data_9DNK # _entry.id 9DNK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.412 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9DNK pdb_00009dnk 10.2210/pdb9dnk/pdb WWPDB D_1000288509 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-08 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9DNK _pdbx_database_status.recvd_initial_deposition_date 2024-09-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'RamR variant S2.3' 9DN8 unspecified PDB 'RamR variant S2.4' 9DN9 unspecified PDB 'RamR variant D2.1' 9DNC unspecified PDB 'RamR variant D2.3' 9DNH unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email jzhang@cm.utexas.edu _pdbx_contact_author.name_first Yan _pdbx_contact_author.name_last Zhang _pdbx_contact_author.name_mi J. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9360-5388 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, W.' 1 ? 'Zhang, Y.J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Using stereoselective biosensors to evolve asymmetric biocatalysts' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary ;d'Oelsnitz, S. ; 1 ? primary 'Kim, W.' 2 ? primary 'Taghon, G.' 3 ? primary 'Hardtke, H.' 4 ? primary 'Ikonomova, S.P.' 5 ? primary 'Alperovich, N.' 6 ? primary 'Vasilyeva, O.' 7 ? primary 'James, M.J.' 8 ? primary 'Zigon, E.S.' 9 ? primary 'Johnson, C.' 10 ? primary 'Ellington, A.D.' 11 ? primary 'Zhang, Y.J.' 12 ? primary 'Springer, M.' 13 ? primary 'Silver, P.A.' 14 ? primary 'Ross, D.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Engineered RamR Variant R2.1' 21879.902 1 ? ? ? ? 2 non-polymer syn '(1R)-1-phenyl-1,2,3,4-tetrahydroisoquinoline' 209.286 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVARPKSEDKKQALLEAATAAFAQSGIAASTAVIARNAGFAEGTLFRYFATKDELINELYLHLKQDLCQSMIMELDRSIT EPKEHTRNIWNSYVDWGIRNPLAHAAIRQTGVSEKLNAETEQAVKDMFPELRDLCHRSVLPVFMSDEYRAFGDGLFLALA ETTMDFAARDPSRAVDFKALGFEAMWRALMREEA ; _entity_poly.pdbx_seq_one_letter_code_can ;MVARPKSEDKKQALLEAATAAFAQSGIAASTAVIARNAGFAEGTLFRYFATKDELINELYLHLKQDLCQSMIMELDRSIT EPKEHTRNIWNSYVDWGIRNPLAHAAIRQTGVSEKLNAETEQAVKDMFPELRDLCHRSVLPVFMSDEYRAFGDGLFLALA ETTMDFAARDPSRAVDFKALGFEAMWRALMREEA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '(1R)-1-phenyl-1,2,3,4-tetrahydroisoquinoline' _pdbx_entity_nonpoly.comp_id A1BEC # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 ALA n 1 4 ARG n 1 5 PRO n 1 6 LYS n 1 7 SER n 1 8 GLU n 1 9 ASP n 1 10 LYS n 1 11 LYS n 1 12 GLN n 1 13 ALA n 1 14 LEU n 1 15 LEU n 1 16 GLU n 1 17 ALA n 1 18 ALA n 1 19 THR n 1 20 ALA n 1 21 ALA n 1 22 PHE n 1 23 ALA n 1 24 GLN n 1 25 SER n 1 26 GLY n 1 27 ILE n 1 28 ALA n 1 29 ALA n 1 30 SER n 1 31 THR n 1 32 ALA n 1 33 VAL n 1 34 ILE n 1 35 ALA n 1 36 ARG n 1 37 ASN n 1 38 ALA n 1 39 GLY n 1 40 PHE n 1 41 ALA n 1 42 GLU n 1 43 GLY n 1 44 THR n 1 45 LEU n 1 46 PHE n 1 47 ARG n 1 48 TYR n 1 49 PHE n 1 50 ALA n 1 51 THR n 1 52 LYS n 1 53 ASP n 1 54 GLU n 1 55 LEU n 1 56 ILE n 1 57 ASN n 1 58 GLU n 1 59 LEU n 1 60 TYR n 1 61 LEU n 1 62 HIS n 1 63 LEU n 1 64 LYS n 1 65 GLN n 1 66 ASP n 1 67 LEU n 1 68 CYS n 1 69 GLN n 1 70 SER n 1 71 MET n 1 72 ILE n 1 73 MET n 1 74 GLU n 1 75 LEU n 1 76 ASP n 1 77 ARG n 1 78 SER n 1 79 ILE n 1 80 THR n 1 81 GLU n 1 82 PRO n 1 83 LYS n 1 84 GLU n 1 85 HIS n 1 86 THR n 1 87 ARG n 1 88 ASN n 1 89 ILE n 1 90 TRP n 1 91 ASN n 1 92 SER n 1 93 TYR n 1 94 VAL n 1 95 ASP n 1 96 TRP n 1 97 GLY n 1 98 ILE n 1 99 ARG n 1 100 ASN n 1 101 PRO n 1 102 LEU n 1 103 ALA n 1 104 HIS n 1 105 ALA n 1 106 ALA n 1 107 ILE n 1 108 ARG n 1 109 GLN n 1 110 THR n 1 111 GLY n 1 112 VAL n 1 113 SER n 1 114 GLU n 1 115 LYS n 1 116 LEU n 1 117 ASN n 1 118 ALA n 1 119 GLU n 1 120 THR n 1 121 GLU n 1 122 GLN n 1 123 ALA n 1 124 VAL n 1 125 LYS n 1 126 ASP n 1 127 MET n 1 128 PHE n 1 129 PRO n 1 130 GLU n 1 131 LEU n 1 132 ARG n 1 133 ASP n 1 134 LEU n 1 135 CYS n 1 136 HIS n 1 137 ARG n 1 138 SER n 1 139 VAL n 1 140 LEU n 1 141 PRO n 1 142 VAL n 1 143 PHE n 1 144 MET n 1 145 SER n 1 146 ASP n 1 147 GLU n 1 148 TYR n 1 149 ARG n 1 150 ALA n 1 151 PHE n 1 152 GLY n 1 153 ASP n 1 154 GLY n 1 155 LEU n 1 156 PHE n 1 157 LEU n 1 158 ALA n 1 159 LEU n 1 160 ALA n 1 161 GLU n 1 162 THR n 1 163 THR n 1 164 MET n 1 165 ASP n 1 166 PHE n 1 167 ALA n 1 168 ALA n 1 169 ARG n 1 170 ASP n 1 171 PRO n 1 172 SER n 1 173 ARG n 1 174 ALA n 1 175 VAL n 1 176 ASP n 1 177 PHE n 1 178 LYS n 1 179 ALA n 1 180 LEU n 1 181 GLY n 1 182 PHE n 1 183 GLU n 1 184 ALA n 1 185 MET n 1 186 TRP n 1 187 ARG n 1 188 ALA n 1 189 LEU n 1 190 MET n 1 191 ARG n 1 192 GLU n 1 193 GLU n 1 194 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 194 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella enterica subsp. enterica serovar Typhimurium' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 90371 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1BEC non-polymer . '(1R)-1-phenyl-1,2,3,4-tetrahydroisoquinoline' ? 'C15 H15 N' 209.286 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 VAL 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 SER 7 7 ? ? ? A . n A 1 8 GLU 8 8 ? ? ? A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 MET 127 127 127 MET MET A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 CYS 135 135 135 CYS CYS A . n A 1 136 HIS 136 136 136 HIS HIS A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 MET 144 144 144 MET MET A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 MET 164 164 164 MET MET A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 PRO 171 171 171 PRO PRO A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 MET 185 185 185 MET MET A . n A 1 186 TRP 186 186 186 TRP TRP A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 MET 190 190 190 MET MET A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 ALA 194 194 194 ALA ALA A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1BEC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1BEC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id A1BEC _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id A1BEC _pdbx_nonpoly_scheme.auth_mon_id Z1R _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18rc3_3805 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 93.76 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9DNK _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.690 _cell.length_a_esd ? _cell.length_b 93.394 _cell.length_b_esd ? _cell.length_c 44.610 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9DNK _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9DNK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.79 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M NaCl, 0.2M Ammonium Sulfate, 0.1M MES pH 6.5, 25% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-10-10 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9999 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9999 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9DNK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8122 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.990 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.096 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.54 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 390 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.294 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.010 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9DNK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 49.62 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7968 _refine.ls_number_reflns_R_free 414 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.54 _refine.ls_percent_reflns_R_free 5.20 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2289 _refine.ls_R_factor_R_free 0.2674 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2267 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 39.18 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1473 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1489 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 49.62 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 ? 1520 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.079 ? 2053 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.056 ? 206 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.051 ? 223 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 268 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.50 2.86 . . 131 2402 92.00 . . . . 0.3194 . . . . . . . . . . . 0.3848 'X-RAY DIFFRACTION' 2.86 3.60 . . 129 2591 98.00 . . . . 0.2573 . . . . . . . . . . . 0.3060 'X-RAY DIFFRACTION' 3.61 49.62 . . 154 2561 96.00 . . . . 0.1982 . . . . . . . . . . . 0.2391 # _struct.entry_id 9DNK _struct.title 'RamR variant R2.1 complexed with 1R-1-phenyl-1,2,3,4-tetrahydroisoquinoline' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9DNK _struct_keywords.text 'Directed evolution, Transcription factor, Stereoselectivity, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9DNK _struct_ref.pdbx_db_accession 9DNK _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9DNK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 194 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9DNK _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 194 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 194 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3610 ? 1 MORE -21 ? 1 'SSA (A^2)' 18500 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 -2.9254027940 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 44.5139766646 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 10 ? GLY A 26 ? LYS A 10 GLY A 26 1 ? 17 HELX_P HELX_P2 AA2 ILE A 27 ? ALA A 29 ? ILE A 27 ALA A 29 5 ? 3 HELX_P HELX_P3 AA3 SER A 30 ? GLY A 39 ? SER A 30 GLY A 39 1 ? 10 HELX_P HELX_P4 AA4 ALA A 41 ? PHE A 49 ? ALA A 41 PHE A 49 1 ? 9 HELX_P HELX_P5 AA5 THR A 51 ? LEU A 75 ? THR A 51 LEU A 75 1 ? 25 HELX_P HELX_P6 AA6 GLU A 81 ? ASN A 100 ? GLU A 81 ASN A 100 1 ? 20 HELX_P HELX_P7 AA7 ASN A 100 ? THR A 110 ? ASN A 100 THR A 110 1 ? 11 HELX_P HELX_P8 AA8 VAL A 112 ? PHE A 128 ? VAL A 112 PHE A 128 1 ? 17 HELX_P HELX_P9 AA9 GLU A 130 ? VAL A 139 ? GLU A 130 VAL A 139 1 ? 10 HELX_P HELX_P10 AB1 LEU A 140 ? SER A 145 ? LEU A 140 SER A 145 1 ? 6 HELX_P HELX_P11 AB2 TYR A 148 ? ASP A 170 ? TYR A 148 ASP A 170 1 ? 23 HELX_P HELX_P12 AB3 ARG A 173 ? MET A 190 ? ARG A 173 MET A 190 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9DNK _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 50 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -103.26 _pdbx_validate_torsion.psi -75.43 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id CYS _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 135 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -13.30 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A VAL 2 ? A VAL 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A ARG 4 ? A ARG 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A SER 7 ? A SER 7 8 1 Y 1 A GLU 8 ? A GLU 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1BEC C01 C N N 1 A1BEC C02 C N N 2 A1BEC C04 C N R 3 A1BEC C05 C Y N 4 A1BEC C06 C Y N 5 A1BEC C07 C Y N 6 A1BEC C08 C Y N 7 A1BEC C09 C Y N 8 A1BEC C10 C Y N 9 A1BEC C11 C Y N 10 A1BEC C12 C Y N 11 A1BEC C13 C Y N 12 A1BEC C14 C Y N 13 A1BEC C15 C Y N 14 A1BEC C16 C Y N 15 A1BEC N03 N N N 16 A1BEC H1 H N N 17 A1BEC H2 H N N 18 A1BEC H3 H N N 19 A1BEC H4 H N N 20 A1BEC H5 H N N 21 A1BEC H6 H N N 22 A1BEC H7 H N N 23 A1BEC H8 H N N 24 A1BEC H9 H N N 25 A1BEC H10 H N N 26 A1BEC H11 H N N 27 A1BEC H12 H N N 28 A1BEC H13 H N N 29 A1BEC H14 H N N 30 A1BEC H15 H N N 31 ALA N N N N 32 ALA CA C N S 33 ALA C C N N 34 ALA O O N N 35 ALA CB C N N 36 ALA OXT O N N 37 ALA H H N N 38 ALA H2 H N N 39 ALA HA H N N 40 ALA HB1 H N N 41 ALA HB2 H N N 42 ALA HB3 H N N 43 ALA HXT H N N 44 ARG N N N N 45 ARG CA C N S 46 ARG C C N N 47 ARG O O N N 48 ARG CB C N N 49 ARG CG C N N 50 ARG CD C N N 51 ARG NE N N N 52 ARG CZ C N N 53 ARG NH1 N N N 54 ARG NH2 N N N 55 ARG OXT O N N 56 ARG H H N N 57 ARG H2 H N N 58 ARG HA H N N 59 ARG HB2 H N N 60 ARG HB3 H N N 61 ARG HG2 H N N 62 ARG HG3 H N N 63 ARG HD2 H N N 64 ARG HD3 H N N 65 ARG HE H N N 66 ARG HH11 H N N 67 ARG HH12 H N N 68 ARG HH21 H N N 69 ARG HH22 H N N 70 ARG HXT H N N 71 ASN N N N N 72 ASN CA C N S 73 ASN C C N N 74 ASN O O N N 75 ASN CB C N N 76 ASN CG C N N 77 ASN OD1 O N N 78 ASN ND2 N N N 79 ASN OXT O N N 80 ASN H H N N 81 ASN H2 H N N 82 ASN HA H N N 83 ASN HB2 H N N 84 ASN HB3 H N N 85 ASN HD21 H N N 86 ASN HD22 H N N 87 ASN HXT H N N 88 ASP N N N N 89 ASP CA C N S 90 ASP C C N N 91 ASP O O N N 92 ASP CB C N N 93 ASP CG C N N 94 ASP OD1 O N N 95 ASP OD2 O N N 96 ASP OXT O N N 97 ASP H H N N 98 ASP H2 H N N 99 ASP HA H N N 100 ASP HB2 H N N 101 ASP HB3 H N N 102 ASP HD2 H N N 103 ASP HXT H N N 104 CYS N N N N 105 CYS CA C N R 106 CYS C C N N 107 CYS O O N N 108 CYS CB C N N 109 CYS SG S N N 110 CYS OXT O N N 111 CYS H H N N 112 CYS H2 H N N 113 CYS HA H N N 114 CYS HB2 H N N 115 CYS HB3 H N N 116 CYS HG H N N 117 CYS HXT H N N 118 GLN N N N N 119 GLN CA C N S 120 GLN C C N N 121 GLN O O N N 122 GLN CB C N N 123 GLN CG C N N 124 GLN CD C N N 125 GLN OE1 O N N 126 GLN NE2 N N N 127 GLN OXT O N N 128 GLN H H N N 129 GLN H2 H N N 130 GLN HA H N N 131 GLN HB2 H N N 132 GLN HB3 H N N 133 GLN HG2 H N N 134 GLN HG3 H N N 135 GLN HE21 H N N 136 GLN HE22 H N N 137 GLN HXT H N N 138 GLU N N N N 139 GLU CA C N S 140 GLU C C N N 141 GLU O O N N 142 GLU CB C N N 143 GLU CG C N N 144 GLU CD C N N 145 GLU OE1 O N N 146 GLU OE2 O N N 147 GLU OXT O N N 148 GLU H H N N 149 GLU H2 H N N 150 GLU HA H N N 151 GLU HB2 H N N 152 GLU HB3 H N N 153 GLU HG2 H N N 154 GLU HG3 H N N 155 GLU HE2 H N N 156 GLU HXT H N N 157 GLY N N N N 158 GLY CA C N N 159 GLY C C N N 160 GLY O O N N 161 GLY OXT O N N 162 GLY H H N N 163 GLY H2 H N N 164 GLY HA2 H N N 165 GLY HA3 H N N 166 GLY HXT H N N 167 HIS N N N N 168 HIS CA C N S 169 HIS C C N N 170 HIS O O N N 171 HIS CB C N N 172 HIS CG C Y N 173 HIS ND1 N Y N 174 HIS CD2 C Y N 175 HIS CE1 C Y N 176 HIS NE2 N Y N 177 HIS OXT O N N 178 HIS H H N N 179 HIS H2 H N N 180 HIS HA H N N 181 HIS HB2 H N N 182 HIS HB3 H N N 183 HIS HD1 H N N 184 HIS HD2 H N N 185 HIS HE1 H N N 186 HIS HE2 H N N 187 HIS HXT H N N 188 ILE N N N N 189 ILE CA C N S 190 ILE C C N N 191 ILE O O N N 192 ILE CB C N S 193 ILE CG1 C N N 194 ILE CG2 C N N 195 ILE CD1 C N N 196 ILE OXT O N N 197 ILE H H N N 198 ILE H2 H N N 199 ILE HA H N N 200 ILE HB H N N 201 ILE HG12 H N N 202 ILE HG13 H N N 203 ILE HG21 H N N 204 ILE HG22 H N N 205 ILE HG23 H N N 206 ILE HD11 H N N 207 ILE HD12 H N N 208 ILE HD13 H N N 209 ILE HXT H N N 210 LEU N N N N 211 LEU CA C N S 212 LEU C C N N 213 LEU O O N N 214 LEU CB C N N 215 LEU CG C N N 216 LEU CD1 C N N 217 LEU CD2 C N N 218 LEU OXT O N N 219 LEU H H N N 220 LEU H2 H N N 221 LEU HA H N N 222 LEU HB2 H N N 223 LEU HB3 H N N 224 LEU HG H N N 225 LEU HD11 H N N 226 LEU HD12 H N N 227 LEU HD13 H N N 228 LEU HD21 H N N 229 LEU HD22 H N N 230 LEU HD23 H N N 231 LEU HXT H N N 232 LYS N N N N 233 LYS CA C N S 234 LYS C C N N 235 LYS O O N N 236 LYS CB C N N 237 LYS CG C N N 238 LYS CD C N N 239 LYS CE C N N 240 LYS NZ N N N 241 LYS OXT O N N 242 LYS H H N N 243 LYS H2 H N N 244 LYS HA H N N 245 LYS HB2 H N N 246 LYS HB3 H N N 247 LYS HG2 H N N 248 LYS HG3 H N N 249 LYS HD2 H N N 250 LYS HD3 H N N 251 LYS HE2 H N N 252 LYS HE3 H N N 253 LYS HZ1 H N N 254 LYS HZ2 H N N 255 LYS HZ3 H N N 256 LYS HXT H N N 257 MET N N N N 258 MET CA C N S 259 MET C C N N 260 MET O O N N 261 MET CB C N N 262 MET CG C N N 263 MET SD S N N 264 MET CE C N N 265 MET OXT O N N 266 MET H H N N 267 MET H2 H N N 268 MET HA H N N 269 MET HB2 H N N 270 MET HB3 H N N 271 MET HG2 H N N 272 MET HG3 H N N 273 MET HE1 H N N 274 MET HE2 H N N 275 MET HE3 H N N 276 MET HXT H N N 277 PHE N N N N 278 PHE CA C N S 279 PHE C C N N 280 PHE O O N N 281 PHE CB C N N 282 PHE CG C Y N 283 PHE CD1 C Y N 284 PHE CD2 C Y N 285 PHE CE1 C Y N 286 PHE CE2 C Y N 287 PHE CZ C Y N 288 PHE OXT O N N 289 PHE H H N N 290 PHE H2 H N N 291 PHE HA H N N 292 PHE HB2 H N N 293 PHE HB3 H N N 294 PHE HD1 H N N 295 PHE HD2 H N N 296 PHE HE1 H N N 297 PHE HE2 H N N 298 PHE HZ H N N 299 PHE HXT H N N 300 PRO N N N N 301 PRO CA C N S 302 PRO C C N N 303 PRO O O N N 304 PRO CB C N N 305 PRO CG C N N 306 PRO CD C N N 307 PRO OXT O N N 308 PRO H H N N 309 PRO HA H N N 310 PRO HB2 H N N 311 PRO HB3 H N N 312 PRO HG2 H N N 313 PRO HG3 H N N 314 PRO HD2 H N N 315 PRO HD3 H N N 316 PRO HXT H N N 317 SER N N N N 318 SER CA C N S 319 SER C C N N 320 SER O O N N 321 SER CB C N N 322 SER OG O N N 323 SER OXT O N N 324 SER H H N N 325 SER H2 H N N 326 SER HA H N N 327 SER HB2 H N N 328 SER HB3 H N N 329 SER HG H N N 330 SER HXT H N N 331 THR N N N N 332 THR CA C N S 333 THR C C N N 334 THR O O N N 335 THR CB C N R 336 THR OG1 O N N 337 THR CG2 C N N 338 THR OXT O N N 339 THR H H N N 340 THR H2 H N N 341 THR HA H N N 342 THR HB H N N 343 THR HG1 H N N 344 THR HG21 H N N 345 THR HG22 H N N 346 THR HG23 H N N 347 THR HXT H N N 348 TRP N N N N 349 TRP CA C N S 350 TRP C C N N 351 TRP O O N N 352 TRP CB C N N 353 TRP CG C Y N 354 TRP CD1 C Y N 355 TRP CD2 C Y N 356 TRP NE1 N Y N 357 TRP CE2 C Y N 358 TRP CE3 C Y N 359 TRP CZ2 C Y N 360 TRP CZ3 C Y N 361 TRP CH2 C Y N 362 TRP OXT O N N 363 TRP H H N N 364 TRP H2 H N N 365 TRP HA H N N 366 TRP HB2 H N N 367 TRP HB3 H N N 368 TRP HD1 H N N 369 TRP HE1 H N N 370 TRP HE3 H N N 371 TRP HZ2 H N N 372 TRP HZ3 H N N 373 TRP HH2 H N N 374 TRP HXT H N N 375 TYR N N N N 376 TYR CA C N S 377 TYR C C N N 378 TYR O O N N 379 TYR CB C N N 380 TYR CG C Y N 381 TYR CD1 C Y N 382 TYR CD2 C Y N 383 TYR CE1 C Y N 384 TYR CE2 C Y N 385 TYR CZ C Y N 386 TYR OH O N N 387 TYR OXT O N N 388 TYR H H N N 389 TYR H2 H N N 390 TYR HA H N N 391 TYR HB2 H N N 392 TYR HB3 H N N 393 TYR HD1 H N N 394 TYR HD2 H N N 395 TYR HE1 H N N 396 TYR HE2 H N N 397 TYR HH H N N 398 TYR HXT H N N 399 VAL N N N N 400 VAL CA C N S 401 VAL C C N N 402 VAL O O N N 403 VAL CB C N N 404 VAL CG1 C N N 405 VAL CG2 C N N 406 VAL OXT O N N 407 VAL H H N N 408 VAL H2 H N N 409 VAL HA H N N 410 VAL HB H N N 411 VAL HG11 H N N 412 VAL HG12 H N N 413 VAL HG13 H N N 414 VAL HG21 H N N 415 VAL HG22 H N N 416 VAL HG23 H N N 417 VAL HXT H N N 418 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1BEC C09 C08 doub Y N 1 A1BEC C09 C10 sing Y N 2 A1BEC C08 C07 sing Y N 3 A1BEC C01 C10 sing N N 4 A1BEC C01 C02 sing N N 5 A1BEC C10 C05 doub Y N 6 A1BEC C07 C06 doub Y N 7 A1BEC C02 N03 sing N N 8 A1BEC C06 C05 sing Y N 9 A1BEC C05 C04 sing N N 10 A1BEC N03 C04 sing N N 11 A1BEC C04 C11 sing N N 12 A1BEC C11 C12 doub Y N 13 A1BEC C11 C16 sing Y N 14 A1BEC C12 C13 sing Y N 15 A1BEC C16 C15 doub Y N 16 A1BEC C13 C14 doub Y N 17 A1BEC C15 C14 sing Y N 18 A1BEC C01 H1 sing N N 19 A1BEC C01 H2 sing N N 20 A1BEC C02 H3 sing N N 21 A1BEC C02 H4 sing N N 22 A1BEC C04 H5 sing N N 23 A1BEC C06 H6 sing N N 24 A1BEC C07 H7 sing N N 25 A1BEC C08 H8 sing N N 26 A1BEC C09 H9 sing N N 27 A1BEC C12 H10 sing N N 28 A1BEC C13 H11 sing N N 29 A1BEC C14 H12 sing N N 30 A1BEC C15 H13 sing N N 31 A1BEC C16 H14 sing N N 32 A1BEC N03 H15 sing N N 33 ALA N CA sing N N 34 ALA N H sing N N 35 ALA N H2 sing N N 36 ALA CA C sing N N 37 ALA CA CB sing N N 38 ALA CA HA sing N N 39 ALA C O doub N N 40 ALA C OXT sing N N 41 ALA CB HB1 sing N N 42 ALA CB HB2 sing N N 43 ALA CB HB3 sing N N 44 ALA OXT HXT sing N N 45 ARG N CA sing N N 46 ARG N H sing N N 47 ARG N H2 sing N N 48 ARG CA C sing N N 49 ARG CA CB sing N N 50 ARG CA HA sing N N 51 ARG C O doub N N 52 ARG C OXT sing N N 53 ARG CB CG sing N N 54 ARG CB HB2 sing N N 55 ARG CB HB3 sing N N 56 ARG CG CD sing N N 57 ARG CG HG2 sing N N 58 ARG CG HG3 sing N N 59 ARG CD NE sing N N 60 ARG CD HD2 sing N N 61 ARG CD HD3 sing N N 62 ARG NE CZ sing N N 63 ARG NE HE sing N N 64 ARG CZ NH1 sing N N 65 ARG CZ NH2 doub N N 66 ARG NH1 HH11 sing N N 67 ARG NH1 HH12 sing N N 68 ARG NH2 HH21 sing N N 69 ARG NH2 HH22 sing N N 70 ARG OXT HXT sing N N 71 ASN N CA sing N N 72 ASN N H sing N N 73 ASN N H2 sing N N 74 ASN CA C sing N N 75 ASN CA CB sing N N 76 ASN CA HA sing N N 77 ASN C O doub N N 78 ASN C OXT sing N N 79 ASN CB CG sing N N 80 ASN CB HB2 sing N N 81 ASN CB HB3 sing N N 82 ASN CG OD1 doub N N 83 ASN CG ND2 sing N N 84 ASN ND2 HD21 sing N N 85 ASN ND2 HD22 sing N N 86 ASN OXT HXT sing N N 87 ASP N CA sing N N 88 ASP N H sing N N 89 ASP N H2 sing N N 90 ASP CA C sing N N 91 ASP CA CB sing N N 92 ASP CA HA sing N N 93 ASP C O doub N N 94 ASP C OXT sing N N 95 ASP CB CG sing N N 96 ASP CB HB2 sing N N 97 ASP CB HB3 sing N N 98 ASP CG OD1 doub N N 99 ASP CG OD2 sing N N 100 ASP OD2 HD2 sing N N 101 ASP OXT HXT sing N N 102 CYS N CA sing N N 103 CYS N H sing N N 104 CYS N H2 sing N N 105 CYS CA C sing N N 106 CYS CA CB sing N N 107 CYS CA HA sing N N 108 CYS C O doub N N 109 CYS C OXT sing N N 110 CYS CB SG sing N N 111 CYS CB HB2 sing N N 112 CYS CB HB3 sing N N 113 CYS SG HG sing N N 114 CYS OXT HXT sing N N 115 GLN N CA sing N N 116 GLN N H sing N N 117 GLN N H2 sing N N 118 GLN CA C sing N N 119 GLN CA CB sing N N 120 GLN CA HA sing N N 121 GLN C O doub N N 122 GLN C OXT sing N N 123 GLN CB CG sing N N 124 GLN CB HB2 sing N N 125 GLN CB HB3 sing N N 126 GLN CG CD sing N N 127 GLN CG HG2 sing N N 128 GLN CG HG3 sing N N 129 GLN CD OE1 doub N N 130 GLN CD NE2 sing N N 131 GLN NE2 HE21 sing N N 132 GLN NE2 HE22 sing N N 133 GLN OXT HXT sing N N 134 GLU N CA sing N N 135 GLU N H sing N N 136 GLU N H2 sing N N 137 GLU CA C sing N N 138 GLU CA CB sing N N 139 GLU CA HA sing N N 140 GLU C O doub N N 141 GLU C OXT sing N N 142 GLU CB CG sing N N 143 GLU CB HB2 sing N N 144 GLU CB HB3 sing N N 145 GLU CG CD sing N N 146 GLU CG HG2 sing N N 147 GLU CG HG3 sing N N 148 GLU CD OE1 doub N N 149 GLU CD OE2 sing N N 150 GLU OE2 HE2 sing N N 151 GLU OXT HXT sing N N 152 GLY N CA sing N N 153 GLY N H sing N N 154 GLY N H2 sing N N 155 GLY CA C sing N N 156 GLY CA HA2 sing N N 157 GLY CA HA3 sing N N 158 GLY C O doub N N 159 GLY C OXT sing N N 160 GLY OXT HXT sing N N 161 HIS N CA sing N N 162 HIS N H sing N N 163 HIS N H2 sing N N 164 HIS CA C sing N N 165 HIS CA CB sing N N 166 HIS CA HA sing N N 167 HIS C O doub N N 168 HIS C OXT sing N N 169 HIS CB CG sing N N 170 HIS CB HB2 sing N N 171 HIS CB HB3 sing N N 172 HIS CG ND1 sing Y N 173 HIS CG CD2 doub Y N 174 HIS ND1 CE1 doub Y N 175 HIS ND1 HD1 sing N N 176 HIS CD2 NE2 sing Y N 177 HIS CD2 HD2 sing N N 178 HIS CE1 NE2 sing Y N 179 HIS CE1 HE1 sing N N 180 HIS NE2 HE2 sing N N 181 HIS OXT HXT sing N N 182 ILE N CA sing N N 183 ILE N H sing N N 184 ILE N H2 sing N N 185 ILE CA C sing N N 186 ILE CA CB sing N N 187 ILE CA HA sing N N 188 ILE C O doub N N 189 ILE C OXT sing N N 190 ILE CB CG1 sing N N 191 ILE CB CG2 sing N N 192 ILE CB HB sing N N 193 ILE CG1 CD1 sing N N 194 ILE CG1 HG12 sing N N 195 ILE CG1 HG13 sing N N 196 ILE CG2 HG21 sing N N 197 ILE CG2 HG22 sing N N 198 ILE CG2 HG23 sing N N 199 ILE CD1 HD11 sing N N 200 ILE CD1 HD12 sing N N 201 ILE CD1 HD13 sing N N 202 ILE OXT HXT sing N N 203 LEU N CA sing N N 204 LEU N H sing N N 205 LEU N H2 sing N N 206 LEU CA C sing N N 207 LEU CA CB sing N N 208 LEU CA HA sing N N 209 LEU C O doub N N 210 LEU C OXT sing N N 211 LEU CB CG sing N N 212 LEU CB HB2 sing N N 213 LEU CB HB3 sing N N 214 LEU CG CD1 sing N N 215 LEU CG CD2 sing N N 216 LEU CG HG sing N N 217 LEU CD1 HD11 sing N N 218 LEU CD1 HD12 sing N N 219 LEU CD1 HD13 sing N N 220 LEU CD2 HD21 sing N N 221 LEU CD2 HD22 sing N N 222 LEU CD2 HD23 sing N N 223 LEU OXT HXT sing N N 224 LYS N CA sing N N 225 LYS N H sing N N 226 LYS N H2 sing N N 227 LYS CA C sing N N 228 LYS CA CB sing N N 229 LYS CA HA sing N N 230 LYS C O doub N N 231 LYS C OXT sing N N 232 LYS CB CG sing N N 233 LYS CB HB2 sing N N 234 LYS CB HB3 sing N N 235 LYS CG CD sing N N 236 LYS CG HG2 sing N N 237 LYS CG HG3 sing N N 238 LYS CD CE sing N N 239 LYS CD HD2 sing N N 240 LYS CD HD3 sing N N 241 LYS CE NZ sing N N 242 LYS CE HE2 sing N N 243 LYS CE HE3 sing N N 244 LYS NZ HZ1 sing N N 245 LYS NZ HZ2 sing N N 246 LYS NZ HZ3 sing N N 247 LYS OXT HXT sing N N 248 MET N CA sing N N 249 MET N H sing N N 250 MET N H2 sing N N 251 MET CA C sing N N 252 MET CA CB sing N N 253 MET CA HA sing N N 254 MET C O doub N N 255 MET C OXT sing N N 256 MET CB CG sing N N 257 MET CB HB2 sing N N 258 MET CB HB3 sing N N 259 MET CG SD sing N N 260 MET CG HG2 sing N N 261 MET CG HG3 sing N N 262 MET SD CE sing N N 263 MET CE HE1 sing N N 264 MET CE HE2 sing N N 265 MET CE HE3 sing N N 266 MET OXT HXT sing N N 267 PHE N CA sing N N 268 PHE N H sing N N 269 PHE N H2 sing N N 270 PHE CA C sing N N 271 PHE CA CB sing N N 272 PHE CA HA sing N N 273 PHE C O doub N N 274 PHE C OXT sing N N 275 PHE CB CG sing N N 276 PHE CB HB2 sing N N 277 PHE CB HB3 sing N N 278 PHE CG CD1 doub Y N 279 PHE CG CD2 sing Y N 280 PHE CD1 CE1 sing Y N 281 PHE CD1 HD1 sing N N 282 PHE CD2 CE2 doub Y N 283 PHE CD2 HD2 sing N N 284 PHE CE1 CZ doub Y N 285 PHE CE1 HE1 sing N N 286 PHE CE2 CZ sing Y N 287 PHE CE2 HE2 sing N N 288 PHE CZ HZ sing N N 289 PHE OXT HXT sing N N 290 PRO N CA sing N N 291 PRO N CD sing N N 292 PRO N H sing N N 293 PRO CA C sing N N 294 PRO CA CB sing N N 295 PRO CA HA sing N N 296 PRO C O doub N N 297 PRO C OXT sing N N 298 PRO CB CG sing N N 299 PRO CB HB2 sing N N 300 PRO CB HB3 sing N N 301 PRO CG CD sing N N 302 PRO CG HG2 sing N N 303 PRO CG HG3 sing N N 304 PRO CD HD2 sing N N 305 PRO CD HD3 sing N N 306 PRO OXT HXT sing N N 307 SER N CA sing N N 308 SER N H sing N N 309 SER N H2 sing N N 310 SER CA C sing N N 311 SER CA CB sing N N 312 SER CA HA sing N N 313 SER C O doub N N 314 SER C OXT sing N N 315 SER CB OG sing N N 316 SER CB HB2 sing N N 317 SER CB HB3 sing N N 318 SER OG HG sing N N 319 SER OXT HXT sing N N 320 THR N CA sing N N 321 THR N H sing N N 322 THR N H2 sing N N 323 THR CA C sing N N 324 THR CA CB sing N N 325 THR CA HA sing N N 326 THR C O doub N N 327 THR C OXT sing N N 328 THR CB OG1 sing N N 329 THR CB CG2 sing N N 330 THR CB HB sing N N 331 THR OG1 HG1 sing N N 332 THR CG2 HG21 sing N N 333 THR CG2 HG22 sing N N 334 THR CG2 HG23 sing N N 335 THR OXT HXT sing N N 336 TRP N CA sing N N 337 TRP N H sing N N 338 TRP N H2 sing N N 339 TRP CA C sing N N 340 TRP CA CB sing N N 341 TRP CA HA sing N N 342 TRP C O doub N N 343 TRP C OXT sing N N 344 TRP CB CG sing N N 345 TRP CB HB2 sing N N 346 TRP CB HB3 sing N N 347 TRP CG CD1 doub Y N 348 TRP CG CD2 sing Y N 349 TRP CD1 NE1 sing Y N 350 TRP CD1 HD1 sing N N 351 TRP CD2 CE2 doub Y N 352 TRP CD2 CE3 sing Y N 353 TRP NE1 CE2 sing Y N 354 TRP NE1 HE1 sing N N 355 TRP CE2 CZ2 sing Y N 356 TRP CE3 CZ3 doub Y N 357 TRP CE3 HE3 sing N N 358 TRP CZ2 CH2 doub Y N 359 TRP CZ2 HZ2 sing N N 360 TRP CZ3 CH2 sing Y N 361 TRP CZ3 HZ3 sing N N 362 TRP CH2 HH2 sing N N 363 TRP OXT HXT sing N N 364 TYR N CA sing N N 365 TYR N H sing N N 366 TYR N H2 sing N N 367 TYR CA C sing N N 368 TYR CA CB sing N N 369 TYR CA HA sing N N 370 TYR C O doub N N 371 TYR C OXT sing N N 372 TYR CB CG sing N N 373 TYR CB HB2 sing N N 374 TYR CB HB3 sing N N 375 TYR CG CD1 doub Y N 376 TYR CG CD2 sing Y N 377 TYR CD1 CE1 sing Y N 378 TYR CD1 HD1 sing N N 379 TYR CD2 CE2 doub Y N 380 TYR CD2 HD2 sing N N 381 TYR CE1 CZ doub Y N 382 TYR CE1 HE1 sing N N 383 TYR CE2 CZ sing Y N 384 TYR CE2 HE2 sing N N 385 TYR CZ OH sing N N 386 TYR OH HH sing N N 387 TYR OXT HXT sing N N 388 VAL N CA sing N N 389 VAL N H sing N N 390 VAL N H2 sing N N 391 VAL CA C sing N N 392 VAL CA CB sing N N 393 VAL CA HA sing N N 394 VAL C O doub N N 395 VAL C OXT sing N N 396 VAL CB CG1 sing N N 397 VAL CB CG2 sing N N 398 VAL CB HB sing N N 399 VAL CG1 HG11 sing N N 400 VAL CG1 HG12 sing N N 401 VAL CG1 HG13 sing N N 402 VAL CG2 HG21 sing N N 403 VAL CG2 HG22 sing N N 404 VAL CG2 HG23 sing N N 405 VAL OXT HXT sing N N 406 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'R35 GM148356' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3VW0 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9DNK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017039 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001120 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010707 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022465 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #