data_9DEF # _entry.id 9DEF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9DEF pdb_00009def 10.2210/pdb9def/pdb WWPDB D_1000287902 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-02-19 ? 2 'Structure model' 1 1 2025-02-26 ? 3 'Structure model' 1 2 2025-04-30 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9DEF _pdbx_database_status.recvd_initial_deposition_date 2024-08-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email dabaker@uw.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pellock, S.J.' 1 ? 'Lauko, A.' 2 ? 'Bera, A.K.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 388 _citation.language ? _citation.page_first eadu2454 _citation.page_last eadu2454 _citation.title 'Computational design of serine hydrolases.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/science.adu2454 _citation.pdbx_database_id_PubMed 39946508 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lauko, A.' 1 0000-0001-5903-3518 primary 'Pellock, S.J.' 2 0000-0002-7557-7985 primary 'Sumida, K.H.' 3 0000-0003-2773-9676 primary 'Anishchenko, I.' 4 0000-0003-3645-2044 primary 'Juergens, D.' 5 0000-0001-6425-8391 primary 'Ahern, W.' 6 0009-0006-1247-8847 primary 'Jeung, J.' 7 0009-0004-8604-908X primary 'Shida, A.F.' 8 0000-0003-4140-6085 primary 'Hunt, A.' 9 0000-0001-9620-593X primary 'Kalvet, I.' 10 0000-0002-6610-2857 primary 'Norn, C.' 11 0000-0002-1450-4651 primary 'Humphreys, I.R.' 12 ? primary 'Jamieson, C.' 13 ? primary 'Krishna, R.' 14 0009-0003-6387-9622 primary 'Kipnis, Y.' 15 0000-0002-3057-4916 primary 'Kang, A.' 16 0000-0001-5487-0499 primary 'Brackenbrough, E.' 17 0009-0004-1476-0219 primary 'Bera, A.K.' 18 0000-0001-9473-2912 primary 'Sankaran, B.' 19 0000-0002-3266-8131 primary 'Houk, K.N.' 20 0000-0002-8387-5261 primary 'Baker, D.' 21 0000-0001-7896-6217 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Win 18271.186 1 ? ? ? ? 2 non-polymer syn 'ACETIC ACID' 60.052 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 64 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSGMTEEELDQAVEDFLRVHSELVHRLAGDPPDELFQRLDRFVTDAIIEGNPERRDEIKADLARAARVFGEALERDITTP EDFNAFLRELGPEAVELVSTFTQQFVDVIRGDPQAVAEHLNISLEDVARLAEAGEAAIERGEGASLGVHRELRRIEARRN SGSG ; _entity_poly.pdbx_seq_one_letter_code_can ;MSGMTEEELDQAVEDFLRVHSELVHRLAGDPPDELFQRLDRFVTDAIIEGNPERRDEIKADLARAARVFGEALERDITTP EDFNAFLRELGPEAVELVSTFTQQFVDVIRGDPQAVAEHLNISLEDVARLAEAGEAAIERGEGASLGVHRELRRIEARRN SGSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETIC ACID' ACY 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 MET n 1 5 THR n 1 6 GLU n 1 7 GLU n 1 8 GLU n 1 9 LEU n 1 10 ASP n 1 11 GLN n 1 12 ALA n 1 13 VAL n 1 14 GLU n 1 15 ASP n 1 16 PHE n 1 17 LEU n 1 18 ARG n 1 19 VAL n 1 20 HIS n 1 21 SER n 1 22 GLU n 1 23 LEU n 1 24 VAL n 1 25 HIS n 1 26 ARG n 1 27 LEU n 1 28 ALA n 1 29 GLY n 1 30 ASP n 1 31 PRO n 1 32 PRO n 1 33 ASP n 1 34 GLU n 1 35 LEU n 1 36 PHE n 1 37 GLN n 1 38 ARG n 1 39 LEU n 1 40 ASP n 1 41 ARG n 1 42 PHE n 1 43 VAL n 1 44 THR n 1 45 ASP n 1 46 ALA n 1 47 ILE n 1 48 ILE n 1 49 GLU n 1 50 GLY n 1 51 ASN n 1 52 PRO n 1 53 GLU n 1 54 ARG n 1 55 ARG n 1 56 ASP n 1 57 GLU n 1 58 ILE n 1 59 LYS n 1 60 ALA n 1 61 ASP n 1 62 LEU n 1 63 ALA n 1 64 ARG n 1 65 ALA n 1 66 ALA n 1 67 ARG n 1 68 VAL n 1 69 PHE n 1 70 GLY n 1 71 GLU n 1 72 ALA n 1 73 LEU n 1 74 GLU n 1 75 ARG n 1 76 ASP n 1 77 ILE n 1 78 THR n 1 79 THR n 1 80 PRO n 1 81 GLU n 1 82 ASP n 1 83 PHE n 1 84 ASN n 1 85 ALA n 1 86 PHE n 1 87 LEU n 1 88 ARG n 1 89 GLU n 1 90 LEU n 1 91 GLY n 1 92 PRO n 1 93 GLU n 1 94 ALA n 1 95 VAL n 1 96 GLU n 1 97 LEU n 1 98 VAL n 1 99 SER n 1 100 THR n 1 101 PHE n 1 102 THR n 1 103 GLN n 1 104 GLN n 1 105 PHE n 1 106 VAL n 1 107 ASP n 1 108 VAL n 1 109 ILE n 1 110 ARG n 1 111 GLY n 1 112 ASP n 1 113 PRO n 1 114 GLN n 1 115 ALA n 1 116 VAL n 1 117 ALA n 1 118 GLU n 1 119 HIS n 1 120 LEU n 1 121 ASN n 1 122 ILE n 1 123 SER n 1 124 LEU n 1 125 GLU n 1 126 ASP n 1 127 VAL n 1 128 ALA n 1 129 ARG n 1 130 LEU n 1 131 ALA n 1 132 GLU n 1 133 ALA n 1 134 GLY n 1 135 GLU n 1 136 ALA n 1 137 ALA n 1 138 ILE n 1 139 GLU n 1 140 ARG n 1 141 GLY n 1 142 GLU n 1 143 GLY n 1 144 ALA n 1 145 SER n 1 146 LEU n 1 147 GLY n 1 148 VAL n 1 149 HIS n 1 150 ARG n 1 151 GLU n 1 152 LEU n 1 153 ARG n 1 154 ARG n 1 155 ILE n 1 156 GLU n 1 157 ALA n 1 158 ARG n 1 159 ARG n 1 160 ASN n 1 161 SER n 1 162 GLY n 1 163 SER n 1 164 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 164 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACY non-polymer . 'ACETIC ACID' ? 'C2 H4 O2' 60.052 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 GLY 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 THR 5 2 ? ? ? A . n A 1 6 GLU 6 3 ? ? ? A . n A 1 7 GLU 7 4 ? ? ? A . n A 1 8 GLU 8 5 ? ? ? A . n A 1 9 LEU 9 6 ? ? ? A . n A 1 10 ASP 10 7 ? ? ? A . n A 1 11 GLN 11 8 8 GLN GLN A . n A 1 12 ALA 12 9 9 ALA ALA A . n A 1 13 VAL 13 10 10 VAL VAL A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 ASP 15 12 12 ASP ASP A . n A 1 16 PHE 16 13 13 PHE PHE A . n A 1 17 LEU 17 14 14 LEU LEU A . n A 1 18 ARG 18 15 15 ARG ARG A . n A 1 19 VAL 19 16 16 VAL VAL A . n A 1 20 HIS 20 17 17 HIS HIS A . n A 1 21 SER 21 18 18 SER SER A . n A 1 22 GLU 22 19 19 GLU GLU A . n A 1 23 LEU 23 20 20 LEU LEU A . n A 1 24 VAL 24 21 21 VAL VAL A . n A 1 25 HIS 25 22 22 HIS HIS A . n A 1 26 ARG 26 23 23 ARG ARG A . n A 1 27 LEU 27 24 24 LEU LEU A . n A 1 28 ALA 28 25 25 ALA ALA A . n A 1 29 GLY 29 26 26 GLY GLY A . n A 1 30 ASP 30 27 27 ASP ASP A . n A 1 31 PRO 31 28 28 PRO PRO A . n A 1 32 PRO 32 29 29 PRO PRO A . n A 1 33 ASP 33 30 30 ASP ASP A . n A 1 34 GLU 34 31 31 GLU GLU A . n A 1 35 LEU 35 32 32 LEU LEU A . n A 1 36 PHE 36 33 33 PHE PHE A . n A 1 37 GLN 37 34 34 GLN GLN A . n A 1 38 ARG 38 35 35 ARG ARG A . n A 1 39 LEU 39 36 36 LEU LEU A . n A 1 40 ASP 40 37 37 ASP ASP A . n A 1 41 ARG 41 38 38 ARG ARG A . n A 1 42 PHE 42 39 39 PHE PHE A . n A 1 43 VAL 43 40 40 VAL VAL A . n A 1 44 THR 44 41 41 THR THR A . n A 1 45 ASP 45 42 42 ASP ASP A . n A 1 46 ALA 46 43 43 ALA ALA A . n A 1 47 ILE 47 44 44 ILE ILE A . n A 1 48 ILE 48 45 45 ILE ILE A . n A 1 49 GLU 49 46 46 GLU GLU A . n A 1 50 GLY 50 47 47 GLY GLY A . n A 1 51 ASN 51 48 48 ASN ASN A . n A 1 52 PRO 52 49 49 PRO PRO A . n A 1 53 GLU 53 50 50 GLU GLU A . n A 1 54 ARG 54 51 51 ARG ARG A . n A 1 55 ARG 55 52 52 ARG ARG A . n A 1 56 ASP 56 53 53 ASP ASP A . n A 1 57 GLU 57 54 54 GLU GLU A . n A 1 58 ILE 58 55 55 ILE ILE A . n A 1 59 LYS 59 56 56 LYS LYS A . n A 1 60 ALA 60 57 57 ALA ALA A . n A 1 61 ASP 61 58 58 ASP ASP A . n A 1 62 LEU 62 59 59 LEU LEU A . n A 1 63 ALA 63 60 60 ALA ALA A . n A 1 64 ARG 64 61 61 ARG ARG A . n A 1 65 ALA 65 62 62 ALA ALA A . n A 1 66 ALA 66 63 63 ALA ALA A . n A 1 67 ARG 67 64 64 ARG ARG A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 PHE 69 66 66 PHE PHE A . n A 1 70 GLY 70 67 67 GLY GLY A . n A 1 71 GLU 71 68 68 GLU GLU A . n A 1 72 ALA 72 69 69 ALA ALA A . n A 1 73 LEU 73 70 70 LEU LEU A . n A 1 74 GLU 74 71 71 GLU GLU A . n A 1 75 ARG 75 72 72 ARG ARG A . n A 1 76 ASP 76 73 73 ASP ASP A . n A 1 77 ILE 77 74 74 ILE ILE A . n A 1 78 THR 78 75 75 THR THR A . n A 1 79 THR 79 76 76 THR THR A . n A 1 80 PRO 80 77 77 PRO PRO A . n A 1 81 GLU 81 78 78 GLU GLU A . n A 1 82 ASP 82 79 79 ASP ASP A . n A 1 83 PHE 83 80 80 PHE PHE A . n A 1 84 ASN 84 81 81 ASN ASN A . n A 1 85 ALA 85 82 82 ALA ALA A . n A 1 86 PHE 86 83 83 PHE PHE A . n A 1 87 LEU 87 84 84 LEU LEU A . n A 1 88 ARG 88 85 85 ARG ARG A . n A 1 89 GLU 89 86 86 GLU GLU A . n A 1 90 LEU 90 87 87 LEU LEU A . n A 1 91 GLY 91 88 88 GLY GLY A . n A 1 92 PRO 92 89 89 PRO PRO A . n A 1 93 GLU 93 90 90 GLU GLU A . n A 1 94 ALA 94 91 91 ALA ALA A . n A 1 95 VAL 95 92 92 VAL VAL A . n A 1 96 GLU 96 93 93 GLU GLU A . n A 1 97 LEU 97 94 94 LEU LEU A . n A 1 98 VAL 98 95 95 VAL VAL A . n A 1 99 SER 99 96 96 SER SER A . n A 1 100 THR 100 97 97 THR THR A . n A 1 101 PHE 101 98 98 PHE PHE A . n A 1 102 THR 102 99 99 THR THR A . n A 1 103 GLN 103 100 100 GLN GLN A . n A 1 104 GLN 104 101 101 GLN GLN A . n A 1 105 PHE 105 102 102 PHE PHE A . n A 1 106 VAL 106 103 103 VAL VAL A . n A 1 107 ASP 107 104 104 ASP ASP A . n A 1 108 VAL 108 105 105 VAL VAL A . n A 1 109 ILE 109 106 106 ILE ILE A . n A 1 110 ARG 110 107 107 ARG ARG A . n A 1 111 GLY 111 108 108 GLY GLY A . n A 1 112 ASP 112 109 109 ASP ASP A . n A 1 113 PRO 113 110 110 PRO PRO A . n A 1 114 GLN 114 111 111 GLN GLN A . n A 1 115 ALA 115 112 112 ALA ALA A . n A 1 116 VAL 116 113 113 VAL VAL A . n A 1 117 ALA 117 114 114 ALA ALA A . n A 1 118 GLU 118 115 115 GLU GLU A . n A 1 119 HIS 119 116 116 HIS HIS A . n A 1 120 LEU 120 117 117 LEU LEU A . n A 1 121 ASN 121 118 118 ASN ASN A . n A 1 122 ILE 122 119 119 ILE ILE A . n A 1 123 SER 123 120 120 SER SER A . n A 1 124 LEU 124 121 121 LEU LEU A . n A 1 125 GLU 125 122 122 GLU GLU A . n A 1 126 ASP 126 123 123 ASP ASP A . n A 1 127 VAL 127 124 124 VAL VAL A . n A 1 128 ALA 128 125 125 ALA ALA A . n A 1 129 ARG 129 126 126 ARG ARG A . n A 1 130 LEU 130 127 127 LEU LEU A . n A 1 131 ALA 131 128 128 ALA ALA A . n A 1 132 GLU 132 129 129 GLU GLU A . n A 1 133 ALA 133 130 130 ALA ALA A . n A 1 134 GLY 134 131 131 GLY GLY A . n A 1 135 GLU 135 132 132 GLU GLU A . n A 1 136 ALA 136 133 133 ALA ALA A . n A 1 137 ALA 137 134 134 ALA ALA A . n A 1 138 ILE 138 135 135 ILE ILE A . n A 1 139 GLU 139 136 136 GLU GLU A . n A 1 140 ARG 140 137 137 ARG ARG A . n A 1 141 GLY 141 138 138 GLY GLY A . n A 1 142 GLU 142 139 139 GLU GLU A . n A 1 143 GLY 143 140 140 GLY GLY A . n A 1 144 ALA 144 141 141 ALA ALA A . n A 1 145 SER 145 142 142 SER SER A . n A 1 146 LEU 146 143 143 LEU LEU A . n A 1 147 GLY 147 144 144 GLY GLY A . n A 1 148 VAL 148 145 145 VAL VAL A . n A 1 149 HIS 149 146 146 HIS HIS A . n A 1 150 ARG 150 147 147 ARG ARG A . n A 1 151 GLU 151 148 148 GLU GLU A . n A 1 152 LEU 152 149 149 LEU LEU A . n A 1 153 ARG 153 150 150 ARG ARG A . n A 1 154 ARG 154 151 151 ARG ARG A . n A 1 155 ILE 155 152 152 ILE ILE A . n A 1 156 GLU 156 153 153 GLU GLU A . n A 1 157 ALA 157 154 154 ALA ALA A . n A 1 158 ARG 158 155 155 ARG ARG A . n A 1 159 ARG 159 156 156 ARG ARG A . n A 1 160 ASN 160 157 157 ASN ASN A . n A 1 161 SER 161 158 158 SER SER A . n A 1 162 GLY 162 159 ? ? ? A . n A 1 163 SER 163 160 ? ? ? A . n A 1 164 GLY 164 161 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACY 1 201 201 ACY ACT A . C 3 CL 1 202 1 CL CL A . D 4 HOH 1 301 47 HOH HOH A . D 4 HOH 2 302 32 HOH HOH A . D 4 HOH 3 303 26 HOH HOH A . D 4 HOH 4 304 38 HOH HOH A . D 4 HOH 5 305 24 HOH HOH A . D 4 HOH 6 306 4 HOH HOH A . D 4 HOH 7 307 63 HOH HOH A . D 4 HOH 8 308 2 HOH HOH A . D 4 HOH 9 309 40 HOH HOH A . D 4 HOH 10 310 9 HOH HOH A . D 4 HOH 11 311 62 HOH HOH A . D 4 HOH 12 312 42 HOH HOH A . D 4 HOH 13 313 54 HOH HOH A . D 4 HOH 14 314 23 HOH HOH A . D 4 HOH 15 315 15 HOH HOH A . D 4 HOH 16 316 3 HOH HOH A . D 4 HOH 17 317 60 HOH HOH A . D 4 HOH 18 318 56 HOH HOH A . D 4 HOH 19 319 39 HOH HOH A . D 4 HOH 20 320 57 HOH HOH A . D 4 HOH 21 321 44 HOH HOH A . D 4 HOH 22 322 14 HOH HOH A . D 4 HOH 23 323 18 HOH HOH A . D 4 HOH 24 324 13 HOH HOH A . D 4 HOH 25 325 16 HOH HOH A . D 4 HOH 26 326 64 HOH HOH A . D 4 HOH 27 327 43 HOH HOH A . D 4 HOH 28 328 7 HOH HOH A . D 4 HOH 29 329 1 HOH HOH A . D 4 HOH 30 330 28 HOH HOH A . D 4 HOH 31 331 22 HOH HOH A . D 4 HOH 32 332 8 HOH HOH A . D 4 HOH 33 333 29 HOH HOH A . D 4 HOH 34 334 50 HOH HOH A . D 4 HOH 35 335 48 HOH HOH A . D 4 HOH 36 336 12 HOH HOH A . D 4 HOH 37 337 36 HOH HOH A . D 4 HOH 38 338 11 HOH HOH A . D 4 HOH 39 339 6 HOH HOH A . D 4 HOH 40 340 34 HOH HOH A . D 4 HOH 41 341 21 HOH HOH A . D 4 HOH 42 342 17 HOH HOH A . D 4 HOH 43 343 49 HOH HOH A . D 4 HOH 44 344 41 HOH HOH A . D 4 HOH 45 345 5 HOH HOH A . D 4 HOH 46 346 46 HOH HOH A . D 4 HOH 47 347 25 HOH HOH A . D 4 HOH 48 348 45 HOH HOH A . D 4 HOH 49 349 58 HOH HOH A . D 4 HOH 50 350 33 HOH HOH A . D 4 HOH 51 351 52 HOH HOH A . D 4 HOH 52 352 51 HOH HOH A . D 4 HOH 53 353 59 HOH HOH A . D 4 HOH 54 354 37 HOH HOH A . D 4 HOH 55 355 31 HOH HOH A . D 4 HOH 56 356 53 HOH HOH A . D 4 HOH 57 357 27 HOH HOH A . D 4 HOH 58 358 61 HOH HOH A . D 4 HOH 59 359 19 HOH HOH A . D 4 HOH 60 360 20 HOH HOH A . D 4 HOH 61 361 35 HOH HOH A . D 4 HOH 62 362 30 HOH HOH A . D 4 HOH 63 363 55 HOH HOH A . D 4 HOH 64 364 10 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21_5207 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9DEF _cell.details ? _cell.formula_units_Z ? _cell.length_a 31.157 _cell.length_a_esd ? _cell.length_b 46.019 _cell.length_b_esd ? _cell.length_c 92.941 _cell.length_c_esd ? _cell.volume 133260.105 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9DEF _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall 'P 2 2ab (y,z,x)' _symmetry.space_group_name_H-M 'P 21 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9DEF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.82 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.54 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Sodium acetate pH 4.6, 8% (w/v) PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-05-01 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00002 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00002 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 27 _reflns.entry_id 9DEF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 46.02 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14105 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.80 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.084 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low 1.78 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 749 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.6 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.402 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.752 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.60 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.274 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 38.85 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9DEF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.75 _refine.ls_d_res_low 46.02 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14057 _refine.ls_number_reflns_R_free 1406 _refine.ls_number_reflns_R_work 12651 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.69 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2414 _refine.ls_R_factor_R_free 0.2685 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2383 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.0269 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2455 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.75 _refine_hist.d_res_low 46.02 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 1263 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1194 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0091 ? 1232 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8490 ? 1666 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0600 ? 184 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0104 ? 232 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.1021 ? 475 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.75 1.81 . . 137 1229 99.71 . . . . 0.3237 . . . . . . . . . . . 0.3605 'X-RAY DIFFRACTION' 1.81 1.89 . . 137 1231 99.78 . . . . 0.2977 . . . . . . . . . . . 0.3574 'X-RAY DIFFRACTION' 1.89 1.97 . . 136 1245 99.78 . . . . 0.2813 . . . . . . . . . . . 0.2955 'X-RAY DIFFRACTION' 1.97 2.07 . . 141 1252 99.57 . . . . 0.2539 . . . . . . . . . . . 0.3062 'X-RAY DIFFRACTION' 2.07 2.20 . . 138 1241 99.35 . . . . 0.2363 . . . . . . . . . . . 0.2776 'X-RAY DIFFRACTION' 2.21 2.37 . . 138 1241 99.49 . . . . 0.2430 . . . . . . . . . . . 0.3206 'X-RAY DIFFRACTION' 2.38 2.61 . . 140 1267 99.93 . . . . 0.2437 . . . . . . . . . . . 0.2804 'X-RAY DIFFRACTION' 2.61 2.99 . . 142 1269 99.65 . . . . 0.2593 . . . . . . . . . . . 0.2929 'X-RAY DIFFRACTION' 2.99 3.77 . . 144 1299 100.00 . . . . 0.2323 . . . . . . . . . . . 0.2418 'X-RAY DIFFRACTION' 3.77 46.02 . . 153 1377 99.61 . . . . 0.2137 . . . . . . . . . . . 0.2389 # _struct.entry_id 9DEF _struct.title 'The designed serine hydrolase known as win' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9DEF _struct_keywords.text 'serine hydrolase, designed enzyme, helical, lit, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9DEF _struct_ref.pdbx_db_accession 9DEF _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9DEF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 164 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9DEF _struct_ref_seq.db_align_beg -2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -2 _struct_ref_seq.pdbx_auth_seq_align_end 161 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 13 ? GLY A 29 ? VAL A 10 GLY A 26 1 ? 17 HELX_P HELX_P2 AA2 ASP A 33 ? GLY A 50 ? ASP A 30 GLY A 47 1 ? 18 HELX_P HELX_P3 AA3 ASN A 51 ? GLU A 53 ? ASN A 48 GLU A 50 5 ? 3 HELX_P HELX_P4 AA4 ARG A 54 ? ARG A 75 ? ARG A 51 ARG A 72 1 ? 22 HELX_P HELX_P5 AA5 THR A 79 ? GLY A 91 ? THR A 76 GLY A 88 1 ? 13 HELX_P HELX_P6 AA6 GLY A 91 ? ASP A 112 ? GLY A 88 ASP A 109 1 ? 22 HELX_P HELX_P7 AA7 ASP A 112 ? ASN A 121 ? ASP A 109 ASN A 118 1 ? 10 HELX_P HELX_P8 AA8 SER A 123 ? ARG A 140 ? SER A 120 ARG A 137 1 ? 18 HELX_P HELX_P9 AA9 GLY A 143 ? ASN A 160 ? GLY A 140 ASN A 157 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9DEF _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 9 ? ? -89.73 36.46 2 1 ASP A 109 ? ? -158.05 70.52 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 326 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y,-z+1/2 3 -x,y,-z 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -2 ? A MET 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A GLY 0 ? A GLY 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A THR 2 ? A THR 5 6 1 Y 1 A GLU 3 ? A GLU 6 7 1 Y 1 A GLU 4 ? A GLU 7 8 1 Y 1 A GLU 5 ? A GLU 8 9 1 Y 1 A LEU 6 ? A LEU 9 10 1 Y 1 A ASP 7 ? A ASP 10 11 1 Y 1 A GLY 159 ? A GLY 162 12 1 Y 1 A SER 160 ? A SER 163 13 1 Y 1 A GLY 161 ? A GLY 164 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACY C C N N 1 ACY O O N N 2 ACY OXT O N N 3 ACY CH3 C N N 4 ACY HXT H N N 5 ACY H1 H N N 6 ACY H2 H N N 7 ACY H3 H N N 8 ALA N N N N 9 ALA CA C N S 10 ALA C C N N 11 ALA O O N N 12 ALA CB C N N 13 ALA OXT O N N 14 ALA H H N N 15 ALA H2 H N N 16 ALA HA H N N 17 ALA HB1 H N N 18 ALA HB2 H N N 19 ALA HB3 H N N 20 ALA HXT H N N 21 ARG N N N N 22 ARG CA C N S 23 ARG C C N N 24 ARG O O N N 25 ARG CB C N N 26 ARG CG C N N 27 ARG CD C N N 28 ARG NE N N N 29 ARG CZ C N N 30 ARG NH1 N N N 31 ARG NH2 N N N 32 ARG OXT O N N 33 ARG H H N N 34 ARG H2 H N N 35 ARG HA H N N 36 ARG HB2 H N N 37 ARG HB3 H N N 38 ARG HG2 H N N 39 ARG HG3 H N N 40 ARG HD2 H N N 41 ARG HD3 H N N 42 ARG HE H N N 43 ARG HH11 H N N 44 ARG HH12 H N N 45 ARG HH21 H N N 46 ARG HH22 H N N 47 ARG HXT H N N 48 ASN N N N N 49 ASN CA C N S 50 ASN C C N N 51 ASN O O N N 52 ASN CB C N N 53 ASN CG C N N 54 ASN OD1 O N N 55 ASN ND2 N N N 56 ASN OXT O N N 57 ASN H H N N 58 ASN H2 H N N 59 ASN HA H N N 60 ASN HB2 H N N 61 ASN HB3 H N N 62 ASN HD21 H N N 63 ASN HD22 H N N 64 ASN HXT H N N 65 ASP N N N N 66 ASP CA C N S 67 ASP C C N N 68 ASP O O N N 69 ASP CB C N N 70 ASP CG C N N 71 ASP OD1 O N N 72 ASP OD2 O N N 73 ASP OXT O N N 74 ASP H H N N 75 ASP H2 H N N 76 ASP HA H N N 77 ASP HB2 H N N 78 ASP HB3 H N N 79 ASP HD2 H N N 80 ASP HXT H N N 81 CL CL CL N N 82 GLN N N N N 83 GLN CA C N S 84 GLN C C N N 85 GLN O O N N 86 GLN CB C N N 87 GLN CG C N N 88 GLN CD C N N 89 GLN OE1 O N N 90 GLN NE2 N N N 91 GLN OXT O N N 92 GLN H H N N 93 GLN H2 H N N 94 GLN HA H N N 95 GLN HB2 H N N 96 GLN HB3 H N N 97 GLN HG2 H N N 98 GLN HG3 H N N 99 GLN HE21 H N N 100 GLN HE22 H N N 101 GLN HXT H N N 102 GLU N N N N 103 GLU CA C N S 104 GLU C C N N 105 GLU O O N N 106 GLU CB C N N 107 GLU CG C N N 108 GLU CD C N N 109 GLU OE1 O N N 110 GLU OE2 O N N 111 GLU OXT O N N 112 GLU H H N N 113 GLU H2 H N N 114 GLU HA H N N 115 GLU HB2 H N N 116 GLU HB3 H N N 117 GLU HG2 H N N 118 GLU HG3 H N N 119 GLU HE2 H N N 120 GLU HXT H N N 121 GLY N N N N 122 GLY CA C N N 123 GLY C C N N 124 GLY O O N N 125 GLY OXT O N N 126 GLY H H N N 127 GLY H2 H N N 128 GLY HA2 H N N 129 GLY HA3 H N N 130 GLY HXT H N N 131 HIS N N N N 132 HIS CA C N S 133 HIS C C N N 134 HIS O O N N 135 HIS CB C N N 136 HIS CG C Y N 137 HIS ND1 N Y N 138 HIS CD2 C Y N 139 HIS CE1 C Y N 140 HIS NE2 N Y N 141 HIS OXT O N N 142 HIS H H N N 143 HIS H2 H N N 144 HIS HA H N N 145 HIS HB2 H N N 146 HIS HB3 H N N 147 HIS HD1 H N N 148 HIS HD2 H N N 149 HIS HE1 H N N 150 HIS HE2 H N N 151 HIS HXT H N N 152 HOH O O N N 153 HOH H1 H N N 154 HOH H2 H N N 155 ILE N N N N 156 ILE CA C N S 157 ILE C C N N 158 ILE O O N N 159 ILE CB C N S 160 ILE CG1 C N N 161 ILE CG2 C N N 162 ILE CD1 C N N 163 ILE OXT O N N 164 ILE H H N N 165 ILE H2 H N N 166 ILE HA H N N 167 ILE HB H N N 168 ILE HG12 H N N 169 ILE HG13 H N N 170 ILE HG21 H N N 171 ILE HG22 H N N 172 ILE HG23 H N N 173 ILE HD11 H N N 174 ILE HD12 H N N 175 ILE HD13 H N N 176 ILE HXT H N N 177 LEU N N N N 178 LEU CA C N S 179 LEU C C N N 180 LEU O O N N 181 LEU CB C N N 182 LEU CG C N N 183 LEU CD1 C N N 184 LEU CD2 C N N 185 LEU OXT O N N 186 LEU H H N N 187 LEU H2 H N N 188 LEU HA H N N 189 LEU HB2 H N N 190 LEU HB3 H N N 191 LEU HG H N N 192 LEU HD11 H N N 193 LEU HD12 H N N 194 LEU HD13 H N N 195 LEU HD21 H N N 196 LEU HD22 H N N 197 LEU HD23 H N N 198 LEU HXT H N N 199 LYS N N N N 200 LYS CA C N S 201 LYS C C N N 202 LYS O O N N 203 LYS CB C N N 204 LYS CG C N N 205 LYS CD C N N 206 LYS CE C N N 207 LYS NZ N N N 208 LYS OXT O N N 209 LYS H H N N 210 LYS H2 H N N 211 LYS HA H N N 212 LYS HB2 H N N 213 LYS HB3 H N N 214 LYS HG2 H N N 215 LYS HG3 H N N 216 LYS HD2 H N N 217 LYS HD3 H N N 218 LYS HE2 H N N 219 LYS HE3 H N N 220 LYS HZ1 H N N 221 LYS HZ2 H N N 222 LYS HZ3 H N N 223 LYS HXT H N N 224 MET N N N N 225 MET CA C N S 226 MET C C N N 227 MET O O N N 228 MET CB C N N 229 MET CG C N N 230 MET SD S N N 231 MET CE C N N 232 MET OXT O N N 233 MET H H N N 234 MET H2 H N N 235 MET HA H N N 236 MET HB2 H N N 237 MET HB3 H N N 238 MET HG2 H N N 239 MET HG3 H N N 240 MET HE1 H N N 241 MET HE2 H N N 242 MET HE3 H N N 243 MET HXT H N N 244 PHE N N N N 245 PHE CA C N S 246 PHE C C N N 247 PHE O O N N 248 PHE CB C N N 249 PHE CG C Y N 250 PHE CD1 C Y N 251 PHE CD2 C Y N 252 PHE CE1 C Y N 253 PHE CE2 C Y N 254 PHE CZ C Y N 255 PHE OXT O N N 256 PHE H H N N 257 PHE H2 H N N 258 PHE HA H N N 259 PHE HB2 H N N 260 PHE HB3 H N N 261 PHE HD1 H N N 262 PHE HD2 H N N 263 PHE HE1 H N N 264 PHE HE2 H N N 265 PHE HZ H N N 266 PHE HXT H N N 267 PRO N N N N 268 PRO CA C N S 269 PRO C C N N 270 PRO O O N N 271 PRO CB C N N 272 PRO CG C N N 273 PRO CD C N N 274 PRO OXT O N N 275 PRO H H N N 276 PRO HA H N N 277 PRO HB2 H N N 278 PRO HB3 H N N 279 PRO HG2 H N N 280 PRO HG3 H N N 281 PRO HD2 H N N 282 PRO HD3 H N N 283 PRO HXT H N N 284 SER N N N N 285 SER CA C N S 286 SER C C N N 287 SER O O N N 288 SER CB C N N 289 SER OG O N N 290 SER OXT O N N 291 SER H H N N 292 SER H2 H N N 293 SER HA H N N 294 SER HB2 H N N 295 SER HB3 H N N 296 SER HG H N N 297 SER HXT H N N 298 THR N N N N 299 THR CA C N S 300 THR C C N N 301 THR O O N N 302 THR CB C N R 303 THR OG1 O N N 304 THR CG2 C N N 305 THR OXT O N N 306 THR H H N N 307 THR H2 H N N 308 THR HA H N N 309 THR HB H N N 310 THR HG1 H N N 311 THR HG21 H N N 312 THR HG22 H N N 313 THR HG23 H N N 314 THR HXT H N N 315 VAL N N N N 316 VAL CA C N S 317 VAL C C N N 318 VAL O O N N 319 VAL CB C N N 320 VAL CG1 C N N 321 VAL CG2 C N N 322 VAL OXT O N N 323 VAL H H N N 324 VAL H2 H N N 325 VAL HA H N N 326 VAL HB H N N 327 VAL HG11 H N N 328 VAL HG12 H N N 329 VAL HG13 H N N 330 VAL HG21 H N N 331 VAL HG22 H N N 332 VAL HG23 H N N 333 VAL HXT H N N 334 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACY C O doub N N 1 ACY C OXT sing N N 2 ACY C CH3 sing N N 3 ACY OXT HXT sing N N 4 ACY CH3 H1 sing N N 5 ACY CH3 H2 sing N N 6 ACY CH3 H3 sing N N 7 ALA N CA sing N N 8 ALA N H sing N N 9 ALA N H2 sing N N 10 ALA CA C sing N N 11 ALA CA CB sing N N 12 ALA CA HA sing N N 13 ALA C O doub N N 14 ALA C OXT sing N N 15 ALA CB HB1 sing N N 16 ALA CB HB2 sing N N 17 ALA CB HB3 sing N N 18 ALA OXT HXT sing N N 19 ARG N CA sing N N 20 ARG N H sing N N 21 ARG N H2 sing N N 22 ARG CA C sing N N 23 ARG CA CB sing N N 24 ARG CA HA sing N N 25 ARG C O doub N N 26 ARG C OXT sing N N 27 ARG CB CG sing N N 28 ARG CB HB2 sing N N 29 ARG CB HB3 sing N N 30 ARG CG CD sing N N 31 ARG CG HG2 sing N N 32 ARG CG HG3 sing N N 33 ARG CD NE sing N N 34 ARG CD HD2 sing N N 35 ARG CD HD3 sing N N 36 ARG NE CZ sing N N 37 ARG NE HE sing N N 38 ARG CZ NH1 sing N N 39 ARG CZ NH2 doub N N 40 ARG NH1 HH11 sing N N 41 ARG NH1 HH12 sing N N 42 ARG NH2 HH21 sing N N 43 ARG NH2 HH22 sing N N 44 ARG OXT HXT sing N N 45 ASN N CA sing N N 46 ASN N H sing N N 47 ASN N H2 sing N N 48 ASN CA C sing N N 49 ASN CA CB sing N N 50 ASN CA HA sing N N 51 ASN C O doub N N 52 ASN C OXT sing N N 53 ASN CB CG sing N N 54 ASN CB HB2 sing N N 55 ASN CB HB3 sing N N 56 ASN CG OD1 doub N N 57 ASN CG ND2 sing N N 58 ASN ND2 HD21 sing N N 59 ASN ND2 HD22 sing N N 60 ASN OXT HXT sing N N 61 ASP N CA sing N N 62 ASP N H sing N N 63 ASP N H2 sing N N 64 ASP CA C sing N N 65 ASP CA CB sing N N 66 ASP CA HA sing N N 67 ASP C O doub N N 68 ASP C OXT sing N N 69 ASP CB CG sing N N 70 ASP CB HB2 sing N N 71 ASP CB HB3 sing N N 72 ASP CG OD1 doub N N 73 ASP CG OD2 sing N N 74 ASP OD2 HD2 sing N N 75 ASP OXT HXT sing N N 76 GLN N CA sing N N 77 GLN N H sing N N 78 GLN N H2 sing N N 79 GLN CA C sing N N 80 GLN CA CB sing N N 81 GLN CA HA sing N N 82 GLN C O doub N N 83 GLN C OXT sing N N 84 GLN CB CG sing N N 85 GLN CB HB2 sing N N 86 GLN CB HB3 sing N N 87 GLN CG CD sing N N 88 GLN CG HG2 sing N N 89 GLN CG HG3 sing N N 90 GLN CD OE1 doub N N 91 GLN CD NE2 sing N N 92 GLN NE2 HE21 sing N N 93 GLN NE2 HE22 sing N N 94 GLN OXT HXT sing N N 95 GLU N CA sing N N 96 GLU N H sing N N 97 GLU N H2 sing N N 98 GLU CA C sing N N 99 GLU CA CB sing N N 100 GLU CA HA sing N N 101 GLU C O doub N N 102 GLU C OXT sing N N 103 GLU CB CG sing N N 104 GLU CB HB2 sing N N 105 GLU CB HB3 sing N N 106 GLU CG CD sing N N 107 GLU CG HG2 sing N N 108 GLU CG HG3 sing N N 109 GLU CD OE1 doub N N 110 GLU CD OE2 sing N N 111 GLU OE2 HE2 sing N N 112 GLU OXT HXT sing N N 113 GLY N CA sing N N 114 GLY N H sing N N 115 GLY N H2 sing N N 116 GLY CA C sing N N 117 GLY CA HA2 sing N N 118 GLY CA HA3 sing N N 119 GLY C O doub N N 120 GLY C OXT sing N N 121 GLY OXT HXT sing N N 122 HIS N CA sing N N 123 HIS N H sing N N 124 HIS N H2 sing N N 125 HIS CA C sing N N 126 HIS CA CB sing N N 127 HIS CA HA sing N N 128 HIS C O doub N N 129 HIS C OXT sing N N 130 HIS CB CG sing N N 131 HIS CB HB2 sing N N 132 HIS CB HB3 sing N N 133 HIS CG ND1 sing Y N 134 HIS CG CD2 doub Y N 135 HIS ND1 CE1 doub Y N 136 HIS ND1 HD1 sing N N 137 HIS CD2 NE2 sing Y N 138 HIS CD2 HD2 sing N N 139 HIS CE1 NE2 sing Y N 140 HIS CE1 HE1 sing N N 141 HIS NE2 HE2 sing N N 142 HIS OXT HXT sing N N 143 HOH O H1 sing N N 144 HOH O H2 sing N N 145 ILE N CA sing N N 146 ILE N H sing N N 147 ILE N H2 sing N N 148 ILE CA C sing N N 149 ILE CA CB sing N N 150 ILE CA HA sing N N 151 ILE C O doub N N 152 ILE C OXT sing N N 153 ILE CB CG1 sing N N 154 ILE CB CG2 sing N N 155 ILE CB HB sing N N 156 ILE CG1 CD1 sing N N 157 ILE CG1 HG12 sing N N 158 ILE CG1 HG13 sing N N 159 ILE CG2 HG21 sing N N 160 ILE CG2 HG22 sing N N 161 ILE CG2 HG23 sing N N 162 ILE CD1 HD11 sing N N 163 ILE CD1 HD12 sing N N 164 ILE CD1 HD13 sing N N 165 ILE OXT HXT sing N N 166 LEU N CA sing N N 167 LEU N H sing N N 168 LEU N H2 sing N N 169 LEU CA C sing N N 170 LEU CA CB sing N N 171 LEU CA HA sing N N 172 LEU C O doub N N 173 LEU C OXT sing N N 174 LEU CB CG sing N N 175 LEU CB HB2 sing N N 176 LEU CB HB3 sing N N 177 LEU CG CD1 sing N N 178 LEU CG CD2 sing N N 179 LEU CG HG sing N N 180 LEU CD1 HD11 sing N N 181 LEU CD1 HD12 sing N N 182 LEU CD1 HD13 sing N N 183 LEU CD2 HD21 sing N N 184 LEU CD2 HD22 sing N N 185 LEU CD2 HD23 sing N N 186 LEU OXT HXT sing N N 187 LYS N CA sing N N 188 LYS N H sing N N 189 LYS N H2 sing N N 190 LYS CA C sing N N 191 LYS CA CB sing N N 192 LYS CA HA sing N N 193 LYS C O doub N N 194 LYS C OXT sing N N 195 LYS CB CG sing N N 196 LYS CB HB2 sing N N 197 LYS CB HB3 sing N N 198 LYS CG CD sing N N 199 LYS CG HG2 sing N N 200 LYS CG HG3 sing N N 201 LYS CD CE sing N N 202 LYS CD HD2 sing N N 203 LYS CD HD3 sing N N 204 LYS CE NZ sing N N 205 LYS CE HE2 sing N N 206 LYS CE HE3 sing N N 207 LYS NZ HZ1 sing N N 208 LYS NZ HZ2 sing N N 209 LYS NZ HZ3 sing N N 210 LYS OXT HXT sing N N 211 MET N CA sing N N 212 MET N H sing N N 213 MET N H2 sing N N 214 MET CA C sing N N 215 MET CA CB sing N N 216 MET CA HA sing N N 217 MET C O doub N N 218 MET C OXT sing N N 219 MET CB CG sing N N 220 MET CB HB2 sing N N 221 MET CB HB3 sing N N 222 MET CG SD sing N N 223 MET CG HG2 sing N N 224 MET CG HG3 sing N N 225 MET SD CE sing N N 226 MET CE HE1 sing N N 227 MET CE HE2 sing N N 228 MET CE HE3 sing N N 229 MET OXT HXT sing N N 230 PHE N CA sing N N 231 PHE N H sing N N 232 PHE N H2 sing N N 233 PHE CA C sing N N 234 PHE CA CB sing N N 235 PHE CA HA sing N N 236 PHE C O doub N N 237 PHE C OXT sing N N 238 PHE CB CG sing N N 239 PHE CB HB2 sing N N 240 PHE CB HB3 sing N N 241 PHE CG CD1 doub Y N 242 PHE CG CD2 sing Y N 243 PHE CD1 CE1 sing Y N 244 PHE CD1 HD1 sing N N 245 PHE CD2 CE2 doub Y N 246 PHE CD2 HD2 sing N N 247 PHE CE1 CZ doub Y N 248 PHE CE1 HE1 sing N N 249 PHE CE2 CZ sing Y N 250 PHE CE2 HE2 sing N N 251 PHE CZ HZ sing N N 252 PHE OXT HXT sing N N 253 PRO N CA sing N N 254 PRO N CD sing N N 255 PRO N H sing N N 256 PRO CA C sing N N 257 PRO CA CB sing N N 258 PRO CA HA sing N N 259 PRO C O doub N N 260 PRO C OXT sing N N 261 PRO CB CG sing N N 262 PRO CB HB2 sing N N 263 PRO CB HB3 sing N N 264 PRO CG CD sing N N 265 PRO CG HG2 sing N N 266 PRO CG HG3 sing N N 267 PRO CD HD2 sing N N 268 PRO CD HD3 sing N N 269 PRO OXT HXT sing N N 270 SER N CA sing N N 271 SER N H sing N N 272 SER N H2 sing N N 273 SER CA C sing N N 274 SER CA CB sing N N 275 SER CA HA sing N N 276 SER C O doub N N 277 SER C OXT sing N N 278 SER CB OG sing N N 279 SER CB HB2 sing N N 280 SER CB HB3 sing N N 281 SER OG HG sing N N 282 SER OXT HXT sing N N 283 THR N CA sing N N 284 THR N H sing N N 285 THR N H2 sing N N 286 THR CA C sing N N 287 THR CA CB sing N N 288 THR CA HA sing N N 289 THR C O doub N N 290 THR C OXT sing N N 291 THR CB OG1 sing N N 292 THR CB CG2 sing N N 293 THR CB HB sing N N 294 THR OG1 HG1 sing N N 295 THR CG2 HG21 sing N N 296 THR CG2 HG22 sing N N 297 THR CG2 HG23 sing N N 298 THR OXT HXT sing N N 299 VAL N CA sing N N 300 VAL N H sing N N 301 VAL N H2 sing N N 302 VAL CA C sing N N 303 VAL CA CB sing N N 304 VAL CA HA sing N N 305 VAL C O doub N N 306 VAL C OXT sing N N 307 VAL CB CG1 sing N N 308 VAL CB CG2 sing N N 309 VAL CB HB sing N N 310 VAL CG1 HG11 sing N N 311 VAL CG1 HG12 sing N N 312 VAL CG1 HG13 sing N N 313 VAL CG2 HG21 sing N N 314 VAL CG2 HG22 sing N N 315 VAL CG2 HG23 sing N N 316 VAL OXT HXT sing N N 317 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Howard Hughes Medical Institute (HHMI)' 'United States' ? 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' ? 2 'Defense Advanced Research Projects Agency (DARPA)' 'United States' ? 3 'Defense Threat Reduction Agency (DTRA)' 'United States' ? 4 'Other private' ? ? 5 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 2 21' _space_group.name_Hall 'P 2 2ab (y,z,x)' _space_group.IT_number 18 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9DEF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.032096 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021730 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010760 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #