data_9DEC # _entry.id 9DEC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9DEC pdb_00009dec 10.2210/pdb9dec/pdb WWPDB D_1000287936 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-03-26 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9DEC _pdbx_database_status.recvd_initial_deposition_date 2024-08-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email dabaker@gmail.com _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bera, A.K.' 1 ? 'Sims, J.' 2 ? 'Baker, D.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biorxiv _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2692-8205 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Massively parallel assessment of designed protein solution properties using mass spectrometry and peptide barcoding.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1101/2025.02.24.639402 _citation.pdbx_database_id_PubMed 40060547 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Feldman, D.' 1 ? primary 'Sims, J.N.' 2 0000-0002-0479-0367 primary 'Li, X.' 3 ? primary 'Johnson, R.' 4 ? primary 'Gerben, S.' 5 ? primary 'Kim, D.E.' 6 0000-0002-0023-956X primary 'Richardson, C.' 7 ? primary 'Koepnick, B.' 8 ? primary 'Eisenach, H.' 9 ? primary 'Hicks, D.R.' 10 ? primary 'Yang, E.C.' 11 0000-0002-1305-9066 primary 'Wicky, B.I.M.' 12 ? primary 'Milles, L.F.' 13 0000-0001-8417-3205 primary 'Bera, A.K.' 14 ? primary 'Kang, A.' 15 ? primary 'Brackenbrough, E.' 16 ? primary 'Joyce, E.' 17 ? primary 'Sankaran, B.' 18 ? primary 'Lubner, J.M.' 19 ? primary 'Goreshnik, I.' 20 ? primary 'Vafeados, D.' 21 ? primary 'Allen, A.' 22 ? primary 'Stewart, L.' 23 ? primary 'MacCoss, M.J.' 24 0000-0003-1853-0256 primary 'Baker, D.' 25 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man D9-threaded 9370.075 3 ? ? ? ? 2 water nat water 18.015 15 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GGGSIKEITETTQLIVKHLAHNGEEYSEVVKEISEEMEKKGLSKEQVILLLIHFLLLSLVKGLSPETTKLLMKELIKELE KIK ; _entity_poly.pdbx_seq_one_letter_code_can ;GGGSIKEITETTQLIVKHLAHNGEEYSEVVKEISEEMEKKGLSKEQVILLLIHFLLLSLVKGLSPETTKLLMKELIKELE KIK ; _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 GLY n 1 4 SER n 1 5 ILE n 1 6 LYS n 1 7 GLU n 1 8 ILE n 1 9 THR n 1 10 GLU n 1 11 THR n 1 12 THR n 1 13 GLN n 1 14 LEU n 1 15 ILE n 1 16 VAL n 1 17 LYS n 1 18 HIS n 1 19 LEU n 1 20 ALA n 1 21 HIS n 1 22 ASN n 1 23 GLY n 1 24 GLU n 1 25 GLU n 1 26 TYR n 1 27 SER n 1 28 GLU n 1 29 VAL n 1 30 VAL n 1 31 LYS n 1 32 GLU n 1 33 ILE n 1 34 SER n 1 35 GLU n 1 36 GLU n 1 37 MET n 1 38 GLU n 1 39 LYS n 1 40 LYS n 1 41 GLY n 1 42 LEU n 1 43 SER n 1 44 LYS n 1 45 GLU n 1 46 GLN n 1 47 VAL n 1 48 ILE n 1 49 LEU n 1 50 LEU n 1 51 LEU n 1 52 ILE n 1 53 HIS n 1 54 PHE n 1 55 LEU n 1 56 LEU n 1 57 LEU n 1 58 SER n 1 59 LEU n 1 60 VAL n 1 61 LYS n 1 62 GLY n 1 63 LEU n 1 64 SER n 1 65 PRO n 1 66 GLU n 1 67 THR n 1 68 THR n 1 69 LYS n 1 70 LEU n 1 71 LEU n 1 72 MET n 1 73 LYS n 1 74 GLU n 1 75 LEU n 1 76 ILE n 1 77 LYS n 1 78 GLU n 1 79 LEU n 1 80 GLU n 1 81 LYS n 1 82 ILE n 1 83 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 83 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 -2 GLY GLY A . n A 1 2 GLY 2 -1 -1 GLY GLY A . n A 1 3 GLY 3 0 0 GLY GLY A . n A 1 4 SER 4 1 1 SER SER A . n A 1 5 ILE 5 2 2 ILE ILE A . n A 1 6 LYS 6 3 3 LYS LYS A . n A 1 7 GLU 7 4 4 GLU GLU A . n A 1 8 ILE 8 5 5 ILE ILE A . n A 1 9 THR 9 6 6 THR THR A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 THR 11 8 8 THR THR A . n A 1 12 THR 12 9 9 THR THR A . n A 1 13 GLN 13 10 10 GLN GLN A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 ILE 15 12 12 ILE ILE A . n A 1 16 VAL 16 13 13 VAL VAL A . n A 1 17 LYS 17 14 14 LYS LYS A . n A 1 18 HIS 18 15 15 HIS HIS A . n A 1 19 LEU 19 16 16 LEU LEU A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 HIS 21 18 18 HIS HIS A . n A 1 22 ASN 22 19 19 ASN ASN A . n A 1 23 GLY 23 20 20 GLY GLY A . n A 1 24 GLU 24 21 21 GLU GLU A . n A 1 25 GLU 25 22 22 GLU GLU A . n A 1 26 TYR 26 23 23 TYR TYR A . n A 1 27 SER 27 24 24 SER SER A . n A 1 28 GLU 28 25 25 GLU GLU A . n A 1 29 VAL 29 26 26 VAL VAL A . n A 1 30 VAL 30 27 27 VAL VAL A . n A 1 31 LYS 31 28 28 LYS LYS A . n A 1 32 GLU 32 29 29 GLU GLU A . n A 1 33 ILE 33 30 30 ILE ILE A . n A 1 34 SER 34 31 31 SER SER A . n A 1 35 GLU 35 32 32 GLU GLU A . n A 1 36 GLU 36 33 33 GLU GLU A . n A 1 37 MET 37 34 34 MET MET A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 LYS 39 36 36 LYS LYS A . n A 1 40 LYS 40 37 37 LYS LYS A . n A 1 41 GLY 41 38 38 GLY GLY A . n A 1 42 LEU 42 39 39 LEU LEU A . n A 1 43 SER 43 40 40 SER SER A . n A 1 44 LYS 44 41 41 LYS LYS A . n A 1 45 GLU 45 42 42 GLU GLU A . n A 1 46 GLN 46 43 43 GLN GLN A . n A 1 47 VAL 47 44 44 VAL VAL A . n A 1 48 ILE 48 45 45 ILE ILE A . n A 1 49 LEU 49 46 46 LEU LEU A . n A 1 50 LEU 50 47 47 LEU LEU A . n A 1 51 LEU 51 48 48 LEU LEU A . n A 1 52 ILE 52 49 49 ILE ILE A . n A 1 53 HIS 53 50 50 HIS HIS A . n A 1 54 PHE 54 51 51 PHE PHE A . n A 1 55 LEU 55 52 52 LEU LEU A . n A 1 56 LEU 56 53 53 LEU LEU A . n A 1 57 LEU 57 54 54 LEU LEU A . n A 1 58 SER 58 55 55 SER SER A . n A 1 59 LEU 59 56 56 LEU LEU A . n A 1 60 VAL 60 57 57 VAL VAL A . n A 1 61 LYS 61 58 58 LYS LYS A . n A 1 62 GLY 62 59 59 GLY GLY A . n A 1 63 LEU 63 60 60 LEU LEU A . n A 1 64 SER 64 61 61 SER SER A . n A 1 65 PRO 65 62 62 PRO PRO A . n A 1 66 GLU 66 63 63 GLU GLU A . n A 1 67 THR 67 64 64 THR THR A . n A 1 68 THR 68 65 65 THR THR A . n A 1 69 LYS 69 66 66 LYS LYS A . n A 1 70 LEU 70 67 67 LEU LEU A . n A 1 71 LEU 71 68 68 LEU LEU A . n A 1 72 MET 72 69 69 MET MET A . n A 1 73 LYS 73 70 70 LYS LYS A . n A 1 74 GLU 74 71 71 GLU GLU A . n A 1 75 LEU 75 72 72 LEU LEU A . n A 1 76 ILE 76 73 73 ILE ILE A . n A 1 77 LYS 77 74 74 LYS LYS A . n A 1 78 GLU 78 75 75 GLU GLU A . n A 1 79 LEU 79 76 76 LEU LEU A . n A 1 80 GLU 80 77 77 GLU GLU A . n A 1 81 LYS 81 78 78 LYS LYS A . n A 1 82 ILE 82 79 79 ILE ILE A . n A 1 83 LYS 83 80 ? ? ? A . n B 1 1 GLY 1 -2 ? ? ? B . n B 1 2 GLY 2 -1 ? ? ? B . n B 1 3 GLY 3 0 ? ? ? B . n B 1 4 SER 4 1 1 SER SER B . n B 1 5 ILE 5 2 2 ILE ILE B . n B 1 6 LYS 6 3 3 LYS LYS B . n B 1 7 GLU 7 4 4 GLU GLU B . n B 1 8 ILE 8 5 5 ILE ILE B . n B 1 9 THR 9 6 6 THR THR B . n B 1 10 GLU 10 7 7 GLU GLU B . n B 1 11 THR 11 8 8 THR THR B . n B 1 12 THR 12 9 9 THR THR B . n B 1 13 GLN 13 10 10 GLN GLN B . n B 1 14 LEU 14 11 11 LEU LEU B . n B 1 15 ILE 15 12 12 ILE ILE B . n B 1 16 VAL 16 13 13 VAL VAL B . n B 1 17 LYS 17 14 14 LYS LYS B . n B 1 18 HIS 18 15 15 HIS HIS B . n B 1 19 LEU 19 16 16 LEU LEU B . n B 1 20 ALA 20 17 17 ALA ALA B . n B 1 21 HIS 21 18 18 HIS HIS B . n B 1 22 ASN 22 19 19 ASN ASN B . n B 1 23 GLY 23 20 20 GLY GLY B . n B 1 24 GLU 24 21 21 GLU GLU B . n B 1 25 GLU 25 22 22 GLU GLU B . n B 1 26 TYR 26 23 23 TYR TYR B . n B 1 27 SER 27 24 24 SER SER B . n B 1 28 GLU 28 25 25 GLU GLU B . n B 1 29 VAL 29 26 26 VAL VAL B . n B 1 30 VAL 30 27 27 VAL VAL B . n B 1 31 LYS 31 28 28 LYS LYS B . n B 1 32 GLU 32 29 29 GLU GLU B . n B 1 33 ILE 33 30 30 ILE ILE B . n B 1 34 SER 34 31 31 SER SER B . n B 1 35 GLU 35 32 32 GLU GLU B . n B 1 36 GLU 36 33 33 GLU GLU B . n B 1 37 MET 37 34 34 MET MET B . n B 1 38 GLU 38 35 35 GLU GLU B . n B 1 39 LYS 39 36 36 LYS LYS B . n B 1 40 LYS 40 37 37 LYS LYS B . n B 1 41 GLY 41 38 38 GLY GLY B . n B 1 42 LEU 42 39 39 LEU LEU B . n B 1 43 SER 43 40 40 SER SER B . n B 1 44 LYS 44 41 41 LYS LYS B . n B 1 45 GLU 45 42 42 GLU GLU B . n B 1 46 GLN 46 43 43 GLN GLN B . n B 1 47 VAL 47 44 44 VAL VAL B . n B 1 48 ILE 48 45 45 ILE ILE B . n B 1 49 LEU 49 46 46 LEU LEU B . n B 1 50 LEU 50 47 47 LEU LEU B . n B 1 51 LEU 51 48 48 LEU LEU B . n B 1 52 ILE 52 49 49 ILE ILE B . n B 1 53 HIS 53 50 50 HIS HIS B . n B 1 54 PHE 54 51 51 PHE PHE B . n B 1 55 LEU 55 52 52 LEU LEU B . n B 1 56 LEU 56 53 53 LEU LEU B . n B 1 57 LEU 57 54 54 LEU LEU B . n B 1 58 SER 58 55 55 SER SER B . n B 1 59 LEU 59 56 56 LEU LEU B . n B 1 60 VAL 60 57 57 VAL VAL B . n B 1 61 LYS 61 58 58 LYS LYS B . n B 1 62 GLY 62 59 59 GLY GLY B . n B 1 63 LEU 63 60 60 LEU LEU B . n B 1 64 SER 64 61 61 SER SER B . n B 1 65 PRO 65 62 62 PRO PRO B . n B 1 66 GLU 66 63 63 GLU GLU B . n B 1 67 THR 67 64 64 THR THR B . n B 1 68 THR 68 65 65 THR THR B . n B 1 69 LYS 69 66 66 LYS LYS B . n B 1 70 LEU 70 67 67 LEU LEU B . n B 1 71 LEU 71 68 68 LEU LEU B . n B 1 72 MET 72 69 69 MET MET B . n B 1 73 LYS 73 70 70 LYS LYS B . n B 1 74 GLU 74 71 71 GLU GLU B . n B 1 75 LEU 75 72 72 LEU LEU B . n B 1 76 ILE 76 73 73 ILE ILE B . n B 1 77 LYS 77 74 74 LYS LYS B . n B 1 78 GLU 78 75 75 GLU GLU B . n B 1 79 LEU 79 76 76 LEU LEU B . n B 1 80 GLU 80 77 77 GLU GLU B . n B 1 81 LYS 81 78 78 LYS LYS B . n B 1 82 ILE 82 79 79 ILE ILE B . n B 1 83 LYS 83 80 ? ? ? B . n C 1 1 GLY 1 -2 ? ? ? C . n C 1 2 GLY 2 -1 ? ? ? C . n C 1 3 GLY 3 0 ? ? ? C . n C 1 4 SER 4 1 1 SER SER C . n C 1 5 ILE 5 2 2 ILE ILE C . n C 1 6 LYS 6 3 3 LYS LYS C . n C 1 7 GLU 7 4 4 GLU GLU C . n C 1 8 ILE 8 5 5 ILE ILE C . n C 1 9 THR 9 6 6 THR THR C . n C 1 10 GLU 10 7 7 GLU GLU C . n C 1 11 THR 11 8 8 THR THR C . n C 1 12 THR 12 9 9 THR THR C . n C 1 13 GLN 13 10 10 GLN GLN C . n C 1 14 LEU 14 11 11 LEU LEU C . n C 1 15 ILE 15 12 12 ILE ILE C . n C 1 16 VAL 16 13 13 VAL VAL C . n C 1 17 LYS 17 14 14 LYS LYS C . n C 1 18 HIS 18 15 15 HIS HIS C . n C 1 19 LEU 19 16 16 LEU LEU C . n C 1 20 ALA 20 17 17 ALA ALA C . n C 1 21 HIS 21 18 18 HIS HIS C . n C 1 22 ASN 22 19 19 ASN ASN C . n C 1 23 GLY 23 20 20 GLY GLY C . n C 1 24 GLU 24 21 21 GLU GLU C . n C 1 25 GLU 25 22 22 GLU GLU C . n C 1 26 TYR 26 23 23 TYR TYR C . n C 1 27 SER 27 24 24 SER SER C . n C 1 28 GLU 28 25 25 GLU GLU C . n C 1 29 VAL 29 26 26 VAL VAL C . n C 1 30 VAL 30 27 27 VAL VAL C . n C 1 31 LYS 31 28 28 LYS LYS C . n C 1 32 GLU 32 29 29 GLU GLU C . n C 1 33 ILE 33 30 30 ILE ILE C . n C 1 34 SER 34 31 31 SER SER C . n C 1 35 GLU 35 32 32 GLU GLU C . n C 1 36 GLU 36 33 33 GLU GLU C . n C 1 37 MET 37 34 34 MET MET C . n C 1 38 GLU 38 35 35 GLU GLU C . n C 1 39 LYS 39 36 36 LYS LYS C . n C 1 40 LYS 40 37 37 LYS LYS C . n C 1 41 GLY 41 38 38 GLY GLY C . n C 1 42 LEU 42 39 39 LEU LEU C . n C 1 43 SER 43 40 40 SER SER C . n C 1 44 LYS 44 41 41 LYS LYS C . n C 1 45 GLU 45 42 42 GLU GLU C . n C 1 46 GLN 46 43 43 GLN GLN C . n C 1 47 VAL 47 44 44 VAL VAL C . n C 1 48 ILE 48 45 45 ILE ILE C . n C 1 49 LEU 49 46 46 LEU LEU C . n C 1 50 LEU 50 47 47 LEU LEU C . n C 1 51 LEU 51 48 48 LEU LEU C . n C 1 52 ILE 52 49 49 ILE ILE C . n C 1 53 HIS 53 50 50 HIS HIS C . n C 1 54 PHE 54 51 51 PHE PHE C . n C 1 55 LEU 55 52 52 LEU LEU C . n C 1 56 LEU 56 53 53 LEU LEU C . n C 1 57 LEU 57 54 54 LEU LEU C . n C 1 58 SER 58 55 55 SER SER C . n C 1 59 LEU 59 56 56 LEU LEU C . n C 1 60 VAL 60 57 57 VAL VAL C . n C 1 61 LYS 61 58 58 LYS LYS C . n C 1 62 GLY 62 59 59 GLY GLY C . n C 1 63 LEU 63 60 60 LEU LEU C . n C 1 64 SER 64 61 61 SER SER C . n C 1 65 PRO 65 62 62 PRO PRO C . n C 1 66 GLU 66 63 63 GLU GLU C . n C 1 67 THR 67 64 64 THR THR C . n C 1 68 THR 68 65 65 THR THR C . n C 1 69 LYS 69 66 66 LYS LYS C . n C 1 70 LEU 70 67 67 LEU LEU C . n C 1 71 LEU 71 68 68 LEU LEU C . n C 1 72 MET 72 69 69 MET MET C . n C 1 73 LYS 73 70 70 LYS LYS C . n C 1 74 GLU 74 71 71 GLU GLU C . n C 1 75 LEU 75 72 72 LEU LEU C . n C 1 76 ILE 76 73 73 ILE ILE C . n C 1 77 LYS 77 74 74 LYS LYS C . n C 1 78 GLU 78 75 75 GLU GLU C . n C 1 79 LEU 79 76 76 LEU LEU C . n C 1 80 GLU 80 77 77 GLU GLU C . n C 1 81 LYS 81 78 78 LYS LYS C . n C 1 82 ILE 82 79 ? ? ? C . n C 1 83 LYS 83 80 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 HOH 1 101 2 HOH HOH A . D 2 HOH 2 102 15 HOH HOH A . D 2 HOH 3 103 3 HOH HOH A . D 2 HOH 4 104 14 HOH HOH A . D 2 HOH 5 105 8 HOH HOH A . D 2 HOH 6 106 12 HOH HOH A . D 2 HOH 7 107 9 HOH HOH A . E 2 HOH 1 101 4 HOH HOH B . E 2 HOH 2 102 1 HOH HOH B . E 2 HOH 3 103 6 HOH HOH B . E 2 HOH 4 104 7 HOH HOH B . F 2 HOH 1 101 11 HOH HOH C . F 2 HOH 2 102 10 HOH HOH C . F 2 HOH 3 103 13 HOH HOH C . F 2 HOH 4 104 5 HOH HOH C . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.1_5286 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9DEC _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.973 _cell.length_a_esd ? _cell.length_b 69.276 _cell.length_b_esd ? _cell.length_c 84.467 _cell.length_c_esd ? _cell.volume 397746.449 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9DEC _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall 'I 2 2' _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9DEC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.77 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.30 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '21 % w/v PEG 3350, 0.1 M MES pH 6.0 and 0.15 M Sodium chloride' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Horizontal pre-focus bimorph mirror & KB bimorph mirrors' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-07-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111) DCM' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97936 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97936 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-2 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 38.36 _reflns.entry_id 9DEC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.04 _reflns.d_resolution_low 31.86 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13040 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.53 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.159 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.04 _reflns_shell.d_res_low 2.15 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1879 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.2 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.782 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.416 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.387 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 52.00 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9DEC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.04 _refine.ls_d_res_low 31.86 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11792 _refine.ls_number_reflns_R_free 1180 _refine.ls_number_reflns_R_work 10612 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 90.42 _refine.ls_percent_reflns_R_free 10.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2276 _refine.ls_R_factor_R_free 0.2781 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2220 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.01 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.8132 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3127 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.04 _refine_hist.d_res_low 31.86 _refine_hist.number_atoms_solvent 15 _refine_hist.number_atoms_total 1921 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1906 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0022 ? 1921 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4558 ? 2569 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0323 ? 325 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0026 ? 305 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.4313 ? 762 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.04 2.13 . . 115 1105 75.82 . . . . 0.3138 . . . . . . . . . . . 0.3671 'X-RAY DIFFRACTION' 2.13 2.25 . . 131 1168 81.70 . . . . 0.3074 . . . . . . . . . . . 0.3667 'X-RAY DIFFRACTION' 2.25 2.39 . . 132 1260 85.77 . . . . 0.2785 . . . . . . . . . . . 0.3433 'X-RAY DIFFRACTION' 2.39 2.57 . . 150 1304 89.92 . . . . 0.2588 . . . . . . . . . . . 0.3256 'X-RAY DIFFRACTION' 2.57 2.83 . . 149 1351 93.46 . . . . 0.2338 . . . . . . . . . . . 0.3445 'X-RAY DIFFRACTION' 2.83 3.24 . . 163 1415 96.75 . . . . 0.2511 . . . . . . . . . . . 0.3170 'X-RAY DIFFRACTION' 3.24 4.08 . . 164 1464 99.33 . . . . 0.2246 . . . . . . . . . . . 0.2552 'X-RAY DIFFRACTION' 4.08 31.86 . . 176 1545 99.59 . . . . 0.1818 . . . . . . . . . . . 0.2365 # _struct.entry_id 9DEC _struct.title 'Crystal Structure of D9-threaded' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9DEC _struct_keywords.text 'de novo protein, design model, barcoding, mass spec' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9DEC _struct_ref.pdbx_db_accession 9DEC _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9DEC A 1 ? 83 ? 9DEC -2 ? 80 ? -2 80 2 1 9DEC B 1 ? 83 ? 9DEC -2 ? 80 ? -2 80 3 1 9DEC C 1 ? 83 ? 9DEC -2 ? 80 ? -2 80 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D 2 1 B,E 3 1 C,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 5 ? ALA A 20 ? ILE A 2 ALA A 17 1 ? 16 HELX_P HELX_P2 AA2 ASN A 22 ? LYS A 40 ? ASN A 19 LYS A 37 1 ? 19 HELX_P HELX_P3 AA3 SER A 43 ? VAL A 60 ? SER A 40 VAL A 57 1 ? 18 HELX_P HELX_P4 AA4 SER A 64 ? ILE A 82 ? SER A 61 ILE A 79 1 ? 19 HELX_P HELX_P5 AA5 ILE B 5 ? ALA B 20 ? ILE B 2 ALA B 17 1 ? 16 HELX_P HELX_P6 AA6 ASN B 22 ? LYS B 40 ? ASN B 19 LYS B 37 1 ? 19 HELX_P HELX_P7 AA7 SER B 43 ? LEU B 59 ? SER B 40 LEU B 56 1 ? 17 HELX_P HELX_P8 AA8 SER B 64 ? GLU B 80 ? SER B 61 GLU B 77 1 ? 17 HELX_P HELX_P9 AA9 ILE C 5 ? ALA C 20 ? ILE C 2 ALA C 17 1 ? 16 HELX_P HELX_P10 AB1 ASN C 22 ? LYS C 40 ? ASN C 19 LYS C 37 1 ? 19 HELX_P HELX_P11 AB2 SER C 43 ? VAL C 60 ? SER C 40 VAL C 57 1 ? 18 HELX_P HELX_P12 AB3 SER C 64 ? LYS C 81 ? SER C 61 LYS C 78 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9DEC _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OG1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 THR _pdbx_validate_symm_contact.auth_seq_id_1 64 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 B _pdbx_validate_symm_contact.auth_comp_id_2 HIS _pdbx_validate_symm_contact.auth_seq_id_2 15 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_565 _pdbx_validate_symm_contact.dist 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 19 ? ? -107.14 45.46 2 1 LEU B 56 ? ? -116.69 -78.41 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x+1/2,y+1/2,z+1/2 6 x+1/2,-y+1/2,-z+1/2 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 12.1077220527 30.7047110817 20.6255830184 0.217547927798 ? -0.0294630595245 ? -0.0163577672181 ? 0.245147412609 ? -0.0131872030513 ? 0.30196680193 ? 5.25062821387 ? 0.369058386174 ? -1.82303469104 ? 6.7952421676 ? -1.53150233874 ? 6.24086197115 ? 0.115273993049 ? -0.057251791127 ? 0.425821025391 ? 0.530535036232 ? 0.219771152412 ? -0.161461469516 ? -0.521667529226 ? 0.17515440078 ? -0.343156078103 ? 2 'X-RAY DIFFRACTION' ? refined 3.91423285132 13.7863523301 12.1955950784 0.41937724562 ? 0.00140769886135 ? -0.0204797415769 ? 0.252832004621 ? -0.0567240776324 ? 0.366154359604 ? 6.09729036433 ? 0.769309459631 ? 2.72361865079 ? 3.94840051362 ? 0.109541006411 ? 8.00523261501 ? -0.238041138023 ? 0.0170396080643 ? -0.259689554644 ? 0.0248100014069 ? -0.132873730161 ? 0.336535088279 ? 0.69721298003 ? -0.475971094494 ? 0.363052074807 ? 3 'X-RAY DIFFRACTION' ? refined 21.2227895133 21.8091764265 3.94920269994 0.276835659331 ? 0.0668436768084 ? 0.088552896758 ? 0.349839392944 ? 0.0744515861275 ? 0.358372859964 ? 4.52464893523 ? 0.33534082657 ? 1.6459256808 ? 7.16763731086 ? -1.82154646613 ? 6.52192417799 ? -0.0382622769286 ? -0.0500193852551 ? -0.0187354720865 ? -0.61042734242 ? -0.245753892053 ? -0.458165175522 ? 0.300721606253 ? 0.630632017694 ? 0.15625033562 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 4 A 1 ? A 82 A 79 ? ? '(chain A and resseq 1:79)' 2 'X-RAY DIFFRACTION' 2 B 1 B 1 ? B 79 B 79 ? ? '(chain B and resseq 1:79)' 3 'X-RAY DIFFRACTION' 3 C 1 C 1 ? C 78 C 78 ? ? '(chain C and resseq 1:78)' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 80 ? A LYS 83 2 1 Y 1 B GLY -2 ? B GLY 1 3 1 Y 1 B GLY -1 ? B GLY 2 4 1 Y 1 B GLY 0 ? B GLY 3 5 1 Y 1 B LYS 80 ? B LYS 83 6 1 Y 1 C GLY -2 ? C GLY 1 7 1 Y 1 C GLY -1 ? C GLY 2 8 1 Y 1 C GLY 0 ? C GLY 3 9 1 Y 1 C ILE 79 ? C ILE 82 10 1 Y 1 C LYS 80 ? C LYS 83 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 GLN N N N N 31 GLN CA C N S 32 GLN C C N N 33 GLN O O N N 34 GLN CB C N N 35 GLN CG C N N 36 GLN CD C N N 37 GLN OE1 O N N 38 GLN NE2 N N N 39 GLN OXT O N N 40 GLN H H N N 41 GLN H2 H N N 42 GLN HA H N N 43 GLN HB2 H N N 44 GLN HB3 H N N 45 GLN HG2 H N N 46 GLN HG3 H N N 47 GLN HE21 H N N 48 GLN HE22 H N N 49 GLN HXT H N N 50 GLU N N N N 51 GLU CA C N S 52 GLU C C N N 53 GLU O O N N 54 GLU CB C N N 55 GLU CG C N N 56 GLU CD C N N 57 GLU OE1 O N N 58 GLU OE2 O N N 59 GLU OXT O N N 60 GLU H H N N 61 GLU H2 H N N 62 GLU HA H N N 63 GLU HB2 H N N 64 GLU HB3 H N N 65 GLU HG2 H N N 66 GLU HG3 H N N 67 GLU HE2 H N N 68 GLU HXT H N N 69 GLY N N N N 70 GLY CA C N N 71 GLY C C N N 72 GLY O O N N 73 GLY OXT O N N 74 GLY H H N N 75 GLY H2 H N N 76 GLY HA2 H N N 77 GLY HA3 H N N 78 GLY HXT H N N 79 HIS N N N N 80 HIS CA C N S 81 HIS C C N N 82 HIS O O N N 83 HIS CB C N N 84 HIS CG C Y N 85 HIS ND1 N Y N 86 HIS CD2 C Y N 87 HIS CE1 C Y N 88 HIS NE2 N Y N 89 HIS OXT O N N 90 HIS H H N N 91 HIS H2 H N N 92 HIS HA H N N 93 HIS HB2 H N N 94 HIS HB3 H N N 95 HIS HD1 H N N 96 HIS HD2 H N N 97 HIS HE1 H N N 98 HIS HE2 H N N 99 HIS HXT H N N 100 HOH O O N N 101 HOH H1 H N N 102 HOH H2 H N N 103 ILE N N N N 104 ILE CA C N S 105 ILE C C N N 106 ILE O O N N 107 ILE CB C N S 108 ILE CG1 C N N 109 ILE CG2 C N N 110 ILE CD1 C N N 111 ILE OXT O N N 112 ILE H H N N 113 ILE H2 H N N 114 ILE HA H N N 115 ILE HB H N N 116 ILE HG12 H N N 117 ILE HG13 H N N 118 ILE HG21 H N N 119 ILE HG22 H N N 120 ILE HG23 H N N 121 ILE HD11 H N N 122 ILE HD12 H N N 123 ILE HD13 H N N 124 ILE HXT H N N 125 LEU N N N N 126 LEU CA C N S 127 LEU C C N N 128 LEU O O N N 129 LEU CB C N N 130 LEU CG C N N 131 LEU CD1 C N N 132 LEU CD2 C N N 133 LEU OXT O N N 134 LEU H H N N 135 LEU H2 H N N 136 LEU HA H N N 137 LEU HB2 H N N 138 LEU HB3 H N N 139 LEU HG H N N 140 LEU HD11 H N N 141 LEU HD12 H N N 142 LEU HD13 H N N 143 LEU HD21 H N N 144 LEU HD22 H N N 145 LEU HD23 H N N 146 LEU HXT H N N 147 LYS N N N N 148 LYS CA C N S 149 LYS C C N N 150 LYS O O N N 151 LYS CB C N N 152 LYS CG C N N 153 LYS CD C N N 154 LYS CE C N N 155 LYS NZ N N N 156 LYS OXT O N N 157 LYS H H N N 158 LYS H2 H N N 159 LYS HA H N N 160 LYS HB2 H N N 161 LYS HB3 H N N 162 LYS HG2 H N N 163 LYS HG3 H N N 164 LYS HD2 H N N 165 LYS HD3 H N N 166 LYS HE2 H N N 167 LYS HE3 H N N 168 LYS HZ1 H N N 169 LYS HZ2 H N N 170 LYS HZ3 H N N 171 LYS HXT H N N 172 MET N N N N 173 MET CA C N S 174 MET C C N N 175 MET O O N N 176 MET CB C N N 177 MET CG C N N 178 MET SD S N N 179 MET CE C N N 180 MET OXT O N N 181 MET H H N N 182 MET H2 H N N 183 MET HA H N N 184 MET HB2 H N N 185 MET HB3 H N N 186 MET HG2 H N N 187 MET HG3 H N N 188 MET HE1 H N N 189 MET HE2 H N N 190 MET HE3 H N N 191 MET HXT H N N 192 PHE N N N N 193 PHE CA C N S 194 PHE C C N N 195 PHE O O N N 196 PHE CB C N N 197 PHE CG C Y N 198 PHE CD1 C Y N 199 PHE CD2 C Y N 200 PHE CE1 C Y N 201 PHE CE2 C Y N 202 PHE CZ C Y N 203 PHE OXT O N N 204 PHE H H N N 205 PHE H2 H N N 206 PHE HA H N N 207 PHE HB2 H N N 208 PHE HB3 H N N 209 PHE HD1 H N N 210 PHE HD2 H N N 211 PHE HE1 H N N 212 PHE HE2 H N N 213 PHE HZ H N N 214 PHE HXT H N N 215 PRO N N N N 216 PRO CA C N S 217 PRO C C N N 218 PRO O O N N 219 PRO CB C N N 220 PRO CG C N N 221 PRO CD C N N 222 PRO OXT O N N 223 PRO H H N N 224 PRO HA H N N 225 PRO HB2 H N N 226 PRO HB3 H N N 227 PRO HG2 H N N 228 PRO HG3 H N N 229 PRO HD2 H N N 230 PRO HD3 H N N 231 PRO HXT H N N 232 SER N N N N 233 SER CA C N S 234 SER C C N N 235 SER O O N N 236 SER CB C N N 237 SER OG O N N 238 SER OXT O N N 239 SER H H N N 240 SER H2 H N N 241 SER HA H N N 242 SER HB2 H N N 243 SER HB3 H N N 244 SER HG H N N 245 SER HXT H N N 246 THR N N N N 247 THR CA C N S 248 THR C C N N 249 THR O O N N 250 THR CB C N R 251 THR OG1 O N N 252 THR CG2 C N N 253 THR OXT O N N 254 THR H H N N 255 THR H2 H N N 256 THR HA H N N 257 THR HB H N N 258 THR HG1 H N N 259 THR HG21 H N N 260 THR HG22 H N N 261 THR HG23 H N N 262 THR HXT H N N 263 TYR N N N N 264 TYR CA C N S 265 TYR C C N N 266 TYR O O N N 267 TYR CB C N N 268 TYR CG C Y N 269 TYR CD1 C Y N 270 TYR CD2 C Y N 271 TYR CE1 C Y N 272 TYR CE2 C Y N 273 TYR CZ C Y N 274 TYR OH O N N 275 TYR OXT O N N 276 TYR H H N N 277 TYR H2 H N N 278 TYR HA H N N 279 TYR HB2 H N N 280 TYR HB3 H N N 281 TYR HD1 H N N 282 TYR HD2 H N N 283 TYR HE1 H N N 284 TYR HE2 H N N 285 TYR HH H N N 286 TYR HXT H N N 287 VAL N N N N 288 VAL CA C N S 289 VAL C C N N 290 VAL O O N N 291 VAL CB C N N 292 VAL CG1 C N N 293 VAL CG2 C N N 294 VAL OXT O N N 295 VAL H H N N 296 VAL H2 H N N 297 VAL HA H N N 298 VAL HB H N N 299 VAL HG11 H N N 300 VAL HG12 H N N 301 VAL HG13 H N N 302 VAL HG21 H N N 303 VAL HG22 H N N 304 VAL HG23 H N N 305 VAL HXT H N N 306 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 GLN N CA sing N N 29 GLN N H sing N N 30 GLN N H2 sing N N 31 GLN CA C sing N N 32 GLN CA CB sing N N 33 GLN CA HA sing N N 34 GLN C O doub N N 35 GLN C OXT sing N N 36 GLN CB CG sing N N 37 GLN CB HB2 sing N N 38 GLN CB HB3 sing N N 39 GLN CG CD sing N N 40 GLN CG HG2 sing N N 41 GLN CG HG3 sing N N 42 GLN CD OE1 doub N N 43 GLN CD NE2 sing N N 44 GLN NE2 HE21 sing N N 45 GLN NE2 HE22 sing N N 46 GLN OXT HXT sing N N 47 GLU N CA sing N N 48 GLU N H sing N N 49 GLU N H2 sing N N 50 GLU CA C sing N N 51 GLU CA CB sing N N 52 GLU CA HA sing N N 53 GLU C O doub N N 54 GLU C OXT sing N N 55 GLU CB CG sing N N 56 GLU CB HB2 sing N N 57 GLU CB HB3 sing N N 58 GLU CG CD sing N N 59 GLU CG HG2 sing N N 60 GLU CG HG3 sing N N 61 GLU CD OE1 doub N N 62 GLU CD OE2 sing N N 63 GLU OE2 HE2 sing N N 64 GLU OXT HXT sing N N 65 GLY N CA sing N N 66 GLY N H sing N N 67 GLY N H2 sing N N 68 GLY CA C sing N N 69 GLY CA HA2 sing N N 70 GLY CA HA3 sing N N 71 GLY C O doub N N 72 GLY C OXT sing N N 73 GLY OXT HXT sing N N 74 HIS N CA sing N N 75 HIS N H sing N N 76 HIS N H2 sing N N 77 HIS CA C sing N N 78 HIS CA CB sing N N 79 HIS CA HA sing N N 80 HIS C O doub N N 81 HIS C OXT sing N N 82 HIS CB CG sing N N 83 HIS CB HB2 sing N N 84 HIS CB HB3 sing N N 85 HIS CG ND1 sing Y N 86 HIS CG CD2 doub Y N 87 HIS ND1 CE1 doub Y N 88 HIS ND1 HD1 sing N N 89 HIS CD2 NE2 sing Y N 90 HIS CD2 HD2 sing N N 91 HIS CE1 NE2 sing Y N 92 HIS CE1 HE1 sing N N 93 HIS NE2 HE2 sing N N 94 HIS OXT HXT sing N N 95 HOH O H1 sing N N 96 HOH O H2 sing N N 97 ILE N CA sing N N 98 ILE N H sing N N 99 ILE N H2 sing N N 100 ILE CA C sing N N 101 ILE CA CB sing N N 102 ILE CA HA sing N N 103 ILE C O doub N N 104 ILE C OXT sing N N 105 ILE CB CG1 sing N N 106 ILE CB CG2 sing N N 107 ILE CB HB sing N N 108 ILE CG1 CD1 sing N N 109 ILE CG1 HG12 sing N N 110 ILE CG1 HG13 sing N N 111 ILE CG2 HG21 sing N N 112 ILE CG2 HG22 sing N N 113 ILE CG2 HG23 sing N N 114 ILE CD1 HD11 sing N N 115 ILE CD1 HD12 sing N N 116 ILE CD1 HD13 sing N N 117 ILE OXT HXT sing N N 118 LEU N CA sing N N 119 LEU N H sing N N 120 LEU N H2 sing N N 121 LEU CA C sing N N 122 LEU CA CB sing N N 123 LEU CA HA sing N N 124 LEU C O doub N N 125 LEU C OXT sing N N 126 LEU CB CG sing N N 127 LEU CB HB2 sing N N 128 LEU CB HB3 sing N N 129 LEU CG CD1 sing N N 130 LEU CG CD2 sing N N 131 LEU CG HG sing N N 132 LEU CD1 HD11 sing N N 133 LEU CD1 HD12 sing N N 134 LEU CD1 HD13 sing N N 135 LEU CD2 HD21 sing N N 136 LEU CD2 HD22 sing N N 137 LEU CD2 HD23 sing N N 138 LEU OXT HXT sing N N 139 LYS N CA sing N N 140 LYS N H sing N N 141 LYS N H2 sing N N 142 LYS CA C sing N N 143 LYS CA CB sing N N 144 LYS CA HA sing N N 145 LYS C O doub N N 146 LYS C OXT sing N N 147 LYS CB CG sing N N 148 LYS CB HB2 sing N N 149 LYS CB HB3 sing N N 150 LYS CG CD sing N N 151 LYS CG HG2 sing N N 152 LYS CG HG3 sing N N 153 LYS CD CE sing N N 154 LYS CD HD2 sing N N 155 LYS CD HD3 sing N N 156 LYS CE NZ sing N N 157 LYS CE HE2 sing N N 158 LYS CE HE3 sing N N 159 LYS NZ HZ1 sing N N 160 LYS NZ HZ2 sing N N 161 LYS NZ HZ3 sing N N 162 LYS OXT HXT sing N N 163 MET N CA sing N N 164 MET N H sing N N 165 MET N H2 sing N N 166 MET CA C sing N N 167 MET CA CB sing N N 168 MET CA HA sing N N 169 MET C O doub N N 170 MET C OXT sing N N 171 MET CB CG sing N N 172 MET CB HB2 sing N N 173 MET CB HB3 sing N N 174 MET CG SD sing N N 175 MET CG HG2 sing N N 176 MET CG HG3 sing N N 177 MET SD CE sing N N 178 MET CE HE1 sing N N 179 MET CE HE2 sing N N 180 MET CE HE3 sing N N 181 MET OXT HXT sing N N 182 PHE N CA sing N N 183 PHE N H sing N N 184 PHE N H2 sing N N 185 PHE CA C sing N N 186 PHE CA CB sing N N 187 PHE CA HA sing N N 188 PHE C O doub N N 189 PHE C OXT sing N N 190 PHE CB CG sing N N 191 PHE CB HB2 sing N N 192 PHE CB HB3 sing N N 193 PHE CG CD1 doub Y N 194 PHE CG CD2 sing Y N 195 PHE CD1 CE1 sing Y N 196 PHE CD1 HD1 sing N N 197 PHE CD2 CE2 doub Y N 198 PHE CD2 HD2 sing N N 199 PHE CE1 CZ doub Y N 200 PHE CE1 HE1 sing N N 201 PHE CE2 CZ sing Y N 202 PHE CE2 HE2 sing N N 203 PHE CZ HZ sing N N 204 PHE OXT HXT sing N N 205 PRO N CA sing N N 206 PRO N CD sing N N 207 PRO N H sing N N 208 PRO CA C sing N N 209 PRO CA CB sing N N 210 PRO CA HA sing N N 211 PRO C O doub N N 212 PRO C OXT sing N N 213 PRO CB CG sing N N 214 PRO CB HB2 sing N N 215 PRO CB HB3 sing N N 216 PRO CG CD sing N N 217 PRO CG HG2 sing N N 218 PRO CG HG3 sing N N 219 PRO CD HD2 sing N N 220 PRO CD HD3 sing N N 221 PRO OXT HXT sing N N 222 SER N CA sing N N 223 SER N H sing N N 224 SER N H2 sing N N 225 SER CA C sing N N 226 SER CA CB sing N N 227 SER CA HA sing N N 228 SER C O doub N N 229 SER C OXT sing N N 230 SER CB OG sing N N 231 SER CB HB2 sing N N 232 SER CB HB3 sing N N 233 SER OG HG sing N N 234 SER OXT HXT sing N N 235 THR N CA sing N N 236 THR N H sing N N 237 THR N H2 sing N N 238 THR CA C sing N N 239 THR CA CB sing N N 240 THR CA HA sing N N 241 THR C O doub N N 242 THR C OXT sing N N 243 THR CB OG1 sing N N 244 THR CB CG2 sing N N 245 THR CB HB sing N N 246 THR OG1 HG1 sing N N 247 THR CG2 HG21 sing N N 248 THR CG2 HG22 sing N N 249 THR CG2 HG23 sing N N 250 THR OXT HXT sing N N 251 TYR N CA sing N N 252 TYR N H sing N N 253 TYR N H2 sing N N 254 TYR CA C sing N N 255 TYR CA CB sing N N 256 TYR CA HA sing N N 257 TYR C O doub N N 258 TYR C OXT sing N N 259 TYR CB CG sing N N 260 TYR CB HB2 sing N N 261 TYR CB HB3 sing N N 262 TYR CG CD1 doub Y N 263 TYR CG CD2 sing Y N 264 TYR CD1 CE1 sing Y N 265 TYR CD1 HD1 sing N N 266 TYR CD2 CE2 doub Y N 267 TYR CD2 HD2 sing N N 268 TYR CE1 CZ doub Y N 269 TYR CE1 HE1 sing N N 270 TYR CE2 CZ sing Y N 271 TYR CE2 HE2 sing N N 272 TYR CZ OH sing N N 273 TYR OH HH sing N N 274 TYR OXT HXT sing N N 275 VAL N CA sing N N 276 VAL N H sing N N 277 VAL N H2 sing N N 278 VAL CA C sing N N 279 VAL CA CB sing N N 280 VAL CA HA sing N N 281 VAL C O doub N N 282 VAL C OXT sing N N 283 VAL CB CG1 sing N N 284 VAL CB CG2 sing N N 285 VAL CB HB sing N N 286 VAL CG1 HG11 sing N N 287 VAL CG1 HG12 sing N N 288 VAL CG1 HG13 sing N N 289 VAL CG2 HG21 sing N N 290 VAL CG2 HG22 sing N N 291 VAL CG2 HG23 sing N N 292 VAL OXT HXT sing N N 293 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'de novo designed model' # _space_group.name_H-M_alt 'I 2 2 2' _space_group.name_Hall 'I 2 2' _space_group.IT_number 23 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9DEC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.014712 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014435 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011839 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_