data_9DE2 # _entry.id 9DE2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9DE2 pdb_00009de2 10.2210/pdb9de2/pdb WWPDB D_1000287888 ? ? BMRB 31200 ? 10.13018/BMR31200 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-09-18 ? 2 'Structure model' 1 1 2025-06-18 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_entry_details # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 2 'Structure model' '_citation_author.identifier_ORCID' 12 2 'Structure model' '_citation_author.name' 13 2 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9DE2 _pdbx_database_status.recvd_initial_deposition_date 2024-08-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'ETO2 MYND bound to MPPL peptide from GATAD2A' _pdbx_database_related.db_id 31200 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email david_willjr@med.unc.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Williams _pdbx_contact_author.name_mi C _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6536-4038 # _audit_author.name 'Williams, D.C.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-6536-4038 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 53 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;The role of multivalency in the association of the eight twenty-one protein 2 (ETO2) with the nucleosome remodeling and deacetylase (NuRD) complex. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkaf439 _citation.pdbx_database_id_PubMed 40421803 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dan-Dukor, G.' 1 ? primary 'Shang, S.' 2 ? primary 'Leighton, G.O.' 3 ? primary 'Travis, C.R.' 4 0000-0003-0673-6978 primary 'Schwochert, T.D.' 5 ? primary 'Agrawal, P.' 6 ? primary 'Ajasa, O.' 7 ? primary 'Li, T.' 8 ? primary 'Waters, M.L.' 9 ? primary 'Ginder, G.D.' 10 ? primary 'Williams Jr., D.C.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GATAD2A-MPPL motif and ETO2 NHR4 domain fusion protein' 7696.501 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MTG8-related protein 2,Myeloid translocation gene on chromosome 16 protein,hMTG16,Zinc finger MYND domain-containing protein 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSASSQVVMPPLVRGAQQKNGRGSDSSESCWNCGRKASETCSGCNAARYCGSFCQHRDWEKHHHVCGQSLQ _entity_poly.pdbx_seq_one_letter_code_can GSASSQVVMPPLVRGAQQKNGRGSDSSESCWNCGRKASETCSGCNAARYCGSFCQHRDWEKHHHVCGQSLQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 SER n 1 5 SER n 1 6 GLN n 1 7 VAL n 1 8 VAL n 1 9 MET n 1 10 PRO n 1 11 PRO n 1 12 LEU n 1 13 VAL n 1 14 ARG n 1 15 GLY n 1 16 ALA n 1 17 GLN n 1 18 GLN n 1 19 LYS n 1 20 ASN n 1 21 GLY n 1 22 ARG n 1 23 GLY n 1 24 SER n 1 25 ASP n 1 26 SER n 1 27 SER n 1 28 GLU n 1 29 SER n 1 30 CYS n 1 31 TRP n 1 32 ASN n 1 33 CYS n 1 34 GLY n 1 35 ARG n 1 36 LYS n 1 37 ALA n 1 38 SER n 1 39 GLU n 1 40 THR n 1 41 CYS n 1 42 SER n 1 43 GLY n 1 44 CYS n 1 45 ASN n 1 46 ALA n 1 47 ALA n 1 48 ARG n 1 49 TYR n 1 50 CYS n 1 51 GLY n 1 52 SER n 1 53 PHE n 1 54 CYS n 1 55 GLN n 1 56 HIS n 1 57 ARG n 1 58 ASP n 1 59 TRP n 1 60 GLU n 1 61 LYS n 1 62 HIS n 1 63 HIS n 1 64 HIS n 1 65 VAL n 1 66 CYS n 1 67 GLY n 1 68 GLN n 1 69 SER n 1 70 LEU n 1 71 GLN n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 22 human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 23 71 human ? 'CBFA2T3, MTG16, MTGR2, ZMYND4' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 527 527 GLY GLY A . n A 1 2 SER 2 528 528 SER SER A . n A 1 3 ALA 3 529 529 ALA ALA A . n A 1 4 SER 4 530 530 SER SER A . n A 1 5 SER 5 531 531 SER SER A . n A 1 6 GLN 6 532 532 GLN GLN A . n A 1 7 VAL 7 533 533 VAL VAL A . n A 1 8 VAL 8 534 534 VAL VAL A . n A 1 9 MET 9 535 535 MET MET A . n A 1 10 PRO 10 536 536 PRO PRO A . n A 1 11 PRO 11 537 537 PRO PRO A . n A 1 12 LEU 12 538 538 LEU LEU A . n A 1 13 VAL 13 539 539 VAL VAL A . n A 1 14 ARG 14 540 540 ARG ARG A . n A 1 15 GLY 15 541 541 GLY GLY A . n A 1 16 ALA 16 542 542 ALA ALA A . n A 1 17 GLN 17 543 543 GLN GLN A . n A 1 18 GLN 18 544 544 GLN GLN A . n A 1 19 LYS 19 545 545 LYS LYS A . n A 1 20 ASN 20 546 546 ASN ASN A . n A 1 21 GLY 21 547 547 GLY GLY A . n A 1 22 ARG 22 548 548 ARG ARG A . n A 1 23 GLY 23 549 549 GLY GLY A . n A 1 24 SER 24 550 550 SER SER A . n A 1 25 ASP 25 551 551 ASP ASP A . n A 1 26 SER 26 552 552 SER SER A . n A 1 27 SER 27 553 553 SER SER A . n A 1 28 GLU 28 554 554 GLU GLU A . n A 1 29 SER 29 555 555 SER SER A . n A 1 30 CYS 30 556 556 CYS CYS A . n A 1 31 TRP 31 557 557 TRP TRP A . n A 1 32 ASN 32 558 558 ASN ASN A . n A 1 33 CYS 33 559 559 CYS CYS A . n A 1 34 GLY 34 560 560 GLY GLY A . n A 1 35 ARG 35 561 561 ARG ARG A . n A 1 36 LYS 36 562 562 LYS LYS A . n A 1 37 ALA 37 563 563 ALA ALA A . n A 1 38 SER 38 564 564 SER SER A . n A 1 39 GLU 39 565 565 GLU GLU A . n A 1 40 THR 40 566 566 THR THR A . n A 1 41 CYS 41 567 567 CYS CYS A . n A 1 42 SER 42 568 568 SER SER A . n A 1 43 GLY 43 569 569 GLY GLY A . n A 1 44 CYS 44 570 570 CYS CYS A . n A 1 45 ASN 45 571 571 ASN ASN A . n A 1 46 ALA 46 572 572 ALA ALA A . n A 1 47 ALA 47 573 573 ALA ALA A . n A 1 48 ARG 48 574 574 ARG ARG A . n A 1 49 TYR 49 575 575 TYR TYR A . n A 1 50 CYS 50 576 576 CYS CYS A . n A 1 51 GLY 51 577 577 GLY GLY A . n A 1 52 SER 52 578 578 SER SER A . n A 1 53 PHE 53 579 579 PHE PHE A . n A 1 54 CYS 54 580 580 CYS CYS A . n A 1 55 GLN 55 581 581 GLN GLN A . n A 1 56 HIS 56 582 582 HIS HIS A . n A 1 57 ARG 57 583 583 ARG ARG A . n A 1 58 ASP 58 584 584 ASP ASP A . n A 1 59 TRP 59 585 585 TRP TRP A . n A 1 60 GLU 60 586 586 GLU GLU A . n A 1 61 LYS 61 587 587 LYS LYS A . n A 1 62 HIS 62 588 588 HIS HIS A . n A 1 63 HIS 63 589 589 HIS HIS A . n A 1 64 HIS 64 590 590 HIS HIS A . n A 1 65 VAL 65 591 591 VAL VAL A . n A 1 66 CYS 66 592 592 CYS CYS A . n A 1 67 GLY 67 593 593 GLY GLY A . n A 1 68 GLN 68 594 594 GLN GLN A . n A 1 69 SER 69 595 595 SER SER A . n A 1 70 LEU 70 596 596 LEU LEU A . n A 1 71 GLN 71 597 597 GLN GLN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 601 601 ZN ZN A . C 2 ZN 1 602 602 ZN ZN A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9DE2 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9DE2 _struct.title 'ETO2 MYND bound to MPPL peptide from GATAD2A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9DE2 _struct_keywords.text 'Zn finger complex, polyproline binder, MYND, NuRD, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 9DE2 9DE2 ? 1 ? 1 2 UNP MTG16_HUMAN O75081 ? 1 DSSESCWNCGRKASETCSGCNAARYCGSFCQHRDWEKHHHVCGQSLQ 551 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9DE2 A 1 ? 22 ? 9DE2 527 ? 548 ? 527 548 2 2 9DE2 A 25 ? 71 ? O75081 551 ? 597 ? 551 597 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9DE2 GLY A 23 ? PDB ? ? ? linker 549 1 1 9DE2 SER A 24 ? PDB ? ? ? linker 550 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 51 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 63 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 577 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 589 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 30 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 556 A ZN 601 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc2 metalc ? ? A CYS 33 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 559 A ZN 601 1_555 ? ? ? ? ? ? ? 2.337 ? ? metalc3 metalc ? ? A CYS 41 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 567 A ZN 602 1_555 ? ? ? ? ? ? ? 2.352 ? ? metalc4 metalc ? ? A CYS 44 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 570 A ZN 602 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc5 metalc ? ? A CYS 50 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 576 A ZN 601 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc6 metalc ? ? A CYS 54 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 580 A ZN 601 1_555 ? ? ? ? ? ? ? 2.341 ? ? metalc7 metalc ? ? A HIS 62 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 588 A ZN 602 1_555 ? ? ? ? ? ? ? 2.064 ? ? metalc8 metalc ? ? A CYS 66 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 592 A ZN 602 1_555 ? ? ? ? ? ? ? 2.340 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 30 ? A CYS 556 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG ? A CYS 33 ? A CYS 559 ? 1_555 109.2 ? 2 SG ? A CYS 30 ? A CYS 556 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG ? A CYS 50 ? A CYS 576 ? 1_555 110.3 ? 3 SG ? A CYS 33 ? A CYS 559 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG ? A CYS 50 ? A CYS 576 ? 1_555 108.3 ? 4 SG ? A CYS 30 ? A CYS 556 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG ? A CYS 54 ? A CYS 580 ? 1_555 110.8 ? 5 SG ? A CYS 33 ? A CYS 559 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG ? A CYS 54 ? A CYS 580 ? 1_555 109.6 ? 6 SG ? A CYS 50 ? A CYS 576 ? 1_555 ZN ? B ZN . ? A ZN 601 ? 1_555 SG ? A CYS 54 ? A CYS 580 ? 1_555 108.7 ? 7 SG ? A CYS 41 ? A CYS 567 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 SG ? A CYS 44 ? A CYS 570 ? 1_555 109.5 ? 8 SG ? A CYS 41 ? A CYS 567 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 NE2 ? A HIS 62 ? A HIS 588 ? 1_555 109.6 ? 9 SG ? A CYS 44 ? A CYS 570 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 NE2 ? A HIS 62 ? A HIS 588 ? 1_555 108.8 ? 10 SG ? A CYS 41 ? A CYS 567 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 SG ? A CYS 66 ? A CYS 592 ? 1_555 110.4 ? 11 SG ? A CYS 44 ? A CYS 570 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 SG ? A CYS 66 ? A CYS 592 ? 1_555 109.7 ? 12 NE2 ? A HIS 62 ? A HIS 588 ? 1_555 ZN ? C ZN . ? A ZN 602 ? 1_555 SG ? A CYS 66 ? A CYS 592 ? 1_555 108.7 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 12 ? ARG A 14 ? LEU A 538 ARG A 540 AA1 2 GLU A 39 ? CYS A 41 ? GLU A 565 CYS A 567 AA1 3 ARG A 48 ? TYR A 49 ? ARG A 574 TYR A 575 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 13 ? N VAL A 539 O THR A 40 ? O THR A 566 AA1 2 3 N GLU A 39 ? N GLU A 565 O TYR A 49 ? O TYR A 575 # _pdbx_entry_details.entry_id 9DE2 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 530 ? ? 54.15 -139.90 2 1 GLN A 544 ? ? -132.11 -33.04 3 1 ARG A 548 ? ? -143.98 43.49 4 1 SER A 550 ? ? -176.40 -50.78 5 1 ASP A 551 ? ? 75.86 -63.86 6 1 SER A 553 ? ? 61.91 160.82 7 1 GLU A 554 ? ? -169.60 37.80 8 1 ASN A 558 ? ? -77.01 -74.65 9 1 LYS A 562 ? ? 39.44 106.28 10 1 SER A 595 ? ? 37.34 -92.40 11 1 LEU A 596 ? ? -145.92 28.98 12 2 GLN A 532 ? ? 75.68 161.34 13 2 ALA A 542 ? ? 50.72 82.56 14 2 GLN A 544 ? ? 59.05 -98.49 15 2 ASP A 551 ? ? -69.59 74.19 16 2 SER A 552 ? ? 68.98 153.68 17 2 GLU A 554 ? ? -101.06 -160.96 18 2 SER A 555 ? ? 76.94 85.68 19 2 ASN A 558 ? ? -85.77 -80.66 20 2 LYS A 562 ? ? 41.11 96.63 21 2 SER A 564 ? ? -158.43 29.61 22 2 SER A 595 ? ? 60.95 121.76 23 3 GLN A 532 ? ? 69.76 96.04 24 3 GLN A 543 ? ? -115.97 -158.38 25 3 LYS A 545 ? ? 62.95 174.09 26 3 ARG A 548 ? ? -100.70 70.08 27 3 ASP A 551 ? ? 76.48 -156.08 28 3 GLU A 554 ? ? -119.29 -138.37 29 3 SER A 555 ? ? 72.40 123.26 30 3 ASN A 558 ? ? -89.08 -82.06 31 3 LYS A 562 ? ? -6.20 132.25 32 3 ASN A 571 ? ? 80.70 -31.28 33 3 SER A 595 ? ? -164.80 72.80 34 4 SER A 530 ? ? -139.13 -148.72 35 4 SER A 531 ? ? 83.05 -161.57 36 4 GLN A 532 ? ? 76.35 166.89 37 4 ALA A 542 ? ? 54.69 70.58 38 4 GLN A 543 ? ? -179.59 -51.96 39 4 GLN A 544 ? ? 56.96 72.59 40 4 SER A 550 ? ? -91.51 -99.12 41 4 ASN A 558 ? ? -89.97 -81.92 42 4 ARG A 561 ? ? -48.50 174.27 43 4 SER A 564 ? ? 172.48 -23.50 44 4 SER A 595 ? ? -147.64 -51.52 45 4 LEU A 596 ? ? 63.71 157.64 46 5 ARG A 540 ? ? 83.84 -145.30 47 5 ALA A 542 ? ? -70.32 -155.82 48 5 SER A 550 ? ? -88.53 -81.55 49 5 SER A 552 ? ? 71.83 144.57 50 5 ASN A 558 ? ? -88.99 -84.93 51 5 LYS A 562 ? ? -8.60 131.40 52 5 ASN A 571 ? ? 84.20 -32.78 53 5 LEU A 596 ? ? 63.25 73.28 54 6 SER A 531 ? ? 51.21 -157.69 55 6 GLN A 532 ? ? 84.98 169.26 56 6 GLN A 543 ? ? -168.57 103.44 57 6 GLN A 544 ? ? -163.12 -55.88 58 6 LYS A 545 ? ? -175.45 59.12 59 6 ASN A 546 ? ? -156.42 57.80 60 6 ASP A 551 ? ? -173.48 74.39 61 6 SER A 552 ? ? 51.05 70.01 62 6 GLU A 554 ? ? -137.06 -129.87 63 6 SER A 555 ? ? 80.83 139.86 64 6 ASN A 558 ? ? -89.48 -78.01 65 6 LYS A 562 ? ? 13.56 119.07 66 6 ALA A 563 ? ? -70.48 -163.15 67 6 SER A 564 ? ? 172.94 -25.17 68 6 ASN A 571 ? ? 80.23 -30.78 69 6 LEU A 596 ? ? -129.22 -57.66 70 7 ALA A 529 ? ? -137.22 -36.88 71 7 SER A 531 ? ? 51.53 -109.08 72 7 GLN A 532 ? ? 82.99 173.73 73 7 ARG A 540 ? ? 76.23 -154.05 74 7 ALA A 542 ? ? 45.98 86.73 75 7 GLN A 544 ? ? 166.27 19.59 76 7 LYS A 545 ? ? 171.01 -53.01 77 7 ASN A 546 ? ? -160.03 -37.42 78 7 ARG A 548 ? ? 42.83 -102.86 79 7 ASP A 551 ? ? -124.43 -74.67 80 7 GLU A 554 ? ? -154.01 -64.53 81 7 SER A 555 ? ? 68.69 133.15 82 7 ASN A 558 ? ? -89.20 -84.78 83 7 LYS A 562 ? ? -23.42 145.86 84 7 ASN A 571 ? ? 84.84 -33.99 85 7 LEU A 596 ? ? -127.65 -72.26 86 8 ALA A 529 ? ? -109.23 -67.63 87 8 SER A 530 ? ? 56.67 94.97 88 8 GLN A 544 ? ? -176.23 -21.81 89 8 ASN A 546 ? ? 46.39 -159.29 90 8 ASP A 551 ? ? 56.54 97.89 91 8 SER A 553 ? ? 80.64 -147.28 92 8 SER A 555 ? ? 164.66 71.63 93 8 ASN A 558 ? ? -61.35 -77.46 94 8 ARG A 561 ? ? -56.87 177.67 95 8 ASN A 571 ? ? 82.72 -31.82 96 8 SER A 595 ? ? 172.33 -26.29 97 9 SER A 528 ? ? 52.39 -157.00 98 9 SER A 531 ? ? -133.92 -69.00 99 9 GLN A 532 ? ? 63.77 90.89 100 9 ARG A 540 ? ? 72.05 -153.99 101 9 ALA A 542 ? ? 170.73 87.18 102 9 GLN A 543 ? ? 178.74 27.18 103 9 ARG A 548 ? ? -157.29 -72.91 104 9 SER A 550 ? ? -162.73 38.83 105 9 SER A 552 ? ? 65.36 69.22 106 9 SER A 553 ? ? 173.38 -90.22 107 9 GLU A 554 ? ? 59.78 -176.51 108 9 SER A 555 ? ? 67.38 129.67 109 9 ASN A 558 ? ? -89.18 -82.05 110 9 LYS A 562 ? ? 29.67 103.38 111 9 SER A 568 ? ? -63.61 -176.64 112 9 GLN A 594 ? ? -86.54 -116.38 113 9 SER A 595 ? ? 60.58 60.50 114 9 LEU A 596 ? ? 73.97 -176.39 115 10 SER A 531 ? ? 56.73 85.75 116 10 ALA A 542 ? ? -176.60 -171.79 117 10 GLN A 543 ? ? 94.41 -45.07 118 10 GLN A 544 ? ? -170.47 -101.99 119 10 LYS A 545 ? ? 48.65 78.42 120 10 SER A 550 ? ? -138.55 -71.33 121 10 SER A 552 ? ? 51.48 -158.25 122 10 ASN A 558 ? ? -58.33 -81.56 123 10 LYS A 562 ? ? 39.76 103.84 124 10 GLN A 594 ? ? 74.43 -76.98 125 10 LEU A 596 ? ? -167.08 -62.01 126 11 SER A 528 ? ? 50.87 -167.29 127 11 ARG A 540 ? ? 114.18 -76.76 128 11 ALA A 542 ? ? 70.62 -73.08 129 11 GLN A 544 ? ? 67.20 81.07 130 11 SER A 550 ? ? -175.23 72.36 131 11 ASP A 551 ? ? -145.68 16.64 132 11 SER A 552 ? ? 173.74 -24.40 133 11 LYS A 562 ? ? 84.37 172.09 134 11 ALA A 563 ? ? -179.97 46.49 135 11 ASN A 571 ? ? 82.08 -30.04 136 11 GLN A 594 ? ? 62.25 -87.70 137 11 LEU A 596 ? ? -151.64 -58.64 138 12 SER A 531 ? ? 53.13 -92.61 139 12 GLN A 532 ? ? 73.24 151.76 140 12 ARG A 540 ? ? 75.71 -140.40 141 12 SER A 550 ? ? 68.48 165.08 142 12 SER A 552 ? ? 69.34 77.35 143 12 GLU A 554 ? ? -148.70 -95.45 144 12 SER A 555 ? ? 74.60 127.99 145 12 ASN A 558 ? ? -89.83 -82.88 146 12 LYS A 562 ? ? -25.38 90.16 147 12 ASN A 571 ? ? 83.84 -31.27 148 12 HIS A 589 ? ? -49.96 -19.13 149 13 SER A 531 ? ? -122.62 -84.51 150 13 GLN A 532 ? ? 62.66 64.64 151 13 ARG A 540 ? ? 71.19 -145.81 152 13 GLN A 543 ? ? -93.08 33.55 153 13 LYS A 545 ? ? 59.85 -98.01 154 13 SER A 550 ? ? 75.65 137.73 155 13 GLU A 554 ? ? -148.22 -86.65 156 13 SER A 555 ? ? 63.69 137.48 157 13 ASN A 558 ? ? -89.54 -83.59 158 13 LYS A 562 ? ? -15.53 136.59 159 13 ASN A 571 ? ? 83.87 -32.20 160 13 GLN A 594 ? ? -92.02 38.92 161 14 ALA A 529 ? ? 59.50 13.78 162 14 SER A 531 ? ? -160.08 -38.33 163 14 GLN A 532 ? ? 81.40 160.48 164 14 VAL A 533 ? ? -102.42 77.48 165 14 ALA A 542 ? ? -162.85 -109.39 166 14 GLN A 543 ? ? -118.44 62.32 167 14 ASN A 546 ? ? 61.15 -171.59 168 14 ARG A 548 ? ? 73.92 -63.63 169 14 SER A 555 ? ? -174.86 145.90 170 14 ASN A 558 ? ? -86.62 -82.92 171 14 LYS A 562 ? ? -32.75 154.52 172 14 ALA A 563 ? ? -137.29 -85.01 173 14 SER A 564 ? ? 127.89 21.28 174 14 ASN A 571 ? ? 78.85 -27.78 175 14 SER A 595 ? ? 82.25 -158.34 176 15 ALA A 529 ? ? 70.59 176.46 177 15 SER A 530 ? ? -171.87 -62.42 178 15 ARG A 540 ? ? 72.80 -154.12 179 15 GLN A 543 ? ? 171.02 108.03 180 15 GLN A 544 ? ? -95.14 -81.20 181 15 GLU A 554 ? ? -115.33 -154.74 182 15 SER A 555 ? ? 81.38 125.75 183 15 ASN A 558 ? ? -90.10 -76.58 184 15 LYS A 562 ? ? 16.90 114.98 185 15 ALA A 563 ? ? -73.18 -158.74 186 15 SER A 564 ? ? 173.31 -24.33 187 15 GLN A 594 ? ? 57.29 -90.75 188 15 SER A 595 ? ? -169.18 -85.21 189 16 ALA A 529 ? ? -163.40 -81.03 190 16 ASN A 546 ? ? -75.76 -88.95 191 16 GLU A 554 ? ? 171.17 -60.71 192 16 SER A 555 ? ? 77.10 131.91 193 16 ASN A 558 ? ? -89.15 -79.41 194 16 LYS A 562 ? ? 31.18 108.48 195 16 ALA A 563 ? ? -74.70 -161.48 196 16 SER A 564 ? ? 169.47 -23.25 197 17 SER A 530 ? ? -132.47 -72.10 198 17 SER A 531 ? ? 47.18 -112.16 199 17 GLN A 532 ? ? 67.12 60.89 200 17 VAL A 533 ? ? 35.96 90.06 201 17 ALA A 542 ? ? 71.14 50.92 202 17 ASN A 546 ? ? -142.44 -35.22 203 17 ARG A 548 ? ? -174.67 28.62 204 17 SER A 550 ? ? 51.93 -155.39 205 17 SER A 552 ? ? -169.60 95.56 206 17 GLU A 554 ? ? -143.97 16.43 207 17 SER A 555 ? ? 80.06 148.24 208 17 ASN A 558 ? ? -89.68 -85.83 209 17 LYS A 562 ? ? 18.76 116.04 210 17 ASN A 571 ? ? 83.03 -31.97 211 17 SER A 595 ? ? -156.31 -53.01 212 17 LEU A 596 ? ? 72.76 -69.21 213 18 SER A 531 ? ? 45.48 -120.35 214 18 GLN A 532 ? ? 76.02 135.36 215 18 ARG A 540 ? ? 81.31 -149.47 216 18 GLN A 543 ? ? 79.64 -164.98 217 18 LYS A 545 ? ? -157.16 -87.45 218 18 ASN A 546 ? ? 42.34 -156.23 219 18 ARG A 548 ? ? -55.76 -77.54 220 18 SER A 550 ? ? -165.70 -37.11 221 18 SER A 553 ? ? 72.89 -90.64 222 18 SER A 555 ? ? 166.90 69.02 223 18 ASN A 558 ? ? -89.27 -84.58 224 18 GLN A 594 ? ? 77.63 60.92 225 18 SER A 595 ? ? 45.13 -168.24 226 19 SER A 531 ? ? 177.68 -34.14 227 19 ALA A 542 ? ? 160.95 -78.56 228 19 ARG A 548 ? ? 171.75 84.08 229 19 SER A 550 ? ? -66.86 91.34 230 19 ASP A 551 ? ? -172.48 141.21 231 19 SER A 552 ? ? 48.04 84.25 232 19 SER A 553 ? ? -130.62 -36.58 233 19 GLU A 554 ? ? 178.31 128.99 234 19 ASN A 558 ? ? -65.07 -78.26 235 19 LYS A 562 ? ? 42.88 96.32 236 19 SER A 564 ? ? 45.03 20.33 237 19 GLN A 594 ? ? -168.59 110.82 238 19 SER A 595 ? ? -179.67 108.48 239 19 LEU A 596 ? ? 59.40 162.68 240 20 GLN A 532 ? ? 69.50 155.33 241 20 ARG A 540 ? ? 130.27 -93.51 242 20 ALA A 542 ? ? 59.21 72.44 243 20 LYS A 545 ? ? 179.08 116.91 244 20 ASN A 546 ? ? -56.97 171.86 245 20 ASP A 551 ? ? 176.72 93.27 246 20 ASN A 558 ? ? -89.85 -82.07 247 20 ARG A 561 ? ? -46.99 167.95 248 20 ALA A 563 ? ? -59.00 179.45 249 20 SER A 564 ? ? 178.69 -30.52 250 20 GLN A 594 ? ? 50.99 -97.30 # _pdbx_nmr_ensemble.entry_id 9DE2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9DE2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '500 uM [U-100% 13C; U-100% 15N] ETO2-NHR4-MPPLsc, 25 mM BisTris, 100 mM NaCl, 1 mM DTT, 50 uM ZnSO4, 95% H2O/5% D2O' '95% H2O/5% D2O' '13C, 15N ETO2-NHR4-MPPLsc' solution ? 2 ;500 uM [U-100% 13C; U-100% 15N] ETO2-NHR4-MPPLsc, 25 mM BisTris, 100 mM NaCl, 1 mM DTT, 50 uM ZnSO4, 5 % PEG:hexonal (C13:E5 r=0.85), 95% H2O/5% D2O ; '95% H2O/5% D2O' '13C, 15N ETO2-NHR4-MPPLsc' solution 'alignment sample' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 ETO2-NHR4-MPPLsc 500 ? uM '[U-100% 13C; U-100% 15N]' 1 BisTris 25 ? mM 'natural abundance' 1 NaCl 100 ? mM 'natural abundance' 1 DTT 1 ? mM 'natural abundance' 1 ZnSO4 50 ? uM 'natural abundance' 2 ETO2-NHR4-MPPLsc 500 ? uM '[U-100% 13C; U-100% 15N]' 2 BisTris 25 ? mM 'natural abundance' 2 NaCl 100 ? mM 'natural abundance' 2 DTT 1 ? mM 'natural abundance' 2 ZnSO4 50 ? uM 'natural abundance' 2 'PEG:hexonal (C13:E5 r=0.85)' 5 ? % 'natural abundance' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 6.8 'NaCl 100 mM' 'Used for all data collection except alignment' ? mM condition_1 ? pH ? ? K 2 295 atm 1 6.8 'NaCl 100 mM' 'Lowered temperature 3 degrees to prevent phase separation of PEG:hexanol liquid crystalline media' ? mM condition_2 ? pH ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 3 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 4 1 1 '3D CBCA(CO)NH' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D HNCO' 1 isotropic 7 1 1 '3D HBHA(CO)NH' 1 isotropic 8 1 1 '3D 1H-15N NOESY' 1 isotropic 9 1 1 '3D C(CO)NH' 1 isotropic 10 1 1 '2D HBCBCGCDHD' 1 isotropic 11 1 1 '2D HBCBCGCDCEHE' 1 isotropic 12 2 2 '3D HNCO JNH' 1 anisotropic # _pdbx_nmr_refine.entry_id 9DE2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 'CcpNmr Analysis' 2 CCPN 2 'structure calculation' 'X-PLOR NIH' 3.8 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 LEU N N N N 158 LEU CA C N S 159 LEU C C N N 160 LEU O O N N 161 LEU CB C N N 162 LEU CG C N N 163 LEU CD1 C N N 164 LEU CD2 C N N 165 LEU OXT O N N 166 LEU H H N N 167 LEU H2 H N N 168 LEU HA H N N 169 LEU HB2 H N N 170 LEU HB3 H N N 171 LEU HG H N N 172 LEU HD11 H N N 173 LEU HD12 H N N 174 LEU HD13 H N N 175 LEU HD21 H N N 176 LEU HD22 H N N 177 LEU HD23 H N N 178 LEU HXT H N N 179 LYS N N N N 180 LYS CA C N S 181 LYS C C N N 182 LYS O O N N 183 LYS CB C N N 184 LYS CG C N N 185 LYS CD C N N 186 LYS CE C N N 187 LYS NZ N N N 188 LYS OXT O N N 189 LYS H H N N 190 LYS H2 H N N 191 LYS HA H N N 192 LYS HB2 H N N 193 LYS HB3 H N N 194 LYS HG2 H N N 195 LYS HG3 H N N 196 LYS HD2 H N N 197 LYS HD3 H N N 198 LYS HE2 H N N 199 LYS HE3 H N N 200 LYS HZ1 H N N 201 LYS HZ2 H N N 202 LYS HZ3 H N N 203 LYS HXT H N N 204 MET N N N N 205 MET CA C N S 206 MET C C N N 207 MET O O N N 208 MET CB C N N 209 MET CG C N N 210 MET SD S N N 211 MET CE C N N 212 MET OXT O N N 213 MET H H N N 214 MET H2 H N N 215 MET HA H N N 216 MET HB2 H N N 217 MET HB3 H N N 218 MET HG2 H N N 219 MET HG3 H N N 220 MET HE1 H N N 221 MET HE2 H N N 222 MET HE3 H N N 223 MET HXT H N N 224 PHE N N N N 225 PHE CA C N S 226 PHE C C N N 227 PHE O O N N 228 PHE CB C N N 229 PHE CG C Y N 230 PHE CD1 C Y N 231 PHE CD2 C Y N 232 PHE CE1 C Y N 233 PHE CE2 C Y N 234 PHE CZ C Y N 235 PHE OXT O N N 236 PHE H H N N 237 PHE H2 H N N 238 PHE HA H N N 239 PHE HB2 H N N 240 PHE HB3 H N N 241 PHE HD1 H N N 242 PHE HD2 H N N 243 PHE HE1 H N N 244 PHE HE2 H N N 245 PHE HZ H N N 246 PHE HXT H N N 247 PRO N N N N 248 PRO CA C N S 249 PRO C C N N 250 PRO O O N N 251 PRO CB C N N 252 PRO CG C N N 253 PRO CD C N N 254 PRO OXT O N N 255 PRO H H N N 256 PRO HA H N N 257 PRO HB2 H N N 258 PRO HB3 H N N 259 PRO HG2 H N N 260 PRO HG3 H N N 261 PRO HD2 H N N 262 PRO HD3 H N N 263 PRO HXT H N N 264 SER N N N N 265 SER CA C N S 266 SER C C N N 267 SER O O N N 268 SER CB C N N 269 SER OG O N N 270 SER OXT O N N 271 SER H H N N 272 SER H2 H N N 273 SER HA H N N 274 SER HB2 H N N 275 SER HB3 H N N 276 SER HG H N N 277 SER HXT H N N 278 THR N N N N 279 THR CA C N S 280 THR C C N N 281 THR O O N N 282 THR CB C N R 283 THR OG1 O N N 284 THR CG2 C N N 285 THR OXT O N N 286 THR H H N N 287 THR H2 H N N 288 THR HA H N N 289 THR HB H N N 290 THR HG1 H N N 291 THR HG21 H N N 292 THR HG22 H N N 293 THR HG23 H N N 294 THR HXT H N N 295 TRP N N N N 296 TRP CA C N S 297 TRP C C N N 298 TRP O O N N 299 TRP CB C N N 300 TRP CG C Y N 301 TRP CD1 C Y N 302 TRP CD2 C Y N 303 TRP NE1 N Y N 304 TRP CE2 C Y N 305 TRP CE3 C Y N 306 TRP CZ2 C Y N 307 TRP CZ3 C Y N 308 TRP CH2 C Y N 309 TRP OXT O N N 310 TRP H H N N 311 TRP H2 H N N 312 TRP HA H N N 313 TRP HB2 H N N 314 TRP HB3 H N N 315 TRP HD1 H N N 316 TRP HE1 H N N 317 TRP HE3 H N N 318 TRP HZ2 H N N 319 TRP HZ3 H N N 320 TRP HH2 H N N 321 TRP HXT H N N 322 TYR N N N N 323 TYR CA C N S 324 TYR C C N N 325 TYR O O N N 326 TYR CB C N N 327 TYR CG C Y N 328 TYR CD1 C Y N 329 TYR CD2 C Y N 330 TYR CE1 C Y N 331 TYR CE2 C Y N 332 TYR CZ C Y N 333 TYR OH O N N 334 TYR OXT O N N 335 TYR H H N N 336 TYR H2 H N N 337 TYR HA H N N 338 TYR HB2 H N N 339 TYR HB3 H N N 340 TYR HD1 H N N 341 TYR HD2 H N N 342 TYR HE1 H N N 343 TYR HE2 H N N 344 TYR HH H N N 345 TYR HXT H N N 346 VAL N N N N 347 VAL CA C N S 348 VAL C C N N 349 VAL O O N N 350 VAL CB C N N 351 VAL CG1 C N N 352 VAL CG2 C N N 353 VAL OXT O N N 354 VAL H H N N 355 VAL H2 H N N 356 VAL HA H N N 357 VAL HB H N N 358 VAL HG11 H N N 359 VAL HG12 H N N 360 VAL HG13 H N N 361 VAL HG21 H N N 362 VAL HG22 H N N 363 VAL HG23 H N N 364 VAL HXT H N N 365 ZN ZN ZN N N 366 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01DK115563 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9DE2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S ZN # loop_ #