data_9DEU # _entry.id 9DEU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9DEU pdb_00009deu 10.2210/pdb9deu/pdb WWPDB D_1000287396 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-12-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _database_PDB_caveat.id _database_PDB_caveat.text 1 ;Residues ILE A 33 and GLN A 34 that are next to each other in the sample sequence are not properly linked: distance between C and N is 1.19. ; 2 ;Residues LEU A 95 and GLU A 96 that are next to each other in the sample sequence are not properly linked: distance between C and N is 1.19. ; 3 ;Residues ALA A 116 and SER A 117 that are next to each other in the sample sequence are not properly linked: distance between C and N is 0.87. ; 4 ;esidues GLY A 154 and VAL A 155 that are next to each other in the sample sequence are not properly linked: distance between C and N is 1.20. ; 5 ;Residues GLN A 166 and ASN A 167 that are next to each other in the sample sequence are not properly linked: distance between C and N is 1.12. ; 6 ;Residues ASN A 167 and TYR A 168 that are next to each other in the sample sequence are not properly linked: distance between C and N is 1.15 ; # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9DEU _pdbx_database_status.recvd_initial_deposition_date 2024-08-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email bruner@chem.ufl.edu _pdbx_contact_author.name_first Steven _pdbx_contact_author.name_last Bruner _pdbx_contact_author.name_mi D. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0522-480X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hu, Y.' 1 ? 'Bruner, S.D.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Mechanism of Catalysis and Substrate Binding of Epoxyqueuosine Reductase in the Biosynthetic Pathway to Queuosine-Modified tRNA.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.4c00524 _citation.pdbx_database_id_PubMed 39644232 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hu, Y.' 1 ? primary 'Jaroch, M.' 2 ? primary 'Sun, G.' 3 ? primary 'Dedon, P.C.' 4 0000-0003-0011-3067 primary 'de Crecy-Lagard, V.' 5 0000-0002-9955-3785 primary 'Bruner, S.D.' 6 0000-0002-0522-480X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epoxyqueuosine reductase QueH' 22548.875 1 1.17.99.6 ? ? ? 2 non-polymer syn ;2-amino-5-({[(1S,4S,5R)-4,5-dihydroxycyclopent-2-en-1-yl]amino}methyl)-7-(5-O-phosphono-beta-D-ribofuranosyl)-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one ; 489.374 1 ? ? ? ? 3 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 non-polymer nat 'ZINC ION' 65.409 1 ? ? ? ? 6 water nat water 18.015 57 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Queuosine biosynthesis protein QueH' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGTVLIHVCCAPDLLTTIFHVRDAEFFFYNPNIQPLSEYEKRREAVDKVANHFSLNVRYGEYSTEEIRKWYTAVKDYKDL GEGSKRCERCISFLLERTAQEARKRGHESFSTTLLASPRKNLPMIENIGKTIEEKYGVKFFFKNFRKGGAYQEGVRLSKE LGIYRQNYCGCVFSLLERREKHAEISRKRGHM ; _entity_poly.pdbx_seq_one_letter_code_can ;MGTVLIHVCCAPDLLTTIFHVRDAEFFFYNPNIQPLSEYEKRREAVDKVANHFSLNVRYGEYSTEEIRKWYTAVKDYKDL GEGSKRCERCISFLLERTAQEARKRGHESFSTTLLASPRKNLPMIENIGKTIEEKYGVKFFFKNFRKGGAYQEGVRLSKE LGIYRQNYCGCVFSLLERREKHAEISRKRGHM ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;2-amino-5-({[(1S,4S,5R)-4,5-dihydroxycyclopent-2-en-1-yl]amino}methyl)-7-(5-O-phosphono-beta-D-ribofuranosyl)-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one ; 56B 3 'IRON/SULFUR CLUSTER' SF4 4 'CHLORIDE ION' CL 5 'ZINC ION' ZN 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 THR n 1 4 VAL n 1 5 LEU n 1 6 ILE n 1 7 HIS n 1 8 VAL n 1 9 CYS n 1 10 CYS n 1 11 ALA n 1 12 PRO n 1 13 ASP n 1 14 LEU n 1 15 LEU n 1 16 THR n 1 17 THR n 1 18 ILE n 1 19 PHE n 1 20 HIS n 1 21 VAL n 1 22 ARG n 1 23 ASP n 1 24 ALA n 1 25 GLU n 1 26 PHE n 1 27 PHE n 1 28 PHE n 1 29 TYR n 1 30 ASN n 1 31 PRO n 1 32 ASN n 1 33 ILE n 1 34 GLN n 1 35 PRO n 1 36 LEU n 1 37 SER n 1 38 GLU n 1 39 TYR n 1 40 GLU n 1 41 LYS n 1 42 ARG n 1 43 ARG n 1 44 GLU n 1 45 ALA n 1 46 VAL n 1 47 ASP n 1 48 LYS n 1 49 VAL n 1 50 ALA n 1 51 ASN n 1 52 HIS n 1 53 PHE n 1 54 SER n 1 55 LEU n 1 56 ASN n 1 57 VAL n 1 58 ARG n 1 59 TYR n 1 60 GLY n 1 61 GLU n 1 62 TYR n 1 63 SER n 1 64 THR n 1 65 GLU n 1 66 GLU n 1 67 ILE n 1 68 ARG n 1 69 LYS n 1 70 TRP n 1 71 TYR n 1 72 THR n 1 73 ALA n 1 74 VAL n 1 75 LYS n 1 76 ASP n 1 77 TYR n 1 78 LYS n 1 79 ASP n 1 80 LEU n 1 81 GLY n 1 82 GLU n 1 83 GLY n 1 84 SER n 1 85 LYS n 1 86 ARG n 1 87 CYS n 1 88 GLU n 1 89 ARG n 1 90 CYS n 1 91 ILE n 1 92 SER n 1 93 PHE n 1 94 LEU n 1 95 LEU n 1 96 GLU n 1 97 ARG n 1 98 THR n 1 99 ALA n 1 100 GLN n 1 101 GLU n 1 102 ALA n 1 103 ARG n 1 104 LYS n 1 105 ARG n 1 106 GLY n 1 107 HIS n 1 108 GLU n 1 109 SER n 1 110 PHE n 1 111 SER n 1 112 THR n 1 113 THR n 1 114 LEU n 1 115 LEU n 1 116 ALA n 1 117 SER n 1 118 PRO n 1 119 ARG n 1 120 LYS n 1 121 ASN n 1 122 LEU n 1 123 PRO n 1 124 MET n 1 125 ILE n 1 126 GLU n 1 127 ASN n 1 128 ILE n 1 129 GLY n 1 130 LYS n 1 131 THR n 1 132 ILE n 1 133 GLU n 1 134 GLU n 1 135 LYS n 1 136 TYR n 1 137 GLY n 1 138 VAL n 1 139 LYS n 1 140 PHE n 1 141 PHE n 1 142 PHE n 1 143 LYS n 1 144 ASN n 1 145 PHE n 1 146 ARG n 1 147 LYS n 1 148 GLY n 1 149 GLY n 1 150 ALA n 1 151 TYR n 1 152 GLN n 1 153 GLU n 1 154 GLY n 1 155 VAL n 1 156 ARG n 1 157 LEU n 1 158 SER n 1 159 LYS n 1 160 GLU n 1 161 LEU n 1 162 GLY n 1 163 ILE n 1 164 TYR n 1 165 ARG n 1 166 GLN n 1 167 ASN n 1 168 TYR n 1 169 CYS n 1 170 GLY n 1 171 CYS n 1 172 VAL n 1 173 PHE n 1 174 SER n 1 175 LEU n 1 176 LEU n 1 177 GLU n 1 178 ARG n 1 179 ARG n 1 180 GLU n 1 181 LYS n 1 182 HIS n 1 183 ALA n 1 184 GLU n 1 185 ILE n 1 186 SER n 1 187 ARG n 1 188 LYS n 1 189 ARG n 1 190 GLY n 1 191 HIS n 1 192 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 192 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'queH, TM_0731' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermotoga maritima MSB8' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 56B 'RNA linking' . ;2-amino-5-({[(1S,4S,5R)-4,5-dihydroxycyclopent-2-en-1-yl]amino}methyl)-7-(5-O-phosphono-beta-D-ribofuranosyl)-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one ; ? 'C17 H24 N5 O10 P' 489.374 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SF4 non-polymer . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4' 351.640 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 TRP 70 70 70 TRP TRP A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 ? ? ? A . n A 1 76 ASP 76 76 ? ? ? A . n A 1 77 TYR 77 77 ? ? ? A . n A 1 78 LYS 78 78 ? ? ? A . n A 1 79 ASP 79 79 ? ? ? A . n A 1 80 LEU 80 80 ? ? ? A . n A 1 81 GLY 81 81 ? ? ? A . n A 1 82 GLU 82 82 ? ? ? A . n A 1 83 GLY 83 83 ? ? ? A . n A 1 84 SER 84 84 ? ? ? A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 MET 124 124 124 MET MET A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 CYS 169 169 169 CYS CYS A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 CYS 171 171 171 CYS CYS A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 PHE 173 173 ? ? ? A . n A 1 174 SER 174 174 ? ? ? A . n A 1 175 LEU 175 175 ? ? ? A . n A 1 176 LEU 176 176 ? ? ? A . n A 1 177 GLU 177 177 ? ? ? A . n A 1 178 ARG 178 178 ? ? ? A . n A 1 179 ARG 179 179 ? ? ? A . n A 1 180 GLU 180 180 ? ? ? A . n A 1 181 LYS 181 181 ? ? ? A . n A 1 182 HIS 182 182 ? ? ? A . n A 1 183 ALA 183 183 ? ? ? A . n A 1 184 GLU 184 184 ? ? ? A . n A 1 185 ILE 185 185 ? ? ? A . n A 1 186 SER 186 186 ? ? ? A . n A 1 187 ARG 187 187 ? ? ? A . n A 1 188 LYS 188 188 ? ? ? A . n A 1 189 ARG 189 189 ? ? ? A . n A 1 190 GLY 190 190 ? ? ? A . n A 1 191 HIS 191 191 ? ? ? A . n A 1 192 MET 192 192 ? ? ? A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 56B ? ? 56B ? ? 'SUBJECT OF INVESTIGATION' ? 2 CL ? ? CL ? ? 'SUBJECT OF INVESTIGATION' ? 3 SF4 ? ? SF4 ? ? 'SUBJECT OF INVESTIGATION' ? 4 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 56B 1 201 201 56B 56B A . C 3 SF4 1 202 501 SF4 SF4 A . D 4 CL 1 203 503 CL CL A . E 5 ZN 1 204 1 ZN ZN A . F 6 HOH 1 301 76 HOH HOH A . F 6 HOH 2 302 53 HOH HOH A . F 6 HOH 3 303 34 HOH HOH A . F 6 HOH 4 304 72 HOH HOH A . F 6 HOH 5 305 19 HOH HOH A . F 6 HOH 6 306 39 HOH HOH A . F 6 HOH 7 307 33 HOH HOH A . F 6 HOH 8 308 61 HOH HOH A . F 6 HOH 9 309 70 HOH HOH A . F 6 HOH 10 310 30 HOH HOH A . F 6 HOH 11 311 24 HOH HOH A . F 6 HOH 12 312 3 HOH HOH A . F 6 HOH 13 313 23 HOH HOH A . F 6 HOH 14 314 28 HOH HOH A . F 6 HOH 15 315 4 HOH HOH A . F 6 HOH 16 316 44 HOH HOH A . F 6 HOH 17 317 8 HOH HOH A . F 6 HOH 18 318 12 HOH HOH A . F 6 HOH 19 319 15 HOH HOH A . F 6 HOH 20 320 46 HOH HOH A . F 6 HOH 21 321 5 HOH HOH A . F 6 HOH 22 322 2 HOH HOH A . F 6 HOH 23 323 1 HOH HOH A . F 6 HOH 24 324 73 HOH HOH A . F 6 HOH 25 325 11 HOH HOH A . F 6 HOH 26 326 16 HOH HOH A . F 6 HOH 27 327 18 HOH HOH A . F 6 HOH 28 328 7 HOH HOH A . F 6 HOH 29 329 10 HOH HOH A . F 6 HOH 30 330 9 HOH HOH A . F 6 HOH 31 331 37 HOH HOH A . F 6 HOH 32 332 69 HOH HOH A . F 6 HOH 33 333 35 HOH HOH A . F 6 HOH 34 334 20 HOH HOH A . F 6 HOH 35 335 17 HOH HOH A . F 6 HOH 36 336 38 HOH HOH A . F 6 HOH 37 337 29 HOH HOH A . F 6 HOH 38 338 55 HOH HOH A . F 6 HOH 39 339 22 HOH HOH A . F 6 HOH 40 340 31 HOH HOH A . F 6 HOH 41 341 42 HOH HOH A . F 6 HOH 42 342 6 HOH HOH A . F 6 HOH 43 343 49 HOH HOH A . F 6 HOH 44 344 21 HOH HOH A . F 6 HOH 45 345 13 HOH HOH A . F 6 HOH 46 346 57 HOH HOH A . F 6 HOH 47 347 75 HOH HOH A . F 6 HOH 48 348 65 HOH HOH A . F 6 HOH 49 349 36 HOH HOH A . F 6 HOH 50 350 41 HOH HOH A . F 6 HOH 51 351 63 HOH HOH A . F 6 HOH 52 352 40 HOH HOH A . F 6 HOH 53 353 48 HOH HOH A . F 6 HOH 54 354 32 HOH HOH A . F 6 HOH 55 355 43 HOH HOH A . F 6 HOH 56 356 67 HOH HOH A . F 6 HOH 57 357 60 HOH HOH A . # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id 56B _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 201 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id OP3 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id B _pdbx_unobs_or_zero_occ_atoms.label_comp_id 56B _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id OP3 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9DEU _cell.details ? _cell.formula_units_Z ? _cell.length_a 53.647 _cell.length_a_esd ? _cell.length_b 105.194 _cell.length_b_esd ? _cell.length_c 73.792 _cell.length_c_esd ? _cell.volume 416433.531 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9DEU _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9DEU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Bis-Tris, pH 5.5, 200 mM lithium sulfate monohydrate, 25% PEG3350, 10 mM CaCl2' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-07-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.033 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.033 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 30.54 _reflns.entry_id 9DEU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.70 _reflns.d_resolution_low 36.9 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22745 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.68 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.86 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.76 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1901 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.706 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 42.01 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9DEU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.70 _refine.ls_d_res_low 36.90 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22742 _refine.ls_number_reflns_R_free 1212 _refine.ls_number_reflns_R_work 21530 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.70 _refine.ls_percent_reflns_R_free 5.33 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2199 _refine.ls_R_factor_R_free 0.2292 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2194 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.8976 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1899 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 36.90 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 1421 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1322 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0239 ? 1398 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.4218 ? 1891 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.5070 ? 202 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0452 ? 234 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.2040 ? 517 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.70 1.77 . . 107 2011 83.42 . . . . 0.2673 . . . . . . . . . . . 0.3185 'X-RAY DIFFRACTION' 1.77 1.85 . . 150 2316 95.77 . . . . 0.2352 . . . . . . . . . . . 0.2347 'X-RAY DIFFRACTION' 1.85 1.95 . . 135 2406 100.00 . . . . 0.2322 . . . . . . . . . . . 0.2680 'X-RAY DIFFRACTION' 1.95 2.07 . . 132 2417 99.92 . . . . 0.2200 . . . . . . . . . . . 0.2453 'X-RAY DIFFRACTION' 2.07 2.23 . . 122 2450 100.00 . . . . 0.2182 . . . . . . . . . . . 0.2302 'X-RAY DIFFRACTION' 2.23 2.46 . . 157 2420 100.00 . . . . 0.2197 . . . . . . . . . . . 0.2560 'X-RAY DIFFRACTION' 2.46 2.81 . . 136 2448 100.00 . . . . 0.2299 . . . . . . . . . . . 0.2101 'X-RAY DIFFRACTION' 2.81 3.54 . . 153 2456 99.92 . . . . 0.2144 . . . . . . . . . . . 0.2456 'X-RAY DIFFRACTION' 3.54 36.90 . . 120 2606 99.96 . . . . 0.2146 . . . . . . . . . . . 0.2068 # _struct.entry_id 9DEU _struct.title 'Crystal structure of epoxyqueuosine reductase QueH in complex with queuosine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9DEU _struct_keywords.text 'Queuosine Biosynthesis, Epoxyqueuosine Reductase, Metalloenzyme, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code QUEH_THEMA _struct_ref.pdbx_db_accession Q9WZJ0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGTVLIHVCCAPDLLTTIFHVRDAEFFFYNPNIQPLSEYEKRREAVDKVANHFSLNVRYGEYSTEEIRKWYTAVKDYKDL GEGSKRCERCISFLLERTAQEARKRGHESFSTTLLASPRKNLPMIENIGKTIEEKYGVKFFFKNFRKGGAYQEGVRLSKE LGIYRQNYCGCVFSLLERREKHAEISRKRGHM ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9DEU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 192 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9WZJ0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 192 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 192 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 10 ? ILE A 18 ? CYS A 10 ILE A 18 1 ? 9 HELX_P HELX_P2 AA2 PRO A 35 ? SER A 54 ? PRO A 35 SER A 54 1 ? 20 HELX_P HELX_P3 AA3 SER A 63 ? VAL A 74 ? SER A 63 VAL A 74 1 ? 12 HELX_P HELX_P4 AA4 ARG A 86 ? ARG A 105 ? ARG A 86 ARG A 105 1 ? 20 HELX_P HELX_P5 AA5 LEU A 114 ? SER A 117 ? LEU A 114 SER A 117 5 ? 4 HELX_P HELX_P6 AA6 ASN A 121 ? GLY A 137 ? ASN A 121 GLY A 137 1 ? 17 HELX_P HELX_P7 AA7 GLY A 149 ? GLY A 162 ? GLY A 149 GLY A 162 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 9 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 9 A ZN 204 1_555 ? ? ? ? ? ? ? 2.243 ? ? metalc2 metalc ? ? A CYS 10 SG ? ? ? 1_555 E ZN . ZN ? ? A CYS 10 A ZN 204 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc3 metalc ? ? A ASP 13 OD2 ? ? ? 1_555 E ZN . ZN ? ? A ASP 13 A ZN 204 1_555 ? ? ? ? ? ? ? 1.955 ? ? metalc4 metalc ? ? A CYS 87 SG ? ? ? 1_555 C SF4 . FE2 ? ? A CYS 87 A SF4 202 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc5 metalc ? ? A CYS 90 SG ? ? ? 1_555 C SF4 . FE3 ? ? A CYS 90 A SF4 202 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc6 metalc ? ? A CYS 169 SG ? ? ? 1_555 C SF4 . FE1 ? ? A CYS 169 A SF4 202 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc7 metalc ? ? A CYS 171 SG ? ? ? 1_555 C SF4 . FE4 ? ? A CYS 171 A SF4 202 1_555 ? ? ? ? ? ? ? 2.349 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 SG ? A CYS 10 ? A CYS 10 ? 1_555 126.1 ? 2 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 OD2 ? A ASP 13 ? A ASP 13 ? 1_555 104.8 ? 3 SG ? A CYS 10 ? A CYS 10 ? 1_555 ZN ? E ZN . ? A ZN 204 ? 1_555 OD2 ? A ASP 13 ? A ASP 13 ? 1_555 94.4 ? 4 SG ? A CYS 87 ? A CYS 87 ? 1_555 FE2 ? C SF4 . ? A SF4 202 ? 1_555 S1 ? C SF4 . ? A SF4 202 ? 1_555 119.0 ? 5 SG ? A CYS 87 ? A CYS 87 ? 1_555 FE2 ? C SF4 . ? A SF4 202 ? 1_555 S3 ? C SF4 . ? A SF4 202 ? 1_555 114.0 ? 6 S1 ? C SF4 . ? A SF4 202 ? 1_555 FE2 ? C SF4 . ? A SF4 202 ? 1_555 S3 ? C SF4 . ? A SF4 202 ? 1_555 103.6 ? 7 SG ? A CYS 87 ? A CYS 87 ? 1_555 FE2 ? C SF4 . ? A SF4 202 ? 1_555 S4 ? C SF4 . ? A SF4 202 ? 1_555 110.9 ? 8 S1 ? C SF4 . ? A SF4 202 ? 1_555 FE2 ? C SF4 . ? A SF4 202 ? 1_555 S4 ? C SF4 . ? A SF4 202 ? 1_555 103.8 ? 9 S3 ? C SF4 . ? A SF4 202 ? 1_555 FE2 ? C SF4 . ? A SF4 202 ? 1_555 S4 ? C SF4 . ? A SF4 202 ? 1_555 104.1 ? 10 SG ? A CYS 90 ? A CYS 90 ? 1_555 FE3 ? C SF4 . ? A SF4 202 ? 1_555 S1 ? C SF4 . ? A SF4 202 ? 1_555 114.8 ? 11 SG ? A CYS 90 ? A CYS 90 ? 1_555 FE3 ? C SF4 . ? A SF4 202 ? 1_555 S2 ? C SF4 . ? A SF4 202 ? 1_555 111.8 ? 12 S1 ? C SF4 . ? A SF4 202 ? 1_555 FE3 ? C SF4 . ? A SF4 202 ? 1_555 S2 ? C SF4 . ? A SF4 202 ? 1_555 103.9 ? 13 SG ? A CYS 90 ? A CYS 90 ? 1_555 FE3 ? C SF4 . ? A SF4 202 ? 1_555 S4 ? C SF4 . ? A SF4 202 ? 1_555 117.1 ? 14 S1 ? C SF4 . ? A SF4 202 ? 1_555 FE3 ? C SF4 . ? A SF4 202 ? 1_555 S4 ? C SF4 . ? A SF4 202 ? 1_555 103.8 ? 15 S2 ? C SF4 . ? A SF4 202 ? 1_555 FE3 ? C SF4 . ? A SF4 202 ? 1_555 S4 ? C SF4 . ? A SF4 202 ? 1_555 104.1 ? 16 SG ? A CYS 169 ? A CYS 169 ? 1_555 FE1 ? C SF4 . ? A SF4 202 ? 1_555 S2 ? C SF4 . ? A SF4 202 ? 1_555 120.1 ? 17 SG ? A CYS 169 ? A CYS 169 ? 1_555 FE1 ? C SF4 . ? A SF4 202 ? 1_555 S3 ? C SF4 . ? A SF4 202 ? 1_555 103.2 ? 18 S2 ? C SF4 . ? A SF4 202 ? 1_555 FE1 ? C SF4 . ? A SF4 202 ? 1_555 S3 ? C SF4 . ? A SF4 202 ? 1_555 104.1 ? 19 SG ? A CYS 169 ? A CYS 169 ? 1_555 FE1 ? C SF4 . ? A SF4 202 ? 1_555 S4 ? C SF4 . ? A SF4 202 ? 1_555 119.1 ? 20 S2 ? C SF4 . ? A SF4 202 ? 1_555 FE1 ? C SF4 . ? A SF4 202 ? 1_555 S4 ? C SF4 . ? A SF4 202 ? 1_555 104.1 ? 21 S3 ? C SF4 . ? A SF4 202 ? 1_555 FE1 ? C SF4 . ? A SF4 202 ? 1_555 S4 ? C SF4 . ? A SF4 202 ? 1_555 104.1 ? 22 SG ? A CYS 171 ? A CYS 171 ? 1_555 FE4 ? C SF4 . ? A SF4 202 ? 1_555 S1 ? C SF4 . ? A SF4 202 ? 1_555 117.5 ? 23 SG ? A CYS 171 ? A CYS 171 ? 1_555 FE4 ? C SF4 . ? A SF4 202 ? 1_555 S2 ? C SF4 . ? A SF4 202 ? 1_555 105.8 ? 24 S1 ? C SF4 . ? A SF4 202 ? 1_555 FE4 ? C SF4 . ? A SF4 202 ? 1_555 S2 ? C SF4 . ? A SF4 202 ? 1_555 104.0 ? 25 SG ? A CYS 171 ? A CYS 171 ? 1_555 FE4 ? C SF4 . ? A SF4 202 ? 1_555 S3 ? C SF4 . ? A SF4 202 ? 1_555 120.0 ? 26 S1 ? C SF4 . ? A SF4 202 ? 1_555 FE4 ? C SF4 . ? A SF4 202 ? 1_555 S3 ? C SF4 . ? A SF4 202 ? 1_555 103.5 ? 27 S2 ? C SF4 . ? A SF4 202 ? 1_555 FE4 ? C SF4 . ? A SF4 202 ? 1_555 S3 ? C SF4 . ? A SF4 202 ? 1_555 104.1 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLN _struct_mon_prot_cis.label_seq_id 34 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLN _struct_mon_prot_cis.auth_seq_id 34 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 35 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 35 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.66 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 57 ? TYR A 59 ? VAL A 57 TYR A 59 AA1 2 ALA A 24 ? PHE A 28 ? ALA A 24 PHE A 28 AA1 3 VAL A 4 ? VAL A 8 ? VAL A 4 VAL A 8 AA1 4 SER A 109 ? THR A 112 ? SER A 109 THR A 112 AA1 5 LYS A 139 ? PHE A 140 ? LYS A 139 PHE A 140 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ARG A 58 ? O ARG A 58 N PHE A 26 ? N PHE A 26 AA1 2 3 O GLU A 25 ? O GLU A 25 N ILE A 6 ? N ILE A 6 AA1 3 4 N HIS A 7 ? N HIS A 7 O SER A 111 ? O SER A 111 AA1 4 5 N PHE A 110 ? N PHE A 110 O LYS A 139 ? O LYS A 139 # _pdbx_entry_details.entry_id 9DEU _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ALA 116 ? ? N A SER 117 ? ? 1.80 2 1 O A GLN 166 ? ? N10 A 56B 201 ? ? 2.17 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A ILE 33 ? ? N A GLN 34 ? ? 1.193 1.336 -0.143 0.023 Y 2 1 C A LEU 95 ? ? N A GLU 96 ? ? 1.188 1.336 -0.148 0.023 Y 3 1 C A ALA 116 ? ? N A SER 117 ? ? 0.866 1.336 -0.470 0.023 Y 4 1 C A GLY 154 ? ? N A VAL 155 ? ? 1.197 1.336 -0.139 0.023 Y 5 1 C A GLN 166 ? ? N A ASN 167 ? ? 1.124 1.336 -0.212 0.023 Y 6 1 C A ASN 167 ? ? N A TYR 168 ? ? 1.154 1.336 -0.182 0.023 Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 O A ILE 33 ? ? C A ILE 33 ? ? N A GLN 34 ? ? 109.54 122.70 -13.16 1.60 Y 2 1 CA A GLN 166 ? ? C A GLN 166 ? ? N A ASN 167 ? ? 103.00 117.20 -14.20 2.20 Y 3 1 O A GLN 166 ? ? C A GLN 166 ? ? N A ASN 167 ? ? 134.56 122.70 11.86 1.60 Y 4 1 O A ASN 167 ? ? C A ASN 167 ? ? N A TYR 168 ? ? 112.53 122.70 -10.17 1.60 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 30 ? ? -154.15 66.45 2 1 ASN A 144 ? ? -69.68 62.72 3 1 ALA A 150 ? ? -39.52 -35.54 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 146 ? ? 0.276 'SIDE CHAIN' 2 1 ARG A 165 ? ? 0.291 'SIDE CHAIN' # loop_ _pdbx_validate_polymer_linkage.id _pdbx_validate_polymer_linkage.PDB_model_num _pdbx_validate_polymer_linkage.auth_atom_id_1 _pdbx_validate_polymer_linkage.auth_asym_id_1 _pdbx_validate_polymer_linkage.auth_comp_id_1 _pdbx_validate_polymer_linkage.auth_seq_id_1 _pdbx_validate_polymer_linkage.PDB_ins_code_1 _pdbx_validate_polymer_linkage.label_alt_id_1 _pdbx_validate_polymer_linkage.auth_atom_id_2 _pdbx_validate_polymer_linkage.auth_asym_id_2 _pdbx_validate_polymer_linkage.auth_comp_id_2 _pdbx_validate_polymer_linkage.auth_seq_id_2 _pdbx_validate_polymer_linkage.PDB_ins_code_2 _pdbx_validate_polymer_linkage.label_alt_id_2 _pdbx_validate_polymer_linkage.dist 1 1 C A ILE 33 ? ? N A GLN 34 ? ? 1.19 2 1 C A LEU 95 ? ? N A GLU 96 ? ? 1.19 3 1 C A ALA 116 ? ? N A SER 117 ? ? 0.87 4 1 C A GLY 154 ? ? N A VAL 155 ? ? 1.20 5 1 C A GLN 166 ? ? N A ASN 167 ? ? 1.12 6 1 C A ASN 167 ? ? N A TYR 168 ? ? 1.15 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 356 ? F HOH . 2 1 A HOH 357 ? F HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A LYS 75 ? A LYS 75 4 1 Y 1 A ASP 76 ? A ASP 76 5 1 Y 1 A TYR 77 ? A TYR 77 6 1 Y 1 A LYS 78 ? A LYS 78 7 1 Y 1 A ASP 79 ? A ASP 79 8 1 Y 1 A LEU 80 ? A LEU 80 9 1 Y 1 A GLY 81 ? A GLY 81 10 1 Y 1 A GLU 82 ? A GLU 82 11 1 Y 1 A GLY 83 ? A GLY 83 12 1 Y 1 A SER 84 ? A SER 84 13 1 Y 1 A PHE 173 ? A PHE 173 14 1 Y 1 A SER 174 ? A SER 174 15 1 Y 1 A LEU 175 ? A LEU 175 16 1 Y 1 A LEU 176 ? A LEU 176 17 1 Y 1 A GLU 177 ? A GLU 177 18 1 Y 1 A ARG 178 ? A ARG 178 19 1 Y 1 A ARG 179 ? A ARG 179 20 1 Y 1 A GLU 180 ? A GLU 180 21 1 Y 1 A LYS 181 ? A LYS 181 22 1 Y 1 A HIS 182 ? A HIS 182 23 1 Y 1 A ALA 183 ? A ALA 183 24 1 Y 1 A GLU 184 ? A GLU 184 25 1 Y 1 A ILE 185 ? A ILE 185 26 1 Y 1 A SER 186 ? A SER 186 27 1 Y 1 A ARG 187 ? A ARG 187 28 1 Y 1 A LYS 188 ? A LYS 188 29 1 Y 1 A ARG 189 ? A ARG 189 30 1 Y 1 A GLY 190 ? A GLY 190 31 1 Y 1 A HIS 191 ? A HIS 191 32 1 Y 1 A MET 192 ? A MET 192 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 56B N9 N Y N 1 56B "C2'" C N R 2 56B "O2'" O N N 3 56B P P N N 4 56B "C1'" C N R 5 56B N10 N N N 6 56B O11 O N N 7 56B C8 C Y N 8 56B N3 N N N 9 56B O12 O N N 10 56B C7 C Y N 11 56B N2 N N N 12 56B O6 O N N 13 56B C9 C N N 14 56B N1 N N N 15 56B "O4'" O N N 16 56B C10 C N S 17 56B "O5'" O N N 18 56B C11 C N R 19 56B OP2 O N N 20 56B C12 C N S 21 56B C13 C N N 22 56B OP1 O N N 23 56B C14 C N N 24 56B "O3'" O N N 25 56B C5 C Y N 26 56B C4 C Y N 27 56B C2 C N N 28 56B C6 C N N 29 56B "C4'" C N R 30 56B "C5'" C N N 31 56B "C3'" C N S 32 56B H1 H N N 33 56B H2 H N N 34 56B H3 H N N 35 56B H4 H N N 36 56B H6 H N N 37 56B H7 H N N 38 56B H8 H N N 39 56B H9 H N N 40 56B H10 H N N 41 56B H11 H N N 42 56B H12 H N N 43 56B H13 H N N 44 56B H14 H N N 45 56B H15 H N N 46 56B H16 H N N 47 56B H17 H N N 48 56B H18 H N N 49 56B H21 H N N 50 56B H23 H N N 51 56B H24 H N N 52 56B H25 H N N 53 56B H26 H N N 54 56B H27 H N N 55 56B OP3 O N N 56 56B HOP3 H N N 57 ALA N N N N 58 ALA CA C N S 59 ALA C C N N 60 ALA O O N N 61 ALA CB C N N 62 ALA OXT O N N 63 ALA H H N N 64 ALA H2 H N N 65 ALA HA H N N 66 ALA HB1 H N N 67 ALA HB2 H N N 68 ALA HB3 H N N 69 ALA HXT H N N 70 ARG N N N N 71 ARG CA C N S 72 ARG C C N N 73 ARG O O N N 74 ARG CB C N N 75 ARG CG C N N 76 ARG CD C N N 77 ARG NE N N N 78 ARG CZ C N N 79 ARG NH1 N N N 80 ARG NH2 N N N 81 ARG OXT O N N 82 ARG H H N N 83 ARG H2 H N N 84 ARG HA H N N 85 ARG HB2 H N N 86 ARG HB3 H N N 87 ARG HG2 H N N 88 ARG HG3 H N N 89 ARG HD2 H N N 90 ARG HD3 H N N 91 ARG HE H N N 92 ARG HH11 H N N 93 ARG HH12 H N N 94 ARG HH21 H N N 95 ARG HH22 H N N 96 ARG HXT H N N 97 ASN N N N N 98 ASN CA C N S 99 ASN C C N N 100 ASN O O N N 101 ASN CB C N N 102 ASN CG C N N 103 ASN OD1 O N N 104 ASN ND2 N N N 105 ASN OXT O N N 106 ASN H H N N 107 ASN H2 H N N 108 ASN HA H N N 109 ASN HB2 H N N 110 ASN HB3 H N N 111 ASN HD21 H N N 112 ASN HD22 H N N 113 ASN HXT H N N 114 ASP N N N N 115 ASP CA C N S 116 ASP C C N N 117 ASP O O N N 118 ASP CB C N N 119 ASP CG C N N 120 ASP OD1 O N N 121 ASP OD2 O N N 122 ASP OXT O N N 123 ASP H H N N 124 ASP H2 H N N 125 ASP HA H N N 126 ASP HB2 H N N 127 ASP HB3 H N N 128 ASP HD2 H N N 129 ASP HXT H N N 130 CL CL CL N N 131 CYS N N N N 132 CYS CA C N R 133 CYS C C N N 134 CYS O O N N 135 CYS CB C N N 136 CYS SG S N N 137 CYS OXT O N N 138 CYS H H N N 139 CYS H2 H N N 140 CYS HA H N N 141 CYS HB2 H N N 142 CYS HB3 H N N 143 CYS HG H N N 144 CYS HXT H N N 145 GLN N N N N 146 GLN CA C N S 147 GLN C C N N 148 GLN O O N N 149 GLN CB C N N 150 GLN CG C N N 151 GLN CD C N N 152 GLN OE1 O N N 153 GLN NE2 N N N 154 GLN OXT O N N 155 GLN H H N N 156 GLN H2 H N N 157 GLN HA H N N 158 GLN HB2 H N N 159 GLN HB3 H N N 160 GLN HG2 H N N 161 GLN HG3 H N N 162 GLN HE21 H N N 163 GLN HE22 H N N 164 GLN HXT H N N 165 GLU N N N N 166 GLU CA C N S 167 GLU C C N N 168 GLU O O N N 169 GLU CB C N N 170 GLU CG C N N 171 GLU CD C N N 172 GLU OE1 O N N 173 GLU OE2 O N N 174 GLU OXT O N N 175 GLU H H N N 176 GLU H2 H N N 177 GLU HA H N N 178 GLU HB2 H N N 179 GLU HB3 H N N 180 GLU HG2 H N N 181 GLU HG3 H N N 182 GLU HE2 H N N 183 GLU HXT H N N 184 GLY N N N N 185 GLY CA C N N 186 GLY C C N N 187 GLY O O N N 188 GLY OXT O N N 189 GLY H H N N 190 GLY H2 H N N 191 GLY HA2 H N N 192 GLY HA3 H N N 193 GLY HXT H N N 194 HIS N N N N 195 HIS CA C N S 196 HIS C C N N 197 HIS O O N N 198 HIS CB C N N 199 HIS CG C Y N 200 HIS ND1 N Y N 201 HIS CD2 C Y N 202 HIS CE1 C Y N 203 HIS NE2 N Y N 204 HIS OXT O N N 205 HIS H H N N 206 HIS H2 H N N 207 HIS HA H N N 208 HIS HB2 H N N 209 HIS HB3 H N N 210 HIS HD1 H N N 211 HIS HD2 H N N 212 HIS HE1 H N N 213 HIS HE2 H N N 214 HIS HXT H N N 215 HOH O O N N 216 HOH H1 H N N 217 HOH H2 H N N 218 ILE N N N N 219 ILE CA C N S 220 ILE C C N N 221 ILE O O N N 222 ILE CB C N S 223 ILE CG1 C N N 224 ILE CG2 C N N 225 ILE CD1 C N N 226 ILE OXT O N N 227 ILE H H N N 228 ILE H2 H N N 229 ILE HA H N N 230 ILE HB H N N 231 ILE HG12 H N N 232 ILE HG13 H N N 233 ILE HG21 H N N 234 ILE HG22 H N N 235 ILE HG23 H N N 236 ILE HD11 H N N 237 ILE HD12 H N N 238 ILE HD13 H N N 239 ILE HXT H N N 240 LEU N N N N 241 LEU CA C N S 242 LEU C C N N 243 LEU O O N N 244 LEU CB C N N 245 LEU CG C N N 246 LEU CD1 C N N 247 LEU CD2 C N N 248 LEU OXT O N N 249 LEU H H N N 250 LEU H2 H N N 251 LEU HA H N N 252 LEU HB2 H N N 253 LEU HB3 H N N 254 LEU HG H N N 255 LEU HD11 H N N 256 LEU HD12 H N N 257 LEU HD13 H N N 258 LEU HD21 H N N 259 LEU HD22 H N N 260 LEU HD23 H N N 261 LEU HXT H N N 262 LYS N N N N 263 LYS CA C N S 264 LYS C C N N 265 LYS O O N N 266 LYS CB C N N 267 LYS CG C N N 268 LYS CD C N N 269 LYS CE C N N 270 LYS NZ N N N 271 LYS OXT O N N 272 LYS H H N N 273 LYS H2 H N N 274 LYS HA H N N 275 LYS HB2 H N N 276 LYS HB3 H N N 277 LYS HG2 H N N 278 LYS HG3 H N N 279 LYS HD2 H N N 280 LYS HD3 H N N 281 LYS HE2 H N N 282 LYS HE3 H N N 283 LYS HZ1 H N N 284 LYS HZ2 H N N 285 LYS HZ3 H N N 286 LYS HXT H N N 287 MET N N N N 288 MET CA C N S 289 MET C C N N 290 MET O O N N 291 MET CB C N N 292 MET CG C N N 293 MET SD S N N 294 MET CE C N N 295 MET OXT O N N 296 MET H H N N 297 MET H2 H N N 298 MET HA H N N 299 MET HB2 H N N 300 MET HB3 H N N 301 MET HG2 H N N 302 MET HG3 H N N 303 MET HE1 H N N 304 MET HE2 H N N 305 MET HE3 H N N 306 MET HXT H N N 307 PHE N N N N 308 PHE CA C N S 309 PHE C C N N 310 PHE O O N N 311 PHE CB C N N 312 PHE CG C Y N 313 PHE CD1 C Y N 314 PHE CD2 C Y N 315 PHE CE1 C Y N 316 PHE CE2 C Y N 317 PHE CZ C Y N 318 PHE OXT O N N 319 PHE H H N N 320 PHE H2 H N N 321 PHE HA H N N 322 PHE HB2 H N N 323 PHE HB3 H N N 324 PHE HD1 H N N 325 PHE HD2 H N N 326 PHE HE1 H N N 327 PHE HE2 H N N 328 PHE HZ H N N 329 PHE HXT H N N 330 PRO N N N N 331 PRO CA C N S 332 PRO C C N N 333 PRO O O N N 334 PRO CB C N N 335 PRO CG C N N 336 PRO CD C N N 337 PRO OXT O N N 338 PRO H H N N 339 PRO HA H N N 340 PRO HB2 H N N 341 PRO HB3 H N N 342 PRO HG2 H N N 343 PRO HG3 H N N 344 PRO HD2 H N N 345 PRO HD3 H N N 346 PRO HXT H N N 347 SER N N N N 348 SER CA C N S 349 SER C C N N 350 SER O O N N 351 SER CB C N N 352 SER OG O N N 353 SER OXT O N N 354 SER H H N N 355 SER H2 H N N 356 SER HA H N N 357 SER HB2 H N N 358 SER HB3 H N N 359 SER HG H N N 360 SER HXT H N N 361 SF4 FE1 FE N N 362 SF4 FE2 FE N N 363 SF4 FE3 FE N N 364 SF4 FE4 FE N N 365 SF4 S1 S N N 366 SF4 S2 S N N 367 SF4 S3 S N N 368 SF4 S4 S N N 369 THR N N N N 370 THR CA C N S 371 THR C C N N 372 THR O O N N 373 THR CB C N R 374 THR OG1 O N N 375 THR CG2 C N N 376 THR OXT O N N 377 THR H H N N 378 THR H2 H N N 379 THR HA H N N 380 THR HB H N N 381 THR HG1 H N N 382 THR HG21 H N N 383 THR HG22 H N N 384 THR HG23 H N N 385 THR HXT H N N 386 TRP N N N N 387 TRP CA C N S 388 TRP C C N N 389 TRP O O N N 390 TRP CB C N N 391 TRP CG C Y N 392 TRP CD1 C Y N 393 TRP CD2 C Y N 394 TRP NE1 N Y N 395 TRP CE2 C Y N 396 TRP CE3 C Y N 397 TRP CZ2 C Y N 398 TRP CZ3 C Y N 399 TRP CH2 C Y N 400 TRP OXT O N N 401 TRP H H N N 402 TRP H2 H N N 403 TRP HA H N N 404 TRP HB2 H N N 405 TRP HB3 H N N 406 TRP HD1 H N N 407 TRP HE1 H N N 408 TRP HE3 H N N 409 TRP HZ2 H N N 410 TRP HZ3 H N N 411 TRP HH2 H N N 412 TRP HXT H N N 413 TYR N N N N 414 TYR CA C N S 415 TYR C C N N 416 TYR O O N N 417 TYR CB C N N 418 TYR CG C Y N 419 TYR CD1 C Y N 420 TYR CD2 C Y N 421 TYR CE1 C Y N 422 TYR CE2 C Y N 423 TYR CZ C Y N 424 TYR OH O N N 425 TYR OXT O N N 426 TYR H H N N 427 TYR H2 H N N 428 TYR HA H N N 429 TYR HB2 H N N 430 TYR HB3 H N N 431 TYR HD1 H N N 432 TYR HD2 H N N 433 TYR HE1 H N N 434 TYR HE2 H N N 435 TYR HH H N N 436 TYR HXT H N N 437 VAL N N N N 438 VAL CA C N S 439 VAL C C N N 440 VAL O O N N 441 VAL CB C N N 442 VAL CG1 C N N 443 VAL CG2 C N N 444 VAL OXT O N N 445 VAL H H N N 446 VAL H2 H N N 447 VAL HA H N N 448 VAL HB H N N 449 VAL HG11 H N N 450 VAL HG12 H N N 451 VAL HG13 H N N 452 VAL HG21 H N N 453 VAL HG22 H N N 454 VAL HG23 H N N 455 VAL HXT H N N 456 ZN ZN ZN N N 457 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 56B N2 C2 sing N N 1 56B C2 N1 sing N N 2 56B C2 N3 doub N N 3 56B N1 C6 sing N N 4 56B N3 C4 sing N N 5 56B C6 O6 doub N N 6 56B C6 C5 sing N N 7 56B C4 C5 doub Y N 8 56B C4 N9 sing Y N 9 56B C5 C7 sing Y N 10 56B "O4'" "C1'" sing N N 11 56B "O4'" "C4'" sing N N 12 56B "O3'" "C3'" sing N N 13 56B "C1'" N9 sing N N 14 56B "C1'" "C2'" sing N N 15 56B N9 C8 sing Y N 16 56B "C4'" "C3'" sing N N 17 56B "C4'" "C5'" sing N N 18 56B C7 C8 doub Y N 19 56B C7 C9 sing N N 20 56B "O2'" "C2'" sing N N 21 56B "C3'" "C2'" sing N N 22 56B N10 C9 sing N N 23 56B N10 C10 sing N N 24 56B C12 C13 sing N N 25 56B C12 O12 sing N N 26 56B C12 C11 sing N N 27 56B C13 C14 doub N N 28 56B C14 C10 sing N N 29 56B "C5'" "O5'" sing N N 30 56B C10 C11 sing N N 31 56B C11 O11 sing N N 32 56B OP2 P sing N N 33 56B "O5'" P sing N N 34 56B P OP1 doub N N 35 56B "C2'" H1 sing N N 36 56B "O2'" H2 sing N N 37 56B "C1'" H3 sing N N 38 56B N10 H4 sing N N 39 56B O11 H6 sing N N 40 56B C8 H7 sing N N 41 56B O12 H8 sing N N 42 56B N2 H9 sing N N 43 56B N2 H10 sing N N 44 56B C9 H11 sing N N 45 56B C9 H12 sing N N 46 56B N1 H13 sing N N 47 56B C10 H14 sing N N 48 56B C11 H15 sing N N 49 56B OP2 H16 sing N N 50 56B C12 H17 sing N N 51 56B C13 H18 sing N N 52 56B C14 H21 sing N N 53 56B "O3'" H23 sing N N 54 56B "C4'" H24 sing N N 55 56B "C5'" H25 sing N N 56 56B "C5'" H26 sing N N 57 56B "C3'" H27 sing N N 58 56B P OP3 sing N N 59 56B OP3 HOP3 sing N N 60 ALA N CA sing N N 61 ALA N H sing N N 62 ALA N H2 sing N N 63 ALA CA C sing N N 64 ALA CA CB sing N N 65 ALA CA HA sing N N 66 ALA C O doub N N 67 ALA C OXT sing N N 68 ALA CB HB1 sing N N 69 ALA CB HB2 sing N N 70 ALA CB HB3 sing N N 71 ALA OXT HXT sing N N 72 ARG N CA sing N N 73 ARG N H sing N N 74 ARG N H2 sing N N 75 ARG CA C sing N N 76 ARG CA CB sing N N 77 ARG CA HA sing N N 78 ARG C O doub N N 79 ARG C OXT sing N N 80 ARG CB CG sing N N 81 ARG CB HB2 sing N N 82 ARG CB HB3 sing N N 83 ARG CG CD sing N N 84 ARG CG HG2 sing N N 85 ARG CG HG3 sing N N 86 ARG CD NE sing N N 87 ARG CD HD2 sing N N 88 ARG CD HD3 sing N N 89 ARG NE CZ sing N N 90 ARG NE HE sing N N 91 ARG CZ NH1 sing N N 92 ARG CZ NH2 doub N N 93 ARG NH1 HH11 sing N N 94 ARG NH1 HH12 sing N N 95 ARG NH2 HH21 sing N N 96 ARG NH2 HH22 sing N N 97 ARG OXT HXT sing N N 98 ASN N CA sing N N 99 ASN N H sing N N 100 ASN N H2 sing N N 101 ASN CA C sing N N 102 ASN CA CB sing N N 103 ASN CA HA sing N N 104 ASN C O doub N N 105 ASN C OXT sing N N 106 ASN CB CG sing N N 107 ASN CB HB2 sing N N 108 ASN CB HB3 sing N N 109 ASN CG OD1 doub N N 110 ASN CG ND2 sing N N 111 ASN ND2 HD21 sing N N 112 ASN ND2 HD22 sing N N 113 ASN OXT HXT sing N N 114 ASP N CA sing N N 115 ASP N H sing N N 116 ASP N H2 sing N N 117 ASP CA C sing N N 118 ASP CA CB sing N N 119 ASP CA HA sing N N 120 ASP C O doub N N 121 ASP C OXT sing N N 122 ASP CB CG sing N N 123 ASP CB HB2 sing N N 124 ASP CB HB3 sing N N 125 ASP CG OD1 doub N N 126 ASP CG OD2 sing N N 127 ASP OD2 HD2 sing N N 128 ASP OXT HXT sing N N 129 CYS N CA sing N N 130 CYS N H sing N N 131 CYS N H2 sing N N 132 CYS CA C sing N N 133 CYS CA CB sing N N 134 CYS CA HA sing N N 135 CYS C O doub N N 136 CYS C OXT sing N N 137 CYS CB SG sing N N 138 CYS CB HB2 sing N N 139 CYS CB HB3 sing N N 140 CYS SG HG sing N N 141 CYS OXT HXT sing N N 142 GLN N CA sing N N 143 GLN N H sing N N 144 GLN N H2 sing N N 145 GLN CA C sing N N 146 GLN CA CB sing N N 147 GLN CA HA sing N N 148 GLN C O doub N N 149 GLN C OXT sing N N 150 GLN CB CG sing N N 151 GLN CB HB2 sing N N 152 GLN CB HB3 sing N N 153 GLN CG CD sing N N 154 GLN CG HG2 sing N N 155 GLN CG HG3 sing N N 156 GLN CD OE1 doub N N 157 GLN CD NE2 sing N N 158 GLN NE2 HE21 sing N N 159 GLN NE2 HE22 sing N N 160 GLN OXT HXT sing N N 161 GLU N CA sing N N 162 GLU N H sing N N 163 GLU N H2 sing N N 164 GLU CA C sing N N 165 GLU CA CB sing N N 166 GLU CA HA sing N N 167 GLU C O doub N N 168 GLU C OXT sing N N 169 GLU CB CG sing N N 170 GLU CB HB2 sing N N 171 GLU CB HB3 sing N N 172 GLU CG CD sing N N 173 GLU CG HG2 sing N N 174 GLU CG HG3 sing N N 175 GLU CD OE1 doub N N 176 GLU CD OE2 sing N N 177 GLU OE2 HE2 sing N N 178 GLU OXT HXT sing N N 179 GLY N CA sing N N 180 GLY N H sing N N 181 GLY N H2 sing N N 182 GLY CA C sing N N 183 GLY CA HA2 sing N N 184 GLY CA HA3 sing N N 185 GLY C O doub N N 186 GLY C OXT sing N N 187 GLY OXT HXT sing N N 188 HIS N CA sing N N 189 HIS N H sing N N 190 HIS N H2 sing N N 191 HIS CA C sing N N 192 HIS CA CB sing N N 193 HIS CA HA sing N N 194 HIS C O doub N N 195 HIS C OXT sing N N 196 HIS CB CG sing N N 197 HIS CB HB2 sing N N 198 HIS CB HB3 sing N N 199 HIS CG ND1 sing Y N 200 HIS CG CD2 doub Y N 201 HIS ND1 CE1 doub Y N 202 HIS ND1 HD1 sing N N 203 HIS CD2 NE2 sing Y N 204 HIS CD2 HD2 sing N N 205 HIS CE1 NE2 sing Y N 206 HIS CE1 HE1 sing N N 207 HIS NE2 HE2 sing N N 208 HIS OXT HXT sing N N 209 HOH O H1 sing N N 210 HOH O H2 sing N N 211 ILE N CA sing N N 212 ILE N H sing N N 213 ILE N H2 sing N N 214 ILE CA C sing N N 215 ILE CA CB sing N N 216 ILE CA HA sing N N 217 ILE C O doub N N 218 ILE C OXT sing N N 219 ILE CB CG1 sing N N 220 ILE CB CG2 sing N N 221 ILE CB HB sing N N 222 ILE CG1 CD1 sing N N 223 ILE CG1 HG12 sing N N 224 ILE CG1 HG13 sing N N 225 ILE CG2 HG21 sing N N 226 ILE CG2 HG22 sing N N 227 ILE CG2 HG23 sing N N 228 ILE CD1 HD11 sing N N 229 ILE CD1 HD12 sing N N 230 ILE CD1 HD13 sing N N 231 ILE OXT HXT sing N N 232 LEU N CA sing N N 233 LEU N H sing N N 234 LEU N H2 sing N N 235 LEU CA C sing N N 236 LEU CA CB sing N N 237 LEU CA HA sing N N 238 LEU C O doub N N 239 LEU C OXT sing N N 240 LEU CB CG sing N N 241 LEU CB HB2 sing N N 242 LEU CB HB3 sing N N 243 LEU CG CD1 sing N N 244 LEU CG CD2 sing N N 245 LEU CG HG sing N N 246 LEU CD1 HD11 sing N N 247 LEU CD1 HD12 sing N N 248 LEU CD1 HD13 sing N N 249 LEU CD2 HD21 sing N N 250 LEU CD2 HD22 sing N N 251 LEU CD2 HD23 sing N N 252 LEU OXT HXT sing N N 253 LYS N CA sing N N 254 LYS N H sing N N 255 LYS N H2 sing N N 256 LYS CA C sing N N 257 LYS CA CB sing N N 258 LYS CA HA sing N N 259 LYS C O doub N N 260 LYS C OXT sing N N 261 LYS CB CG sing N N 262 LYS CB HB2 sing N N 263 LYS CB HB3 sing N N 264 LYS CG CD sing N N 265 LYS CG HG2 sing N N 266 LYS CG HG3 sing N N 267 LYS CD CE sing N N 268 LYS CD HD2 sing N N 269 LYS CD HD3 sing N N 270 LYS CE NZ sing N N 271 LYS CE HE2 sing N N 272 LYS CE HE3 sing N N 273 LYS NZ HZ1 sing N N 274 LYS NZ HZ2 sing N N 275 LYS NZ HZ3 sing N N 276 LYS OXT HXT sing N N 277 MET N CA sing N N 278 MET N H sing N N 279 MET N H2 sing N N 280 MET CA C sing N N 281 MET CA CB sing N N 282 MET CA HA sing N N 283 MET C O doub N N 284 MET C OXT sing N N 285 MET CB CG sing N N 286 MET CB HB2 sing N N 287 MET CB HB3 sing N N 288 MET CG SD sing N N 289 MET CG HG2 sing N N 290 MET CG HG3 sing N N 291 MET SD CE sing N N 292 MET CE HE1 sing N N 293 MET CE HE2 sing N N 294 MET CE HE3 sing N N 295 MET OXT HXT sing N N 296 PHE N CA sing N N 297 PHE N H sing N N 298 PHE N H2 sing N N 299 PHE CA C sing N N 300 PHE CA CB sing N N 301 PHE CA HA sing N N 302 PHE C O doub N N 303 PHE C OXT sing N N 304 PHE CB CG sing N N 305 PHE CB HB2 sing N N 306 PHE CB HB3 sing N N 307 PHE CG CD1 doub Y N 308 PHE CG CD2 sing Y N 309 PHE CD1 CE1 sing Y N 310 PHE CD1 HD1 sing N N 311 PHE CD2 CE2 doub Y N 312 PHE CD2 HD2 sing N N 313 PHE CE1 CZ doub Y N 314 PHE CE1 HE1 sing N N 315 PHE CE2 CZ sing Y N 316 PHE CE2 HE2 sing N N 317 PHE CZ HZ sing N N 318 PHE OXT HXT sing N N 319 PRO N CA sing N N 320 PRO N CD sing N N 321 PRO N H sing N N 322 PRO CA C sing N N 323 PRO CA CB sing N N 324 PRO CA HA sing N N 325 PRO C O doub N N 326 PRO C OXT sing N N 327 PRO CB CG sing N N 328 PRO CB HB2 sing N N 329 PRO CB HB3 sing N N 330 PRO CG CD sing N N 331 PRO CG HG2 sing N N 332 PRO CG HG3 sing N N 333 PRO CD HD2 sing N N 334 PRO CD HD3 sing N N 335 PRO OXT HXT sing N N 336 SER N CA sing N N 337 SER N H sing N N 338 SER N H2 sing N N 339 SER CA C sing N N 340 SER CA CB sing N N 341 SER CA HA sing N N 342 SER C O doub N N 343 SER C OXT sing N N 344 SER CB OG sing N N 345 SER CB HB2 sing N N 346 SER CB HB3 sing N N 347 SER OG HG sing N N 348 SER OXT HXT sing N N 349 SF4 FE1 S2 sing N N 350 SF4 FE1 S3 sing N N 351 SF4 FE1 S4 sing N N 352 SF4 FE2 S1 sing N N 353 SF4 FE2 S3 sing N N 354 SF4 FE2 S4 sing N N 355 SF4 FE3 S1 sing N N 356 SF4 FE3 S2 sing N N 357 SF4 FE3 S4 sing N N 358 SF4 FE4 S1 sing N N 359 SF4 FE4 S2 sing N N 360 SF4 FE4 S3 sing N N 361 THR N CA sing N N 362 THR N H sing N N 363 THR N H2 sing N N 364 THR CA C sing N N 365 THR CA CB sing N N 366 THR CA HA sing N N 367 THR C O doub N N 368 THR C OXT sing N N 369 THR CB OG1 sing N N 370 THR CB CG2 sing N N 371 THR CB HB sing N N 372 THR OG1 HG1 sing N N 373 THR CG2 HG21 sing N N 374 THR CG2 HG22 sing N N 375 THR CG2 HG23 sing N N 376 THR OXT HXT sing N N 377 TRP N CA sing N N 378 TRP N H sing N N 379 TRP N H2 sing N N 380 TRP CA C sing N N 381 TRP CA CB sing N N 382 TRP CA HA sing N N 383 TRP C O doub N N 384 TRP C OXT sing N N 385 TRP CB CG sing N N 386 TRP CB HB2 sing N N 387 TRP CB HB3 sing N N 388 TRP CG CD1 doub Y N 389 TRP CG CD2 sing Y N 390 TRP CD1 NE1 sing Y N 391 TRP CD1 HD1 sing N N 392 TRP CD2 CE2 doub Y N 393 TRP CD2 CE3 sing Y N 394 TRP NE1 CE2 sing Y N 395 TRP NE1 HE1 sing N N 396 TRP CE2 CZ2 sing Y N 397 TRP CE3 CZ3 doub Y N 398 TRP CE3 HE3 sing N N 399 TRP CZ2 CH2 doub Y N 400 TRP CZ2 HZ2 sing N N 401 TRP CZ3 CH2 sing Y N 402 TRP CZ3 HZ3 sing N N 403 TRP CH2 HH2 sing N N 404 TRP OXT HXT sing N N 405 TYR N CA sing N N 406 TYR N H sing N N 407 TYR N H2 sing N N 408 TYR CA C sing N N 409 TYR CA CB sing N N 410 TYR CA HA sing N N 411 TYR C O doub N N 412 TYR C OXT sing N N 413 TYR CB CG sing N N 414 TYR CB HB2 sing N N 415 TYR CB HB3 sing N N 416 TYR CG CD1 doub Y N 417 TYR CG CD2 sing Y N 418 TYR CD1 CE1 sing Y N 419 TYR CD1 HD1 sing N N 420 TYR CD2 CE2 doub Y N 421 TYR CD2 HD2 sing N N 422 TYR CE1 CZ doub Y N 423 TYR CE1 HE1 sing N N 424 TYR CE2 CZ sing Y N 425 TYR CE2 HE2 sing N N 426 TYR CZ OH sing N N 427 TYR OH HH sing N N 428 TYR OXT HXT sing N N 429 VAL N CA sing N N 430 VAL N H sing N N 431 VAL N H2 sing N N 432 VAL CA C sing N N 433 VAL CA CB sing N N 434 VAL CA HA sing N N 435 VAL C O doub N N 436 VAL C OXT sing N N 437 VAL CB CG1 sing N N 438 VAL CB CG2 sing N N 439 VAL CB HB sing N N 440 VAL CG1 HG11 sing N N 441 VAL CG1 HG12 sing N N 442 VAL CG1 HG13 sing N N 443 VAL CG2 HG21 sing N N 444 VAL CG2 HG22 sing N N 445 VAL CG2 HG23 sing N N 446 VAL OXT HXT sing N N 447 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM70641 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7LC5 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9DEU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.018640 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009506 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013552 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? FE ? ? 20.90327 4.99816 ? ? 2.55100 38.46870 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_