 -51.39 132 9 PHE D 4 ? ? 60.63 167.47 133 9 GLN D 6 ? ? -154.90 -51.39 134 9 PHE E 4 ? ? 60.60 167.42 135 9 GLN E 6 ? ? -154.96 -51.38 136 10 PRO A 3 ? ? -55.80 -173.77 137 10 PRO B 3 ? ? -55.70 -173.81 138 10 PRO C 3 ? ? -55.59 -173.85 139 10 PRO D 3 ? ? -55.69 -173.82 140 10 PRO E 3 ? ? -55.68 -173.83 # _pdbx_nmr_ensemble.entry_id 9DCJ _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9DCJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '15 % w/w [U-13C; U-15N] MERS ENTM, 23 % w/w POPC, 10 % w/w POPE, 11 % w/w POPS, 4 % w/w cholesterol, 38 % w/w water, 95% H2O/5% D2O' '95% H2O/5% D2O' 'U-13C, 15N' liposome 'P:L=1:25; POPC/POPE/POPS/chol.' 2 ;8 % w/w 1,3-glycerol, 2-glycerol 13C MERS ENTM, 21 % w/w POPC, 9 % w/w POPE, 10 % w/w POPS, 4 % w/w cholesterol, 41 % w/w water, 95% H2O/5% D2O ; '95% H2O/5% D2O' 'mixed 1,3-13C : 2-13C, 15N (1:1)' liposome 'P:L=1:18; POPC/POPE/POPS/chol.' 3 '8 % w/w [U-13C; U-15N] MERS ENTM, 21 % w/w POPC, 9 % w/w POPE, 10 % w/w POPS, 4 % w/w cholesterol, 41 % w/w water, 95% H2O/5% D2O' '95% H2O/5% D2O' 'mixed 15N : 13C (1:1)' liposome 'P:L=1:18; POPC/POPE/POPS/chol.' 5 ;8 % w/w 1,3 glycerol [U-13C; U-15N] MERS ENTM, 21 % w/w POPC, 9 % w/w POPE, 10 % w/w POPS, 4 % w/w cholesterol, 41 % w/w water, 95% H2O/5% D2O ; '95% H2O/5% D2O' 'mixed 1,3-13C : 15N (1:1)' liposome 'P:L=1:18; POPC/POPE/POPS/chol.' 4 '17 % w/w 19F MERS ENTM, 21 % w/w POPC, 9 % w/w POPE, 9 % w/w POPS, 3 % w/w cholesterol, 40 % w/w water, 95% H2O/5% D2O' '95% H2O/5% D2O' '19F-Phe19 1:15' liposome 'P:L=1:15; POPC/POPE/POPS/chol.' 8 '20 % w/w 19F MERS ENTM, 19 % w/w POPC, 8 % w/w POPE, 9 % w/w POPS, 3 % w/w cholesterol, 40 % w/w water, 95% H2O/5% D2O' '95% H2O/5% D2O' '19F-Phe19 1:12' liposome 'P:L=1:12; POPC/POPE/POPS/chol.' 6 '10 % w/w 19F MERS ENTM, 24 % w/w POPC, 10 % w/w POPE, 11 % w/w POPS, 4 % w/w cholesterol, 40 % w/w water, 95% H2O/5% D2O' '95% H2O/5% D2O' '19F-Phe19 1:30' liposome 'P:L=1:30; POPC/POPE/POPS/chol.' 7 '15 % w/w [U-13C; U-15N] MERS ENTM, 38 % w/w POPC, 10 % w/w POPG, 38 % w/w water, 95% H2O/5% D2O' '95% H2O/5% D2O' 'U-13C, 15N; POPC/POPG' liposome 'P:L=1:18; POPC/POPG' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'MERS ENTM' 15 ? '% w/w' '[U-13C; U-15N]' 1 POPC 23 ? '% w/w' 'natural abundance' 1 POPE 10 ? '% w/w' 'natural abundance' 1 POPS 11 ? '% w/w' 'natural abundance' 1 cholesterol 4 ? '% w/w' 'natural abundance' 1 water 38 ? '% w/w' 'natural abundance' 2 'MERS ENTM' 8 ? '% w/w' '1,3-glycerol, 2-glycerol 13C' 2 POPC 21 ? '% w/w' 'natural abundance' 2 POPE 9 ? '% w/w' 'natural abundance' 2 POPS 10 ? '% w/w' 'natural abundance' 2 cholesterol 4 ? '% w/w' 'natural abundance' 2 water 41 ? '% w/w' 'natural abundance' 3 'MERS ENTM' 8 ? '% w/w' '[U-13C; U-15N]' 3 POPC 21 ? '% w/w' 'natural abundance' 3 POPE 9 ? '% w/w' 'natural abundance' 3 POPS 10 ? '% w/w' 'natural abundance' 3 cholesterol 4 ? '% w/w' 'natural abundance' 3 water 41 ? '% w/w' 'natural abundance' 5 'MERS ENTM' 8 ? '% w/w' '1,3 glycerol [U-13C; U-15N]' 5 POPC 21 ? '% w/w' 'natural abundance' 5 POPE 9 ? '% w/w' 'natural abundance' 5 POPS 10 ? '% w/w' 'natural abundance' 5 cholesterol 4 ? '% w/w' 'natural abundance' 5 water 41 ? '% w/w' 'natural abundance' 4 'MERS ENTM' 17 ? '% w/w' 19F 4 POPC 21 ? '% w/w' 'natural abundance' 4 POPE 9 ? '% w/w' 'natural abundance' 4 POPS 9 ? '% w/w' 'natural abundance' 4 cholesterol 3 ? '% w/w' 'natural abundance' 4 water 40 ? '% w/w' 'natural abundance' 8 'MERS ENTM' 20 ? '% w/w' 19F 8 POPC 19 ? '% w/w' 'natural abundance' 8 POPE 8 ? '% w/w' 'natural abundance' 8 POPS 9 ? '% w/w' 'natural abundance' 8 cholesterol 3 ? '% w/w' 'natural abundance' 8 water 40 ? '% w/w' 'natural abundance' 6 'MERS ENTM' 10 ? '% w/w' 19F 6 POPC 24 ? '% w/w' 'natural abundance' 6 POPE 10 ? '% w/w' 'natural abundance' 6 POPS 11 ? '% w/w' 'natural abundance' 6 cholesterol 4 ? '% w/w' 'natural abundance' 6 water 40 ? '% w/w' 'natural abundance' 7 'MERS ENTM' 15 ? '% w/w' '[U-13C; U-15N]' 7 POPC 38 ? '% w/w' 'natural abundance' 7 POPG 10 ? '% w/w' 'natural abundance' 7 water 38 ? '% w/w' 'natural abundance' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 290 atm 1 7.4 0.025 ? ? M 'pH 7.4, 20 mM tris, 20 mM NaCl' ? pH ? ? K 2 286 atm 1 4.5 0.1 ? ? M 'pH 4.5, 25 mM NaOAc,25 mM NaCl + 25 mM CaCl2' ? pH ? ? K 3 288 atm 1 7.5 0.2 ? ? M 'pH 7.5 20 mM tris + 200 mM KCl' ? pH ? ? K 4 253 atm 1 7.4 0.025 'pH 7.4, 20 mM tris, 20 mM NaCl' ? M -20C ? pH ? ? K 5 303 atm 1 7.4 0.025 'pH 7.4, 20 mM tris, 20 mM NaCl' ? M 30C ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D NCaCx' 1 isotropic 2 1 1 '3D NCoCx' 1 isotropic 3 1 1 '3D CoNCa' 1 isotropic 4 1 1 '2D CC 100 ms' 1 isotropic 5 1 1 '3D CCC' 3 isotropic 20 1 1 '3D NCaCx' 3 isotropic 6 1 2 '2D CC 300 ms' 3 isotropic 7 1 3 '2D NhhC 2 ms' 2 isotropic 8 1 5 '2D NhhC 2 ms' 1 isotropic 17 1 5 '2D CC 300 ms' 1 isotropic 9 4 4 '1D CODEX' 2 isotropic 10 4 8 '1D CODEX' 2 isotropic 11 4 6 '1D CODEX' 2 isotropic 12 1 4 '2D HF HETCOR' 2 isotropic 13 5 7 '2D DIPSHIFT' 1 isotropic 14 1 1 '2D NCa water-ed' 1 isotropic 18 2 1 '2D CC 24 ms' 1 isotropic 15 2 1 '2D NCa water-ed' 1 isotropic 19 3 1 '2D CC 24 ms' 1 isotropic 16 3 1 '2D NCa water-ed' 1 isotropic # _pdbx_nmr_refine.entry_id 9DCJ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 'CcpNmr Analysis' v3 CCPN 2 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 collection TopSpin ? 'Bruker Biospin' 4 'peak picking' 'CcpNmr Analysis' v3 CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 ILE N N N N 121 ILE CA C N S 122 ILE C C N N 123 ILE O O N N 124 ILE CB C N S 125 ILE CG1 C N N 126 ILE CG2 C N N 127 ILE CD1 C N N 128 ILE OXT O N N 129 ILE H H N N 130 ILE H2 H N N 131 ILE HA H N N 132 ILE HB H N N 133 ILE HG12 H N N 134 ILE HG13 H N N 135 ILE HG21 H N N 136 ILE HG22 H N N 137 ILE HG23 H N N 138 ILE HD11 H N N 139 ILE HD12 H N N 140 ILE HD13 H N N 141 ILE HXT H N N 142 LEU N N N N 143 LEU CA C N S 144 LEU C C N N 145 LEU O O N N 146 LEU CB C N N 147 LEU CG C N N 148 LEU CD1 C N N 149 LEU CD2 C N N 150 LEU OXT O N N 151 LEU H H N N 152 LEU H2 H N N 153 LEU HA H N N 154 LEU HB2 H N N 155 LEU HB3 H N N 156 LEU HG H N N 157 LEU HD11 H N N 158 LEU HD12 H N N 159 LEU HD13 H N N 160 LEU HD21 H N N 161 LEU HD22 H N N 162 LEU HD23 H N N 163 LEU HXT H N N 164 MET N N N N 165 MET CA C N S 166 MET C C N N 167 MET O O N N 168 MET CB C N N 169 MET CG C N N 170 MET SD S N N 171 MET CE C N N 172 MET OXT O N N 173 MET H H N N 174 MET H2 H N N 175 MET HA H N N 176 MET HB2 H N N 177 MET HB3 H N N 178 MET HG2 H N N 179 MET HG3 H N N 180 MET HE1 H N N 181 MET HE2 H N N 182 MET HE3 H N N 183 MET HXT H N N 184 PHE N N N N 185 PHE CA C N S 186 PHE C C N N 187 PHE O O N N 188 PHE CB C N N 189 PHE CG C Y N 190 PHE CD1 C Y N 191 PHE CD2 C Y N 192 PHE CE1 C Y N 193 PHE CE2 C Y N 194 PHE CZ C Y N 195 PHE OXT O N N 196 PHE H H N N 197 PHE H2 H N N 198 PHE HA H N N 199 PHE HB2 H N N 200 PHE HB3 H N N 201 PHE HD1 H N N 202 PHE HD2 H N N 203 PHE HE1 H N N 204 PHE HE2 H N N 205 PHE HZ H N N 206 PHE HXT H N N 207 PRO N N N N 208 PRO CA C N S 209 PRO C C N N 210 PRO O O N N 211 PRO CB C N N 212 PRO CG C N N 213 PRO CD C N N 214 PRO OXT O N N 215 PRO H H N N 216 PRO HA H N N 217 PRO HB2 H N N 218 PRO HB3 H N N 219 PRO HG2 H N N 220 PRO HG3 H N N 221 PRO HD2 H N N 222 PRO HD3 H N N 223 PRO HXT H N N 224 SER N N N N 225 SER CA C N S 226 SER C C N N 227 SER O O N N 228 SER CB C N N 229 SER OG O N N 230 SER OXT O N N 231 SER H H N N 232 SER H2 H N N 233 SER HA H N N 234 SER HB2 H N N 235 SER HB3 H N N 236 SER HG H N N 237 SER HXT H N N 238 THR N N N N 239 THR CA C N S 240 THR C C N N 241 THR O O N N 242 THR CB C N R 243 THR OG1 O N N 244 THR CG2 C N N 245 THR OXT O N N 246 THR H H N N 247 THR H2 H N N 248 THR HA H N N 249 THR HB H N N 250 THR HG1 H N N 251 THR HG21 H N N 252 THR HG22 H N N 253 THR HG23 H N N 254 THR HXT H N N 255 VAL N N N N 256 VAL CA C N S 257 VAL C C N N 258 VAL O O N N 259 VAL CB C N N 260 VAL CG1 C N N 261 VAL CG2 C N N 262 VAL OXT O N N 263 VAL H H N N 264 VAL H2 H N N 265 VAL HA H N N 266 VAL HB H N N 267 VAL HG11 H N N 268 VAL HG12 H N N 269 VAL HG13 H N N 270 VAL HG21 H N N 271 VAL HG22 H N N 272 VAL HG23 H N N 273 VAL HXT H N N 274 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 ILE N CA sing N N 114 ILE N H sing N N 115 ILE N H2 sing N N 116 ILE CA C sing N N 117 ILE CA CB sing N N 118 ILE CA HA sing N N 119 ILE C O doub N N 120 ILE C OXT sing N N 121 ILE CB CG1 sing N N 122 ILE CB CG2 sing N N 123 ILE CB HB sing N N 124 ILE CG1 CD1 sing N N 125 ILE CG1 HG12 sing N N 126 ILE CG1 HG13 sing N N 127 ILE CG2 HG21 sing N N 128 ILE CG2 HG22 sing N N 129 ILE CG2 HG23 sing N N 130 ILE CD1 HD11 sing N N 131 ILE CD1 HD12 sing N N 132 ILE CD1 HD13 sing N N 133 ILE OXT HXT sing N N 134 LEU N CA sing N N 135 LEU N H sing N N 136 LEU N H2 sing N N 137 LEU CA C sing N N 138 LEU CA CB sing N N 139 LEU CA HA sing N N 140 LEU C O doub N N 141 LEU C OXT sing N N 142 LEU CB CG sing N N 143 LEU CB HB2 sing N N 144 LEU CB HB3 sing N N 145 LEU CG CD1 sing N N 146 LEU CG CD2 sing N N 147 LEU CG HG sing N N 148 LEU CD1 HD11 sing N N 149 LEU CD1 HD12 sing N N 150 LEU CD1 HD13 sing N N 151 LEU CD2 HD21 sing N N 152 LEU CD2 HD22 sing N N 153 LEU CD2 HD23 sing N N 154 LEU OXT HXT sing N N 155 MET N CA sing N N 156 MET N H sing N N 157 MET N H2 sing N N 158 MET CA C sing N N 159 MET CA CB sing N N 160 MET CA HA sing N N 161 MET C O doub N N 162 MET C OXT sing N N 163 MET CB CG sing N N 164 MET CB HB2 sing N N 165 MET CB HB3 sing N N 166 MET CG SD sing N N 167 MET CG HG2 sing N N 168 MET CG HG3 sing N N 169 MET SD CE sing N N 170 MET CE HE1 sing N N 171 MET CE HE2 sing N N 172 MET CE HE3 sing N N 173 MET OXT HXT sing N N 174 PHE N CA sing N N 175 PHE N H sing N N 176 PHE N H2 sing N N 177 PHE CA C sing N N 178 PHE CA CB sing N N 179 PHE CA HA sing N N 180 PHE C O doub N N 181 PHE C OXT sing N N 182 PHE CB CG sing N N 183 PHE CB HB2 sing N N 184 PHE CB HB3 sing N N 185 PHE CG CD1 doub Y N 186 PHE CG CD2 sing Y N 187 PHE CD1 CE1 sing Y N 188 PHE CD1 HD1 sing N N 189 PHE CD2 CE2 doub Y N 190 PHE CD2 HD2 sing N N 191 PHE CE1 CZ doub Y N 192 PHE CE1 HE1 sing N N 193 PHE CE2 CZ sing Y N 194 PHE CE2 HE2 sing N N 195 PHE CZ HZ sing N N 196 PHE OXT HXT sing N N 197 PRO N CA sing N N 198 PRO N CD sing N N 199 PRO N H sing N N 200 PRO CA C sing N N 201 PRO CA CB sing N N 202 PRO CA HA sing N N 203 PRO C O doub N N 204 PRO C OXT sing N N 205 PRO CB CG sing N N 206 PRO CB HB2 sing N N 207 PRO CB HB3 sing N N 208 PRO CG CD sing N N 209 PRO CG HG2 sing N N 210 PRO CG HG3 sing N N 211 PRO CD HD2 sing N N 212 PRO CD HD3 sing N N 213 PRO OXT HXT sing N N 214 SER N CA sing N N 215 SER N H sing N N 216 SER N H2 sing N N 217 SER CA C sing N N 218 SER CA CB sing N N 219 SER CA HA sing N N 220 SER C O doub N N 221 SER C OXT sing N N 222 SER CB OG sing N N 223 SER CB HB2 sing N N 224 SER CB HB3 sing N N 225 SER OG HG sing N N 226 SER OXT HXT sing N N 227 THR N CA sing N N 228 THR N H sing N N 229 THR N H2 sing N N 230 THR CA C sing N N 231 THR CA CB sing N N 232 THR CA HA sing N N 233 THR C O doub N N 234 THR C OXT sing N N 235 THR CB OG1 sing N N 236 THR CB CG2 sing N N 237 THR CB HB sing N N 238 THR OG1 HG1 sing N N 239 THR CG2 HG21 sing N N 240 THR CG2 HG22 sing N N 241 THR CG2 HG23 sing N N 242 THR OXT HXT sing N N 243 VAL N CA sing N N 244 VAL N H sing N N 245 VAL N H2 sing N N 246 VAL CA C sing N N 247 VAL CA CB sing N N 248 VAL CA HA sing N N 249 VAL C O doub N N 250 VAL C OXT sing N N 251 VAL CB CG1 sing N N 252 VAL CB CG2 sing N N 253 VAL CB HB sing N N 254 VAL CG1 HG11 sing N N 255 VAL CG1 HG12 sing N N 256 VAL CG1 HG13 sing N N 257 VAL CG2 HG21 sing N N 258 VAL CG2 HG22 sing N N 259 VAL CG2 HG23 sing N N 260 VAL OXT HXT sing N N 261 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 6951834 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE NEO' ? Bruker 800 ? 2 'AVANCE III' ? Bruker 600 ? 3 'AVANCE NEO' ? Bruker 600 ? # _atom_sites.entry_id 9DCJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #