data_9DZM # _entry.id 9DZM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9DZM pdb_00009dzm 10.2210/pdb9dzm/pdb WWPDB D_1000289135 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-10-23 ? 2 'Structure model' 1 1 2025-03-05 ? 3 'Structure model' 1 2 2025-03-12 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9DZM _pdbx_database_status.recvd_initial_deposition_date 2024-10-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email gpoon@gsu.edu _pdbx_contact_author.name_first Gregory _pdbx_contact_author.name_last Poon _pdbx_contact_author.name_mi MK _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5107-9458 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Terrell, J.R.' 1 0000-0001-5394-5663 'Poon, G.M.K.' 2 0000-0001-5107-9458 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Phys.Chem.B _citation.journal_id_ASTM JPCBFK _citation.journal_id_CSD 1278 _citation.journal_id_ISSN 1089-5647 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 129 _citation.language ? _citation.page_first 2138 _citation.page_last 2148 _citation.title 'Coupled Heterogeneity to Dimeric Site-Specific Binding by the POU-Family Transcription Factor OCT2.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jpcb.4c07071 _citation.pdbx_database_id_PubMed 39960871 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Terrell, J.R.' 1 ? primary 'Poon, G.M.K.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn ;DNA (5'-D(*TP*CP*CP*TP*CP*AP*TP*GP*CP*AP*TP*AP*TP*GP*CP*AP*TP*GP*AP*GP*G)-3') ; 6438.172 1 ? ? ? ? 2 polymer syn ;DNA (5'-D(*TP*CP*CP*TP*CP*AP*TP*GP*CP*AP*TP*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*A)-3') ; 6751.379 1 ? ? ? ? 3 polymer man 'POU domain, class 2, transcription factor 2' 19278.094 4 ? ? ? ? 4 non-polymer syn 'BROMIDE ION' 79.904 1 ? ? ? ? 5 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 3 _entity_name_com.name ;Lymphoid-restricted immunoglobulin octamer-binding protein NF-A2,Octamer-binding protein 2,Oct-2,Octamer-binding transcription factor 2,OTF-2 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 polydeoxyribonucleotide no no ;(DT)(DC)(DC)(DT)(DC)(DA)(DT)(DG)(DC)(DA)(DT)(DA)(DT)(DG)(DC)(DA)(DT)(DG)(DA)(DG) (DG) ; TCCTCATGCATATGCATGAGG A ? 2 polydeoxyribonucleotide no no ;(DT)(DC)(DC)(DT)(DC)(DA)(DT)(DG)(DC)(DA)(DT)(DA)(DT)(DG)(DC)(DA)(DT)(DG)(DA)(DG) (DG)(DA) ; TCCTCATGCATATGCATGAGGA B ? 3 'polypeptide(L)' no no ;GSHMEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAET MSVDSSLPSPNQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQ KEKRINP ; ;GSHMEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAET MSVDSSLPSPNQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQ KEKRINP ; C,D,E,F ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 'BROMIDE ION' BR 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 DT n 1 2 DC n 1 3 DC n 1 4 DT n 1 5 DC n 1 6 DA n 1 7 DT n 1 8 DG n 1 9 DC n 1 10 DA n 1 11 DT n 1 12 DA n 1 13 DT n 1 14 DG n 1 15 DC n 1 16 DA n 1 17 DT n 1 18 DG n 1 19 DA n 1 20 DG n 1 21 DG n 2 1 DT n 2 2 DC n 2 3 DC n 2 4 DT n 2 5 DC n 2 6 DA n 2 7 DT n 2 8 DG n 2 9 DC n 2 10 DA n 2 11 DT n 2 12 DA n 2 13 DT n 2 14 DG n 2 15 DC n 2 16 DA n 2 17 DT n 2 18 DG n 2 19 DA n 2 20 DG n 2 21 DG n 2 22 DA n 3 1 GLY n 3 2 SER n 3 3 HIS n 3 4 MET n 3 5 GLU n 3 6 GLU n 3 7 PRO n 3 8 SER n 3 9 ASP n 3 10 LEU n 3 11 GLU n 3 12 GLU n 3 13 LEU n 3 14 GLU n 3 15 GLN n 3 16 PHE n 3 17 ALA n 3 18 ARG n 3 19 THR n 3 20 PHE n 3 21 LYS n 3 22 GLN n 3 23 ARG n 3 24 ARG n 3 25 ILE n 3 26 LYS n 3 27 LEU n 3 28 GLY n 3 29 PHE n 3 30 THR n 3 31 GLN n 3 32 GLY n 3 33 ASP n 3 34 VAL n 3 35 GLY n 3 36 LEU n 3 37 ALA n 3 38 MET n 3 39 GLY n 3 40 LYS n 3 41 LEU n 3 42 TYR n 3 43 GLY n 3 44 ASN n 3 45 ASP n 3 46 PHE n 3 47 SER n 3 48 GLN n 3 49 THR n 3 50 THR n 3 51 ILE n 3 52 SER n 3 53 ARG n 3 54 PHE n 3 55 GLU n 3 56 ALA n 3 57 LEU n 3 58 ASN n 3 59 LEU n 3 60 SER n 3 61 PHE n 3 62 LYS n 3 63 ASN n 3 64 MET n 3 65 CYS n 3 66 LYS n 3 67 LEU n 3 68 LYS n 3 69 PRO n 3 70 LEU n 3 71 LEU n 3 72 GLU n 3 73 LYS n 3 74 TRP n 3 75 LEU n 3 76 ASN n 3 77 ASP n 3 78 ALA n 3 79 GLU n 3 80 THR n 3 81 MET n 3 82 SER n 3 83 VAL n 3 84 ASP n 3 85 SER n 3 86 SER n 3 87 LEU n 3 88 PRO n 3 89 SER n 3 90 PRO n 3 91 ASN n 3 92 GLN n 3 93 LEU n 3 94 SER n 3 95 SER n 3 96 PRO n 3 97 SER n 3 98 LEU n 3 99 GLY n 3 100 PHE n 3 101 ASP n 3 102 GLY n 3 103 LEU n 3 104 PRO n 3 105 GLY n 3 106 ARG n 3 107 ARG n 3 108 ARG n 3 109 LYS n 3 110 LYS n 3 111 ARG n 3 112 THR n 3 113 SER n 3 114 ILE n 3 115 GLU n 3 116 THR n 3 117 ASN n 3 118 VAL n 3 119 ARG n 3 120 PHE n 3 121 ALA n 3 122 LEU n 3 123 GLU n 3 124 LYS n 3 125 SER n 3 126 PHE n 3 127 LEU n 3 128 ALA n 3 129 ASN n 3 130 GLN n 3 131 LYS n 3 132 PRO n 3 133 THR n 3 134 SER n 3 135 GLU n 3 136 GLU n 3 137 ILE n 3 138 LEU n 3 139 LEU n 3 140 ILE n 3 141 ALA n 3 142 GLU n 3 143 GLN n 3 144 LEU n 3 145 HIS n 3 146 MET n 3 147 GLU n 3 148 LYS n 3 149 GLU n 3 150 VAL n 3 151 ILE n 3 152 ARG n 3 153 VAL n 3 154 TRP n 3 155 PHE n 3 156 CYS n 3 157 ASN n 3 158 ARG n 3 159 ARG n 3 160 GLN n 3 161 LYS n 3 162 GLU n 3 163 LYS n 3 164 ARG n 3 165 ILE n 3 166 ASN n 3 167 PRO n # _entity_src_gen.entity_id 3 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 167 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'POU2F2, OCT2, OTF2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample 1 21 'synthetic construct' ? 32630 ? 2 1 sample 1 22 'synthetic construct' ? 32630 ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BR non-polymer . 'BROMIDE ION' ? 'Br -1' 79.904 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DA 'DNA linking' y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 DC 'DNA linking' y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P' 307.197 DG 'DNA linking' y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 DT 'DNA linking' y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 DT 1 201 201 DT DT A . n A 1 2 DC 2 202 202 DC DC A . n A 1 3 DC 3 203 203 DC DC A . n A 1 4 DT 4 204 204 DT DT A . n A 1 5 DC 5 205 205 DC DC A . n A 1 6 DA 6 206 206 DA DA A . n A 1 7 DT 7 207 207 DT DT A . n A 1 8 DG 8 208 208 DG DG A . n A 1 9 DC 9 209 209 DC DC A . n A 1 10 DA 10 210 210 DA DA A . n A 1 11 DT 11 211 211 DT DT A . n A 1 12 DA 12 212 212 DA DA A . n A 1 13 DT 13 213 213 DT DT A . n A 1 14 DG 14 214 214 DG DG A . n A 1 15 DC 15 215 215 DC DC A . n A 1 16 DA 16 216 216 DA DA A . n A 1 17 DT 17 217 217 DT DT A . n A 1 18 DG 18 218 218 DG DG A . n A 1 19 DA 19 219 219 DA DA A . n A 1 20 DG 20 220 220 DG DG A . n A 1 21 DG 21 221 221 DG DG A . n B 2 1 DT 1 201 201 DT DT B . n B 2 2 DC 2 202 202 DC DC B . n B 2 3 DC 3 203 203 DC DC B . n B 2 4 DT 4 204 204 DT DT B . n B 2 5 DC 5 205 205 DC DC B . n B 2 6 DA 6 206 206 DA DA B . n B 2 7 DT 7 207 207 DT DT B . n B 2 8 DG 8 208 208 DG DG B . n B 2 9 DC 9 209 209 DC DC B . n B 2 10 DA 10 210 210 DA DA B . n B 2 11 DT 11 211 211 DT DT B . n B 2 12 DA 12 212 212 DA DA B . n B 2 13 DT 13 213 213 DT DT B . n B 2 14 DG 14 214 214 DG DG B . n B 2 15 DC 15 215 215 DC DC B . n B 2 16 DA 16 216 216 DA DA B . n B 2 17 DT 17 217 217 DT DT B . n B 2 18 DG 18 218 218 DG DG B . n B 2 19 DA 19 219 219 DA DA B . n B 2 20 DG 20 220 220 DG DG B . n B 2 21 DG 21 221 221 DG DG B . n B 2 22 DA 22 222 222 DA DA B . n C 3 1 GLY 1 193 ? ? ? C . n C 3 2 SER 2 194 ? ? ? C . n C 3 3 HIS 3 195 ? ? ? C . n C 3 4 MET 4 196 ? ? ? C . n C 3 5 GLU 5 197 197 GLU GLU C . n C 3 6 GLU 6 198 198 GLU GLU C . n C 3 7 PRO 7 199 199 PRO PRO C . n C 3 8 SER 8 200 200 SER SER C . n C 3 9 ASP 9 201 201 ASP ASP C . n C 3 10 LEU 10 202 202 LEU LEU C . n C 3 11 GLU 11 203 203 GLU GLU C . n C 3 12 GLU 12 204 204 GLU GLU C . n C 3 13 LEU 13 205 205 LEU LEU C . n C 3 14 GLU 14 206 206 GLU GLU C . n C 3 15 GLN 15 207 207 GLN GLN C . n C 3 16 PHE 16 208 208 PHE PHE C . n C 3 17 ALA 17 209 209 ALA ALA C . n C 3 18 ARG 18 210 210 ARG ARG C . n C 3 19 THR 19 211 211 THR THR C . n C 3 20 PHE 20 212 212 PHE PHE C . n C 3 21 LYS 21 213 213 LYS LYS C . n C 3 22 GLN 22 214 214 GLN GLN C . n C 3 23 ARG 23 215 215 ARG ARG C . n C 3 24 ARG 24 216 216 ARG ARG C . n C 3 25 ILE 25 217 217 ILE ILE C . n C 3 26 LYS 26 218 218 LYS LYS C . n C 3 27 LEU 27 219 219 LEU LEU C . n C 3 28 GLY 28 220 220 GLY GLY C . n C 3 29 PHE 29 221 221 PHE PHE C . n C 3 30 THR 30 222 222 THR THR C . n C 3 31 GLN 31 223 223 GLN GLN C . n C 3 32 GLY 32 224 224 GLY GLY C . n C 3 33 ASP 33 225 225 ASP ASP C . n C 3 34 VAL 34 226 226 VAL VAL C . n C 3 35 GLY 35 227 227 GLY GLY C . n C 3 36 LEU 36 228 228 LEU LEU C . n C 3 37 ALA 37 229 229 ALA ALA C . n C 3 38 MET 38 230 230 MET MET C . n C 3 39 GLY 39 231 231 GLY GLY C . n C 3 40 LYS 40 232 232 LYS LYS C . n C 3 41 LEU 41 233 233 LEU LEU C . n C 3 42 TYR 42 234 234 TYR TYR C . n C 3 43 GLY 43 235 235 GLY GLY C . n C 3 44 ASN 44 236 236 ASN ASN C . n C 3 45 ASP 45 237 237 ASP ASP C . n C 3 46 PHE 46 238 238 PHE PHE C . n C 3 47 SER 47 239 239 SER SER C . n C 3 48 GLN 48 240 240 GLN GLN C . n C 3 49 THR 49 241 241 THR THR C . n C 3 50 THR 50 242 242 THR THR C . n C 3 51 ILE 51 243 243 ILE ILE C . n C 3 52 SER 52 244 244 SER SER C . n C 3 53 ARG 53 245 245 ARG ARG C . n C 3 54 PHE 54 246 246 PHE PHE C . n C 3 55 GLU 55 247 247 GLU GLU C . n C 3 56 ALA 56 248 248 ALA ALA C . n C 3 57 LEU 57 249 249 LEU LEU C . n C 3 58 ASN 58 250 250 ASN ASN C . n C 3 59 LEU 59 251 251 LEU LEU C . n C 3 60 SER 60 252 252 SER SER C . n C 3 61 PHE 61 253 253 PHE PHE C . n C 3 62 LYS 62 254 254 LYS LYS C . n C 3 63 ASN 63 255 255 ASN ASN C . n C 3 64 MET 64 256 256 MET MET C . n C 3 65 CYS 65 257 257 CYS CYS C . n C 3 66 LYS 66 258 258 LYS LYS C . n C 3 67 LEU 67 259 259 LEU LEU C . n C 3 68 LYS 68 260 260 LYS LYS C . n C 3 69 PRO 69 261 261 PRO PRO C . n C 3 70 LEU 70 262 262 LEU LEU C . n C 3 71 LEU 71 263 263 LEU LEU C . n C 3 72 GLU 72 264 264 GLU GLU C . n C 3 73 LYS 73 265 265 LYS LYS C . n C 3 74 TRP 74 266 266 TRP TRP C . n C 3 75 LEU 75 267 267 LEU LEU C . n C 3 76 ASN 76 268 268 ASN ASN C . n C 3 77 ASP 77 269 269 ASP ASP C . n C 3 78 ALA 78 270 270 ALA ALA C . n C 3 79 GLU 79 271 271 GLU GLU C . n C 3 80 THR 80 272 272 THR THR C . n C 3 81 MET 81 273 273 MET MET C . n C 3 82 SER 82 274 274 SER SER C . n C 3 83 VAL 83 275 275 VAL VAL C . n C 3 84 ASP 84 276 276 ASP ASP C . n C 3 85 SER 85 277 277 SER SER C . n C 3 86 SER 86 278 ? ? ? C . n C 3 87 LEU 87 279 ? ? ? C . n C 3 88 PRO 88 280 ? ? ? C . n C 3 89 SER 89 281 ? ? ? C . n C 3 90 PRO 90 282 ? ? ? C . n C 3 91 ASN 91 283 ? ? ? C . n C 3 92 GLN 92 284 ? ? ? C . n C 3 93 LEU 93 285 ? ? ? C . n C 3 94 SER 94 286 ? ? ? C . n C 3 95 SER 95 287 ? ? ? C . n C 3 96 PRO 96 288 ? ? ? C . n C 3 97 SER 97 289 ? ? ? C . n C 3 98 LEU 98 290 ? ? ? C . n C 3 99 GLY 99 291 ? ? ? C . n C 3 100 PHE 100 292 ? ? ? C . n C 3 101 ASP 101 293 ? ? ? C . n C 3 102 GLY 102 294 ? ? ? C . n C 3 103 LEU 103 295 ? ? ? C . n C 3 104 PRO 104 296 ? ? ? C . n C 3 105 GLY 105 297 ? ? ? C . n C 3 106 ARG 106 298 ? ? ? C . n C 3 107 ARG 107 299 ? ? ? C . n C 3 108 ARG 108 300 ? ? ? C . n C 3 109 LYS 109 301 ? ? ? C . n C 3 110 LYS 110 302 ? ? ? C . n C 3 111 ARG 111 303 ? ? ? C . n C 3 112 THR 112 304 ? ? ? C . n C 3 113 SER 113 305 ? ? ? C . n C 3 114 ILE 114 306 ? ? ? C . n C 3 115 GLU 115 307 ? ? ? C . n C 3 116 THR 116 308 ? ? ? C . n C 3 117 ASN 117 309 ? ? ? C . n C 3 118 VAL 118 310 ? ? ? C . n C 3 119 ARG 119 311 ? ? ? C . n C 3 120 PHE 120 312 ? ? ? C . n C 3 121 ALA 121 313 ? ? ? C . n C 3 122 LEU 122 314 ? ? ? C . n C 3 123 GLU 123 315 ? ? ? C . n C 3 124 LYS 124 316 ? ? ? C . n C 3 125 SER 125 317 ? ? ? C . n C 3 126 PHE 126 318 ? ? ? C . n C 3 127 LEU 127 319 ? ? ? C . n C 3 128 ALA 128 320 ? ? ? C . n C 3 129 ASN 129 321 ? ? ? C . n C 3 130 GLN 130 322 ? ? ? C . n C 3 131 LYS 131 323 ? ? ? C . n C 3 132 PRO 132 324 ? ? ? C . n C 3 133 THR 133 325 ? ? ? C . n C 3 134 SER 134 326 ? ? ? C . n C 3 135 GLU 135 327 ? ? ? C . n C 3 136 GLU 136 328 ? ? ? C . n C 3 137 ILE 137 329 ? ? ? C . n C 3 138 LEU 138 330 ? ? ? C . n C 3 139 LEU 139 331 ? ? ? C . n C 3 140 ILE 140 332 ? ? ? C . n C 3 141 ALA 141 333 ? ? ? C . n C 3 142 GLU 142 334 ? ? ? C . n C 3 143 GLN 143 335 ? ? ? C . n C 3 144 LEU 144 336 ? ? ? C . n C 3 145 HIS 145 337 ? ? ? C . n C 3 146 MET 146 338 ? ? ? C . n C 3 147 GLU 147 339 ? ? ? C . n C 3 148 LYS 148 340 ? ? ? C . n C 3 149 GLU 149 341 ? ? ? C . n C 3 150 VAL 150 342 ? ? ? C . n C 3 151 ILE 151 343 ? ? ? C . n C 3 152 ARG 152 344 ? ? ? C . n C 3 153 VAL 153 345 ? ? ? C . n C 3 154 TRP 154 346 ? ? ? C . n C 3 155 PHE 155 347 ? ? ? C . n C 3 156 CYS 156 348 ? ? ? C . n C 3 157 ASN 157 349 ? ? ? C . n C 3 158 ARG 158 350 ? ? ? C . n C 3 159 ARG 159 351 ? ? ? C . n C 3 160 GLN 160 352 ? ? ? C . n C 3 161 LYS 161 353 ? ? ? C . n C 3 162 GLU 162 354 ? ? ? C . n C 3 163 LYS 163 355 ? ? ? C . n C 3 164 ARG 164 356 ? ? ? C . n C 3 165 ILE 165 357 ? ? ? C . n C 3 166 ASN 166 358 ? ? ? C . n C 3 167 PRO 167 359 ? ? ? C . n D 3 1 GLY 1 193 ? ? ? D . n D 3 2 SER 2 194 ? ? ? D . n D 3 3 HIS 3 195 ? ? ? D . n D 3 4 MET 4 196 ? ? ? D . n D 3 5 GLU 5 197 ? ? ? D . n D 3 6 GLU 6 198 ? ? ? D . n D 3 7 PRO 7 199 199 PRO PRO D . n D 3 8 SER 8 200 200 SER SER D . n D 3 9 ASP 9 201 201 ASP ASP D . n D 3 10 LEU 10 202 202 LEU LEU D . n D 3 11 GLU 11 203 203 GLU GLU D . n D 3 12 GLU 12 204 204 GLU GLU D . n D 3 13 LEU 13 205 205 LEU LEU D . n D 3 14 GLU 14 206 206 GLU GLU D . n D 3 15 GLN 15 207 207 GLN GLN D . n D 3 16 PHE 16 208 208 PHE PHE D . n D 3 17 ALA 17 209 209 ALA ALA D . n D 3 18 ARG 18 210 210 ARG ARG D . n D 3 19 THR 19 211 211 THR THR D . n D 3 20 PHE 20 212 212 PHE PHE D . n D 3 21 LYS 21 213 213 LYS LYS D . n D 3 22 GLN 22 214 214 GLN GLN D . n D 3 23 ARG 23 215 215 ARG ARG D . n D 3 24 ARG 24 216 216 ARG ARG D . n D 3 25 ILE 25 217 217 ILE ILE D . n D 3 26 LYS 26 218 218 LYS LYS D . n D 3 27 LEU 27 219 219 LEU LEU D . n D 3 28 GLY 28 220 220 GLY GLY D . n D 3 29 PHE 29 221 221 PHE PHE D . n D 3 30 THR 30 222 222 THR THR D . n D 3 31 GLN 31 223 223 GLN GLN D . n D 3 32 GLY 32 224 224 GLY GLY D . n D 3 33 ASP 33 225 225 ASP ASP D . n D 3 34 VAL 34 226 226 VAL VAL D . n D 3 35 GLY 35 227 227 GLY GLY D . n D 3 36 LEU 36 228 228 LEU LEU D . n D 3 37 ALA 37 229 229 ALA ALA D . n D 3 38 MET 38 230 230 MET MET D . n D 3 39 GLY 39 231 231 GLY GLY D . n D 3 40 LYS 40 232 232 LYS LYS D . n D 3 41 LEU 41 233 233 LEU LEU D . n D 3 42 TYR 42 234 234 TYR TYR D . n D 3 43 GLY 43 235 235 GLY GLY D . n D 3 44 ASN 44 236 236 ASN ASN D . n D 3 45 ASP 45 237 237 ASP ASP D . n D 3 46 PHE 46 238 238 PHE PHE D . n D 3 47 SER 47 239 239 SER SER D . n D 3 48 GLN 48 240 240 GLN GLN D . n D 3 49 THR 49 241 241 THR THR D . n D 3 50 THR 50 242 242 THR THR D . n D 3 51 ILE 51 243 243 ILE ILE D . n D 3 52 SER 52 244 244 SER SER D . n D 3 53 ARG 53 245 245 ARG ARG D . n D 3 54 PHE 54 246 246 PHE PHE D . n D 3 55 GLU 55 247 247 GLU GLU D . n D 3 56 ALA 56 248 248 ALA ALA D . n D 3 57 LEU 57 249 249 LEU LEU D . n D 3 58 ASN 58 250 250 ASN ASN D . n D 3 59 LEU 59 251 251 LEU LEU D . n D 3 60 SER 60 252 252 SER SER D . n D 3 61 PHE 61 253 253 PHE PHE D . n D 3 62 LYS 62 254 254 LYS LYS D . n D 3 63 ASN 63 255 255 ASN ASN D . n D 3 64 MET 64 256 256 MET MET D . n D 3 65 CYS 65 257 257 CYS CYS D . n D 3 66 LYS 66 258 258 LYS LYS D . n D 3 67 LEU 67 259 259 LEU LEU D . n D 3 68 LYS 68 260 260 LYS LYS D . n D 3 69 PRO 69 261 261 PRO PRO D . n D 3 70 LEU 70 262 262 LEU LEU D . n D 3 71 LEU 71 263 263 LEU LEU D . n D 3 72 GLU 72 264 264 GLU GLU D . n D 3 73 LYS 73 265 265 LYS LYS D . n D 3 74 TRP 74 266 266 TRP TRP D . n D 3 75 LEU 75 267 267 LEU LEU D . n D 3 76 ASN 76 268 268 ASN ASN D . n D 3 77 ASP 77 269 269 ASP ASP D . n D 3 78 ALA 78 270 270 ALA ALA D . n D 3 79 GLU 79 271 271 GLU GLU D . n D 3 80 THR 80 272 272 THR THR D . n D 3 81 MET 81 273 273 MET MET D . n D 3 82 SER 82 274 274 SER SER D . n D 3 83 VAL 83 275 275 VAL VAL D . n D 3 84 ASP 84 276 276 ASP ASP D . n D 3 85 SER 85 277 ? ? ? D . n D 3 86 SER 86 278 ? ? ? D . n D 3 87 LEU 87 279 ? ? ? D . n D 3 88 PRO 88 280 ? ? ? D . n D 3 89 SER 89 281 ? ? ? D . n D 3 90 PRO 90 282 ? ? ? D . n D 3 91 ASN 91 283 ? ? ? D . n D 3 92 GLN 92 284 ? ? ? D . n D 3 93 LEU 93 285 ? ? ? D . n D 3 94 SER 94 286 ? ? ? D . n D 3 95 SER 95 287 ? ? ? D . n D 3 96 PRO 96 288 ? ? ? D . n D 3 97 SER 97 289 ? ? ? D . n D 3 98 LEU 98 290 ? ? ? D . n D 3 99 GLY 99 291 ? ? ? D . n D 3 100 PHE 100 292 ? ? ? D . n D 3 101 ASP 101 293 ? ? ? D . n D 3 102 GLY 102 294 ? ? ? D . n D 3 103 LEU 103 295 ? ? ? D . n D 3 104 PRO 104 296 ? ? ? D . n D 3 105 GLY 105 297 ? ? ? D . n D 3 106 ARG 106 298 ? ? ? D . n D 3 107 ARG 107 299 ? ? ? D . n D 3 108 ARG 108 300 ? ? ? D . n D 3 109 LYS 109 301 ? ? ? D . n D 3 110 LYS 110 302 ? ? ? D . n D 3 111 ARG 111 303 ? ? ? D . n D 3 112 THR 112 304 ? ? ? D . n D 3 113 SER 113 305 ? ? ? D . n D 3 114 ILE 114 306 ? ? ? D . n D 3 115 GLU 115 307 ? ? ? D . n D 3 116 THR 116 308 ? ? ? D . n D 3 117 ASN 117 309 ? ? ? D . n D 3 118 VAL 118 310 ? ? ? D . n D 3 119 ARG 119 311 ? ? ? D . n D 3 120 PHE 120 312 ? ? ? D . n D 3 121 ALA 121 313 ? ? ? D . n D 3 122 LEU 122 314 ? ? ? D . n D 3 123 GLU 123 315 ? ? ? D . n D 3 124 LYS 124 316 ? ? ? D . n D 3 125 SER 125 317 ? ? ? D . n D 3 126 PHE 126 318 ? ? ? D . n D 3 127 LEU 127 319 ? ? ? D . n D 3 128 ALA 128 320 ? ? ? D . n D 3 129 ASN 129 321 ? ? ? D . n D 3 130 GLN 130 322 ? ? ? D . n D 3 131 LYS 131 323 ? ? ? D . n D 3 132 PRO 132 324 ? ? ? D . n D 3 133 THR 133 325 ? ? ? D . n D 3 134 SER 134 326 ? ? ? D . n D 3 135 GLU 135 327 ? ? ? D . n D 3 136 GLU 136 328 ? ? ? D . n D 3 137 ILE 137 329 ? ? ? D . n D 3 138 LEU 138 330 ? ? ? D . n D 3 139 LEU 139 331 ? ? ? D . n D 3 140 ILE 140 332 ? ? ? D . n D 3 141 ALA 141 333 ? ? ? D . n D 3 142 GLU 142 334 ? ? ? D . n D 3 143 GLN 143 335 ? ? ? D . n D 3 144 LEU 144 336 ? ? ? D . n D 3 145 HIS 145 337 ? ? ? D . n D 3 146 MET 146 338 ? ? ? D . n D 3 147 GLU 147 339 ? ? ? D . n D 3 148 LYS 148 340 ? ? ? D . n D 3 149 GLU 149 341 ? ? ? D . n D 3 150 VAL 150 342 ? ? ? D . n D 3 151 ILE 151 343 ? ? ? D . n D 3 152 ARG 152 344 ? ? ? D . n D 3 153 VAL 153 345 ? ? ? D . n D 3 154 TRP 154 346 ? ? ? D . n D 3 155 PHE 155 347 ? ? ? D . n D 3 156 CYS 156 348 ? ? ? D . n D 3 157 ASN 157 349 ? ? ? D . n D 3 158 ARG 158 350 ? ? ? D . n D 3 159 ARG 159 351 ? ? ? D . n D 3 160 GLN 160 352 ? ? ? D . n D 3 161 LYS 161 353 ? ? ? D . n D 3 162 GLU 162 354 ? ? ? D . n D 3 163 LYS 163 355 ? ? ? D . n D 3 164 ARG 164 356 ? ? ? D . n D 3 165 ILE 165 357 ? ? ? D . n D 3 166 ASN 166 358 ? ? ? D . n D 3 167 PRO 167 359 ? ? ? D . n E 3 1 GLY 1 191 ? ? ? E . n E 3 2 SER 2 192 ? ? ? E . n E 3 3 HIS 3 193 ? ? ? E . n E 3 4 MET 4 194 ? ? ? E . n E 3 5 GLU 5 195 ? ? ? E . n E 3 6 GLU 6 196 ? ? ? E . n E 3 7 PRO 7 197 ? ? ? E . n E 3 8 SER 8 198 ? ? ? E . n E 3 9 ASP 9 199 ? ? ? E . n E 3 10 LEU 10 200 ? ? ? E . n E 3 11 GLU 11 201 ? ? ? E . n E 3 12 GLU 12 202 ? ? ? E . n E 3 13 LEU 13 203 ? ? ? E . n E 3 14 GLU 14 204 ? ? ? E . n E 3 15 GLN 15 205 ? ? ? E . n E 3 16 PHE 16 206 ? ? ? E . n E 3 17 ALA 17 207 ? ? ? E . n E 3 18 ARG 18 208 ? ? ? E . n E 3 19 THR 19 209 ? ? ? E . n E 3 20 PHE 20 210 ? ? ? E . n E 3 21 LYS 21 211 ? ? ? E . n E 3 22 GLN 22 212 ? ? ? E . n E 3 23 ARG 23 213 ? ? ? E . n E 3 24 ARG 24 214 ? ? ? E . n E 3 25 ILE 25 215 ? ? ? E . n E 3 26 LYS 26 216 ? ? ? E . n E 3 27 LEU 27 217 ? ? ? E . n E 3 28 GLY 28 218 ? ? ? E . n E 3 29 PHE 29 219 ? ? ? E . n E 3 30 THR 30 220 ? ? ? E . n E 3 31 GLN 31 221 ? ? ? E . n E 3 32 GLY 32 222 ? ? ? E . n E 3 33 ASP 33 223 ? ? ? E . n E 3 34 VAL 34 224 ? ? ? E . n E 3 35 GLY 35 225 ? ? ? E . n E 3 36 LEU 36 226 ? ? ? E . n E 3 37 ALA 37 227 ? ? ? E . n E 3 38 MET 38 228 ? ? ? E . n E 3 39 GLY 39 229 ? ? ? E . n E 3 40 LYS 40 230 ? ? ? E . n E 3 41 LEU 41 231 ? ? ? E . n E 3 42 TYR 42 232 ? ? ? E . n E 3 43 GLY 43 233 ? ? ? E . n E 3 44 ASN 44 234 ? ? ? E . n E 3 45 ASP 45 235 ? ? ? E . n E 3 46 PHE 46 236 ? ? ? E . n E 3 47 SER 47 237 ? ? ? E . n E 3 48 GLN 48 238 ? ? ? E . n E 3 49 THR 49 239 ? ? ? E . n E 3 50 THR 50 240 ? ? ? E . n E 3 51 ILE 51 241 ? ? ? E . n E 3 52 SER 52 242 ? ? ? E . n E 3 53 ARG 53 243 ? ? ? E . n E 3 54 PHE 54 244 ? ? ? E . n E 3 55 GLU 55 245 ? ? ? E . n E 3 56 ALA 56 246 ? ? ? E . n E 3 57 LEU 57 247 ? ? ? E . n E 3 58 ASN 58 248 ? ? ? E . n E 3 59 LEU 59 249 ? ? ? E . n E 3 60 SER 60 250 ? ? ? E . n E 3 61 PHE 61 251 ? ? ? E . n E 3 62 LYS 62 252 ? ? ? E . n E 3 63 ASN 63 253 ? ? ? E . n E 3 64 MET 64 254 ? ? ? E . n E 3 65 CYS 65 255 ? ? ? E . n E 3 66 LYS 66 256 ? ? ? E . n E 3 67 LEU 67 257 ? ? ? E . n E 3 68 LYS 68 258 ? ? ? E . n E 3 69 PRO 69 259 ? ? ? E . n E 3 70 LEU 70 260 ? ? ? E . n E 3 71 LEU 71 261 ? ? ? E . n E 3 72 GLU 72 262 ? ? ? E . n E 3 73 LYS 73 263 ? ? ? E . n E 3 74 TRP 74 264 ? ? ? E . n E 3 75 LEU 75 265 ? ? ? E . n E 3 76 ASN 76 266 ? ? ? E . n E 3 77 ASP 77 267 ? ? ? E . n E 3 78 ALA 78 268 ? ? ? E . n E 3 79 GLU 79 269 ? ? ? E . n E 3 80 THR 80 270 ? ? ? E . n E 3 81 MET 81 271 ? ? ? E . n E 3 82 SER 82 272 ? ? ? E . n E 3 83 VAL 83 273 ? ? ? E . n E 3 84 ASP 84 274 ? ? ? E . n E 3 85 SER 85 275 ? ? ? E . n E 3 86 SER 86 276 ? ? ? E . n E 3 87 LEU 87 277 ? ? ? E . n E 3 88 PRO 88 278 ? ? ? E . n E 3 89 SER 89 279 ? ? ? E . n E 3 90 PRO 90 280 ? ? ? E . n E 3 91 ASN 91 281 ? ? ? E . n E 3 92 GLN 92 282 ? ? ? E . n E 3 93 LEU 93 283 ? ? ? E . n E 3 94 SER 94 284 ? ? ? E . n E 3 95 SER 95 285 ? ? ? E . n E 3 96 PRO 96 286 ? ? ? E . n E 3 97 SER 97 287 ? ? ? E . n E 3 98 LEU 98 288 ? ? ? E . n E 3 99 GLY 99 289 ? ? ? E . n E 3 100 PHE 100 290 ? ? ? E . n E 3 101 ASP 101 291 ? ? ? E . n E 3 102 GLY 102 292 ? ? ? E . n E 3 103 LEU 103 293 ? ? ? E . n E 3 104 PRO 104 294 ? ? ? E . n E 3 105 GLY 105 295 ? ? ? E . n E 3 106 ARG 106 296 ? ? ? E . n E 3 107 ARG 107 297 ? ? ? E . n E 3 108 ARG 108 298 ? ? ? E . n E 3 109 LYS 109 299 ? ? ? E . n E 3 110 LYS 110 300 300 LYS LYS E . n E 3 111 ARG 111 301 301 ARG ARG E . n E 3 112 THR 112 302 302 THR THR E . n E 3 113 SER 113 303 303 SER SER E . n E 3 114 ILE 114 304 304 ILE ILE E . n E 3 115 GLU 115 305 305 GLU GLU E . n E 3 116 THR 116 306 306 THR THR E . n E 3 117 ASN 117 307 307 ASN ASN E . n E 3 118 VAL 118 308 308 VAL VAL E . n E 3 119 ARG 119 309 309 ARG ARG E . n E 3 120 PHE 120 310 310 PHE PHE E . n E 3 121 ALA 121 311 311 ALA ALA E . n E 3 122 LEU 122 312 312 LEU LEU E . n E 3 123 GLU 123 313 313 GLU GLU E . n E 3 124 LYS 124 314 314 LYS LYS E . n E 3 125 SER 125 315 315 SER SER E . n E 3 126 PHE 126 316 316 PHE PHE E . n E 3 127 LEU 127 317 317 LEU LEU E . n E 3 128 ALA 128 318 318 ALA ALA E . n E 3 129 ASN 129 319 319 ASN ASN E . n E 3 130 GLN 130 320 320 GLN GLN E . n E 3 131 LYS 131 321 321 LYS LYS E . n E 3 132 PRO 132 322 322 PRO PRO E . n E 3 133 THR 133 323 323 THR THR E . n E 3 134 SER 134 324 324 SER SER E . n E 3 135 GLU 135 325 325 GLU GLU E . n E 3 136 GLU 136 326 326 GLU GLU E . n E 3 137 ILE 137 327 327 ILE ILE E . n E 3 138 LEU 138 328 328 LEU LEU E . n E 3 139 LEU 139 329 329 LEU LEU E . n E 3 140 ILE 140 330 330 ILE ILE E . n E 3 141 ALA 141 331 331 ALA ALA E . n E 3 142 GLU 142 332 332 GLU GLU E . n E 3 143 GLN 143 333 333 GLN GLN E . n E 3 144 LEU 144 334 334 LEU LEU E . n E 3 145 HIS 145 335 335 HIS HIS E . n E 3 146 MET 146 336 336 MET MET E . n E 3 147 GLU 147 337 337 GLU GLU E . n E 3 148 LYS 148 338 338 LYS LYS E . n E 3 149 GLU 149 339 339 GLU GLU E . n E 3 150 VAL 150 340 340 VAL VAL E . n E 3 151 ILE 151 341 341 ILE ILE E . n E 3 152 ARG 152 342 342 ARG ARG E . n E 3 153 VAL 153 343 343 VAL VAL E . n E 3 154 TRP 154 344 344 TRP TRP E . n E 3 155 PHE 155 345 345 PHE PHE E . n E 3 156 CYS 156 346 346 CYS CYS E . n E 3 157 ASN 157 347 347 ASN ASN E . n E 3 158 ARG 158 348 348 ARG ARG E . n E 3 159 ARG 159 349 349 ARG ARG E . n E 3 160 GLN 160 350 350 GLN GLN E . n E 3 161 LYS 161 351 351 LYS LYS E . n E 3 162 GLU 162 352 352 GLU GLU E . n E 3 163 LYS 163 353 353 LYS LYS E . n E 3 164 ARG 164 354 354 ARG ARG E . n E 3 165 ILE 165 355 355 ILE ILE E . n E 3 166 ASN 166 356 356 ASN ASN E . n E 3 167 PRO 167 357 357 PRO PRO E . n F 3 1 GLY 1 191 ? ? ? F . n F 3 2 SER 2 192 ? ? ? F . n F 3 3 HIS 3 193 ? ? ? F . n F 3 4 MET 4 194 ? ? ? F . n F 3 5 GLU 5 195 ? ? ? F . n F 3 6 GLU 6 196 ? ? ? F . n F 3 7 PRO 7 197 ? ? ? F . n F 3 8 SER 8 198 ? ? ? F . n F 3 9 ASP 9 199 ? ? ? F . n F 3 10 LEU 10 200 ? ? ? F . n F 3 11 GLU 11 201 ? ? ? F . n F 3 12 GLU 12 202 ? ? ? F . n F 3 13 LEU 13 203 ? ? ? F . n F 3 14 GLU 14 204 ? ? ? F . n F 3 15 GLN 15 205 ? ? ? F . n F 3 16 PHE 16 206 ? ? ? F . n F 3 17 ALA 17 207 ? ? ? F . n F 3 18 ARG 18 208 ? ? ? F . n F 3 19 THR 19 209 ? ? ? F . n F 3 20 PHE 20 210 ? ? ? F . n F 3 21 LYS 21 211 ? ? ? F . n F 3 22 GLN 22 212 ? ? ? F . n F 3 23 ARG 23 213 ? ? ? F . n F 3 24 ARG 24 214 ? ? ? F . n F 3 25 ILE 25 215 ? ? ? F . n F 3 26 LYS 26 216 ? ? ? F . n F 3 27 LEU 27 217 ? ? ? F . n F 3 28 GLY 28 218 ? ? ? F . n F 3 29 PHE 29 219 ? ? ? F . n F 3 30 THR 30 220 ? ? ? F . n F 3 31 GLN 31 221 ? ? ? F . n F 3 32 GLY 32 222 ? ? ? F . n F 3 33 ASP 33 223 ? ? ? F . n F 3 34 VAL 34 224 ? ? ? F . n F 3 35 GLY 35 225 ? ? ? F . n F 3 36 LEU 36 226 ? ? ? F . n F 3 37 ALA 37 227 ? ? ? F . n F 3 38 MET 38 228 ? ? ? F . n F 3 39 GLY 39 229 ? ? ? F . n F 3 40 LYS 40 230 ? ? ? F . n F 3 41 LEU 41 231 ? ? ? F . n F 3 42 TYR 42 232 ? ? ? F . n F 3 43 GLY 43 233 ? ? ? F . n F 3 44 ASN 44 234 ? ? ? F . n F 3 45 ASP 45 235 ? ? ? F . n F 3 46 PHE 46 236 ? ? ? F . n F 3 47 SER 47 237 ? ? ? F . n F 3 48 GLN 48 238 ? ? ? F . n F 3 49 THR 49 239 ? ? ? F . n F 3 50 THR 50 240 ? ? ? F . n F 3 51 ILE 51 241 ? ? ? F . n F 3 52 SER 52 242 ? ? ? F . n F 3 53 ARG 53 243 ? ? ? F . n F 3 54 PHE 54 244 ? ? ? F . n F 3 55 GLU 55 245 ? ? ? F . n F 3 56 ALA 56 246 ? ? ? F . n F 3 57 LEU 57 247 ? ? ? F . n F 3 58 ASN 58 248 ? ? ? F . n F 3 59 LEU 59 249 ? ? ? F . n F 3 60 SER 60 250 ? ? ? F . n F 3 61 PHE 61 251 ? ? ? F . n F 3 62 LYS 62 252 ? ? ? F . n F 3 63 ASN 63 253 ? ? ? F . n F 3 64 MET 64 254 ? ? ? F . n F 3 65 CYS 65 255 ? ? ? F . n F 3 66 LYS 66 256 ? ? ? F . n F 3 67 LEU 67 257 ? ? ? F . n F 3 68 LYS 68 258 ? ? ? F . n F 3 69 PRO 69 259 ? ? ? F . n F 3 70 LEU 70 260 ? ? ? F . n F 3 71 LEU 71 261 ? ? ? F . n F 3 72 GLU 72 262 ? ? ? F . n F 3 73 LYS 73 263 ? ? ? F . n F 3 74 TRP 74 264 ? ? ? F . n F 3 75 LEU 75 265 ? ? ? F . n F 3 76 ASN 76 266 ? ? ? F . n F 3 77 ASP 77 267 ? ? ? F . n F 3 78 ALA 78 268 ? ? ? F . n F 3 79 GLU 79 269 ? ? ? F . n F 3 80 THR 80 270 ? ? ? F . n F 3 81 MET 81 271 ? ? ? F . n F 3 82 SER 82 272 ? ? ? F . n F 3 83 VAL 83 273 ? ? ? F . n F 3 84 ASP 84 274 ? ? ? F . n F 3 85 SER 85 275 ? ? ? F . n F 3 86 SER 86 276 ? ? ? F . n F 3 87 LEU 87 277 ? ? ? F . n F 3 88 PRO 88 278 ? ? ? F . n F 3 89 SER 89 279 ? ? ? F . n F 3 90 PRO 90 280 ? ? ? F . n F 3 91 ASN 91 281 ? ? ? F . n F 3 92 GLN 92 282 ? ? ? F . n F 3 93 LEU 93 283 ? ? ? F . n F 3 94 SER 94 284 ? ? ? F . n F 3 95 SER 95 285 ? ? ? F . n F 3 96 PRO 96 286 ? ? ? F . n F 3 97 SER 97 287 ? ? ? F . n F 3 98 LEU 98 288 ? ? ? F . n F 3 99 GLY 99 289 ? ? ? F . n F 3 100 PHE 100 290 ? ? ? F . n F 3 101 ASP 101 291 ? ? ? F . n F 3 102 GLY 102 292 ? ? ? F . n F 3 103 LEU 103 293 ? ? ? F . n F 3 104 PRO 104 294 ? ? ? F . n F 3 105 GLY 105 295 ? ? ? F . n F 3 106 ARG 106 296 ? ? ? F . n F 3 107 ARG 107 297 ? ? ? F . n F 3 108 ARG 108 298 ? ? ? F . n F 3 109 LYS 109 299 ? ? ? F . n F 3 110 LYS 110 300 300 LYS LYS F . n F 3 111 ARG 111 301 301 ARG ARG F . n F 3 112 THR 112 302 302 THR THR F . n F 3 113 SER 113 303 303 SER SER F . n F 3 114 ILE 114 304 304 ILE ILE F . n F 3 115 GLU 115 305 305 GLU GLU F . n F 3 116 THR 116 306 306 THR THR F . n F 3 117 ASN 117 307 307 ASN ASN F . n F 3 118 VAL 118 308 308 VAL VAL F . n F 3 119 ARG 119 309 309 ARG ARG F . n F 3 120 PHE 120 310 310 PHE PHE F . n F 3 121 ALA 121 311 311 ALA ALA F . n F 3 122 LEU 122 312 312 LEU LEU F . n F 3 123 GLU 123 313 313 GLU GLU F . n F 3 124 LYS 124 314 314 LYS LYS F . n F 3 125 SER 125 315 315 SER SER F . n F 3 126 PHE 126 316 316 PHE PHE F . n F 3 127 LEU 127 317 317 LEU LEU F . n F 3 128 ALA 128 318 318 ALA ALA F . n F 3 129 ASN 129 319 319 ASN ASN F . n F 3 130 GLN 130 320 320 GLN GLN F . n F 3 131 LYS 131 321 321 LYS LYS F . n F 3 132 PRO 132 322 322 PRO PRO F . n F 3 133 THR 133 323 323 THR THR F . n F 3 134 SER 134 324 324 SER SER F . n F 3 135 GLU 135 325 325 GLU GLU F . n F 3 136 GLU 136 326 326 GLU GLU F . n F 3 137 ILE 137 327 327 ILE ILE F . n F 3 138 LEU 138 328 328 LEU LEU F . n F 3 139 LEU 139 329 329 LEU LEU F . n F 3 140 ILE 140 330 330 ILE ILE F . n F 3 141 ALA 141 331 331 ALA ALA F . n F 3 142 GLU 142 332 332 GLU GLU F . n F 3 143 GLN 143 333 333 GLN GLN F . n F 3 144 LEU 144 334 334 LEU LEU F . n F 3 145 HIS 145 335 335 HIS HIS F . n F 3 146 MET 146 336 336 MET MET F . n F 3 147 GLU 147 337 337 GLU GLU F . n F 3 148 LYS 148 338 338 LYS LYS F . n F 3 149 GLU 149 339 339 GLU GLU F . n F 3 150 VAL 150 340 340 VAL VAL F . n F 3 151 ILE 151 341 341 ILE ILE F . n F 3 152 ARG 152 342 342 ARG ARG F . n F 3 153 VAL 153 343 343 VAL VAL F . n F 3 154 TRP 154 344 344 TRP TRP F . n F 3 155 PHE 155 345 345 PHE PHE F . n F 3 156 CYS 156 346 346 CYS CYS F . n F 3 157 ASN 157 347 347 ASN ASN F . n F 3 158 ARG 158 348 348 ARG ARG F . n F 3 159 ARG 159 349 349 ARG ARG F . n F 3 160 GLN 160 350 350 GLN GLN F . n F 3 161 LYS 161 351 351 LYS LYS F . n F 3 162 GLU 162 352 352 GLU GLU F . n F 3 163 LYS 163 353 353 LYS LYS F . n F 3 164 ARG 164 354 354 ARG ARG F . n F 3 165 ILE 165 355 355 ILE ILE F . n F 3 166 ASN 166 356 356 ASN ASN F . n F 3 167 PRO 167 357 357 PRO PRO F . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code G 4 BR 1 401 1 BR BR E . H 5 HOH 1 301 20 HOH HOH A . H 5 HOH 2 302 27 HOH HOH A . H 5 HOH 3 303 22 HOH HOH A . H 5 HOH 4 304 15 HOH HOH A . H 5 HOH 5 305 30 HOH HOH A . H 5 HOH 6 306 32 HOH HOH A . I 5 HOH 1 301 9 HOH HOH B . I 5 HOH 2 302 19 HOH HOH B . I 5 HOH 3 303 3 HOH HOH B . I 5 HOH 4 304 12 HOH HOH B . I 5 HOH 5 305 33 HOH HOH B . I 5 HOH 6 306 2 HOH HOH B . I 5 HOH 7 307 17 HOH HOH B . J 5 HOH 1 401 4 HOH HOH C . J 5 HOH 2 402 5 HOH HOH C . J 5 HOH 3 403 24 HOH HOH C . J 5 HOH 4 404 10 HOH HOH C . J 5 HOH 5 405 6 HOH HOH C . J 5 HOH 6 406 16 HOH HOH C . J 5 HOH 7 407 26 HOH HOH C . J 5 HOH 8 408 11 HOH HOH C . J 5 HOH 9 409 21 HOH HOH C . J 5 HOH 10 410 25 HOH HOH C . J 5 HOH 11 411 13 HOH HOH C . K 5 HOH 1 401 1 HOH HOH D . K 5 HOH 2 402 7 HOH HOH D . K 5 HOH 3 403 18 HOH HOH D . K 5 HOH 4 404 29 HOH HOH D . K 5 HOH 5 405 14 HOH HOH D . K 5 HOH 6 406 34 HOH HOH D . K 5 HOH 7 407 28 HOH HOH D . L 5 HOH 1 501 31 HOH HOH E . L 5 HOH 2 502 35 HOH HOH E . M 5 HOH 1 401 23 HOH HOH F . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 C LYS 218 ? CG ? C LYS 26 CG 2 1 Y 1 C LYS 218 ? CD ? C LYS 26 CD 3 1 Y 1 C LYS 218 ? CE ? C LYS 26 CE 4 1 Y 1 C LYS 218 ? NZ ? C LYS 26 NZ 5 1 Y 1 D GLU 203 ? CG ? D GLU 11 CG 6 1 Y 1 D GLU 203 ? CD ? D GLU 11 CD 7 1 Y 1 D GLU 203 ? OE1 ? D GLU 11 OE1 8 1 Y 1 D GLU 203 ? OE2 ? D GLU 11 OE2 9 1 Y 1 D GLU 204 ? CG ? D GLU 12 CG 10 1 Y 1 D GLU 204 ? CD ? D GLU 12 CD 11 1 Y 1 D GLU 204 ? OE1 ? D GLU 12 OE1 12 1 Y 1 D GLU 204 ? OE2 ? D GLU 12 OE2 13 1 Y 1 E LYS 300 ? CG ? E LYS 110 CG 14 1 Y 1 E LYS 300 ? CD ? E LYS 110 CD 15 1 Y 1 E LYS 300 ? CE ? E LYS 110 CE 16 1 Y 1 E LYS 300 ? NZ ? E LYS 110 NZ 17 1 Y 1 E LYS 314 ? CG ? E LYS 124 CG 18 1 Y 1 E LYS 314 ? CD ? E LYS 124 CD 19 1 Y 1 E LYS 314 ? CE ? E LYS 124 CE 20 1 Y 1 E LYS 314 ? NZ ? E LYS 124 NZ 21 1 Y 1 E GLU 332 ? CG ? E GLU 142 CG 22 1 Y 1 E GLU 332 ? CD ? E GLU 142 CD 23 1 Y 1 E GLU 332 ? OE1 ? E GLU 142 OE1 24 1 Y 1 E GLU 332 ? OE2 ? E GLU 142 OE2 25 1 Y 1 F LYS 300 ? CG ? F LYS 110 CG 26 1 Y 1 F LYS 300 ? CD ? F LYS 110 CD 27 1 Y 1 F LYS 300 ? CE ? F LYS 110 CE 28 1 Y 1 F LYS 300 ? NZ ? F LYS 110 NZ 29 1 Y 1 F ARG 309 ? CG ? F ARG 119 CG 30 1 Y 1 F ARG 309 ? CD ? F ARG 119 CD 31 1 Y 1 F ARG 309 ? NE ? F ARG 119 NE 32 1 Y 1 F ARG 309 ? CZ ? F ARG 119 CZ 33 1 Y 1 F ARG 309 ? NH1 ? F ARG 119 NH1 34 1 Y 1 F ARG 309 ? NH2 ? F ARG 119 NH2 35 1 Y 1 F LYS 314 ? CG ? F LYS 124 CG 36 1 Y 1 F LYS 314 ? CD ? F LYS 124 CD 37 1 Y 1 F LYS 314 ? CE ? F LYS 124 CE 38 1 Y 1 F LYS 314 ? NZ ? F LYS 124 NZ 39 1 Y 1 F GLU 325 ? CG ? F GLU 135 CG 40 1 Y 1 F GLU 325 ? CD ? F GLU 135 CD 41 1 Y 1 F GLU 325 ? OE1 ? F GLU 135 OE1 42 1 Y 1 F GLU 325 ? OE2 ? F GLU 135 OE2 43 1 Y 1 F GLU 332 ? CG ? F GLU 142 CG 44 1 Y 1 F GLU 332 ? CD ? F GLU 142 CD 45 1 Y 1 F GLU 332 ? OE1 ? F GLU 142 OE1 46 1 Y 1 F GLU 332 ? OE2 ? F GLU 142 OE2 47 1 Y 1 F HIS 335 ? CG ? F HIS 145 CG 48 1 Y 1 F HIS 335 ? ND1 ? F HIS 145 ND1 49 1 Y 1 F HIS 335 ? CD2 ? F HIS 145 CD2 50 1 Y 1 F HIS 335 ? CE1 ? F HIS 145 CE1 51 1 Y 1 F HIS 335 ? NE2 ? F HIS 145 NE2 52 1 Y 1 F LYS 338 ? CG ? F LYS 148 CG 53 1 Y 1 F LYS 338 ? CD ? F LYS 148 CD 54 1 Y 1 F LYS 338 ? CE ? F LYS 148 CE 55 1 Y 1 F LYS 338 ? NZ ? F LYS 148 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 82.373 _cell.angle_alpha_esd ? _cell.angle_beta 79.657 _cell.angle_beta_esd ? _cell.angle_gamma 71.769 _cell.angle_gamma_esd ? _cell.entry_id 9DZM _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.029 _cell.length_a_esd ? _cell.length_b 54.922 _cell.length_b_esd ? _cell.length_c 69.164 _cell.length_c_esd ? _cell.volume 134523.225 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9DZM _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall 'P 1' _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9DZM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '150 mM KBr, 27.5% PEG MME 2000 mixed 1:1 with 200 uM DNA:protein complex' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 295 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-07-20 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'vertical DCM' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.920105 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.920105 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 51.55 _reflns.entry_id 9DZM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.54 _reflns.d_resolution_low 33.91 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16395 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.45 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.37 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.08414 _reflns.pdbx_Rpim_I_all 0.0564 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.06205 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.54 _reflns_shell.d_res_low 2.631 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.03 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1603 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.0 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.544 _reflns_shell.pdbx_Rpim_I_all 0.3637 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.87 _reflns_shell.pdbx_CC_star 0.965 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 95.19 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.4024 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 66.93 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9DZM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.54 _refine.ls_d_res_low 33.91 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16380 _refine.ls_number_reflns_R_free 1640 _refine.ls_number_reflns_R_work 14740 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.47 _refine.ls_percent_reflns_R_free 10.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2197 _refine.ls_R_factor_R_free 0.2418 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2172 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.7684 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3803 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.54 _refine_hist.d_res_low 33.91 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 3119 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2209 _refine_hist.pdbx_number_atoms_nucleic_acid 875 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0051 ? 3231 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8859 ? 4533 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0443 ? 508 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0055 ? 434 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 23.2254 ? 1285 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.54 2.61 . . 133 1194 95.13 . . . . 0.3654 . . . . . . . . . . . 0.3615 'X-RAY DIFFRACTION' 2.61 2.70 . . 137 1236 95.21 . . . . 0.3333 . . . . . . . . . . . 0.3813 'X-RAY DIFFRACTION' 2.70 2.80 . . 135 1214 95.13 . . . . 0.2772 . . . . . . . . . . . 0.3180 'X-RAY DIFFRACTION' 2.80 2.91 . . 137 1238 94.31 . . . . 0.2703 . . . . . . . . . . . 0.3020 'X-RAY DIFFRACTION' 2.91 3.04 . . 138 1236 96.76 . . . . 0.2593 . . . . . . . . . . . 0.3277 'X-RAY DIFFRACTION' 3.04 3.20 . . 137 1237 95.88 . . . . 0.2770 . . . . . . . . . . . 0.3039 'X-RAY DIFFRACTION' 3.20 3.40 . . 138 1229 95.73 . . . . 0.2267 . . . . . . . . . . . 0.2357 'X-RAY DIFFRACTION' 3.40 3.66 . . 135 1212 95.33 . . . . 0.2044 . . . . . . . . . . . 0.2577 'X-RAY DIFFRACTION' 3.66 4.03 . . 140 1260 95.89 . . . . 0.2001 . . . . . . . . . . . 0.2176 'X-RAY DIFFRACTION' 4.03 4.61 . . 136 1220 95.49 . . . . 0.1830 . . . . . . . . . . . 0.2023 'X-RAY DIFFRACTION' 4.61 5.80 . . 136 1232 95.73 . . . . 0.1907 . . . . . . . . . . . 0.1960 'X-RAY DIFFRACTION' 5.81 33.91 . . 138 1232 95.21 . . . . 0.1819 . . . . . . . . . . . 0.2135 # _struct.entry_id 9DZM _struct.title 'Dimeric human OCT2 (POU2F2) POU domain bound to palindromic MORE DNA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9DZM _struct_keywords.text 'transcription factor, protein-DNA complex, TRANSCRIPTION-DNA complex, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION/DNA # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 5 ? I N N 5 ? J N N 5 ? K N N 5 ? L N N 5 ? M N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 9DZM 9DZM ? 1 ? 1 2 PDB 9DZM 9DZM ? 2 ? 1 3 UNP PO2F2_HUMAN P09086 ? 3 ;EEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVD SSLPSPNQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKR INP ; 195 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9DZM A 1 ? 21 ? 9DZM 201 ? 221 ? 201 221 2 2 9DZM B 1 ? 22 ? 9DZM 201 ? 222 ? 201 222 3 3 9DZM C 5 ? 167 ? P09086 195 ? 357 ? 197 359 4 3 9DZM D 5 ? 167 ? P09086 195 ? 357 ? 197 359 5 3 9DZM E 5 ? 167 ? P09086 195 ? 357 ? 195 357 6 3 9DZM F 5 ? 167 ? P09086 195 ? 357 ? 195 357 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 3 9DZM GLY C 1 ? UNP P09086 ? ? 'expression tag' 193 1 3 9DZM SER C 2 ? UNP P09086 ? ? 'expression tag' 194 2 3 9DZM HIS C 3 ? UNP P09086 ? ? 'expression tag' 195 3 3 9DZM MET C 4 ? UNP P09086 ? ? 'expression tag' 196 4 4 9DZM GLY D 1 ? UNP P09086 ? ? 'expression tag' 193 5 4 9DZM SER D 2 ? UNP P09086 ? ? 'expression tag' 194 6 4 9DZM HIS D 3 ? UNP P09086 ? ? 'expression tag' 195 7 4 9DZM MET D 4 ? UNP P09086 ? ? 'expression tag' 196 8 5 9DZM GLY E 1 ? UNP P09086 ? ? 'expression tag' 191 9 5 9DZM SER E 2 ? UNP P09086 ? ? 'expression tag' 192 10 5 9DZM HIS E 3 ? UNP P09086 ? ? 'expression tag' 193 11 5 9DZM MET E 4 ? UNP P09086 ? ? 'expression tag' 194 12 6 9DZM GLY F 1 ? UNP P09086 ? ? 'expression tag' 191 13 6 9DZM SER F 2 ? UNP P09086 ? ? 'expression tag' 192 14 6 9DZM HIS F 3 ? UNP P09086 ? ? 'expression tag' 193 15 6 9DZM MET F 4 ? UNP P09086 ? ? 'expression tag' 194 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9440 ? 1 MORE -48 ? 1 'SSA (A^2)' 20120 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU C 6 ? LEU C 27 ? GLU C 198 LEU C 219 1 ? 22 HELX_P HELX_P2 AA2 THR C 30 ? GLY C 43 ? THR C 222 GLY C 235 1 ? 14 HELX_P HELX_P3 AA3 SER C 47 ? LEU C 57 ? SER C 239 LEU C 249 1 ? 11 HELX_P HELX_P4 AA4 SER C 60 ? SER C 85 ? SER C 252 SER C 277 1 ? 26 HELX_P HELX_P5 AA5 ASP D 9 ? LEU D 27 ? ASP D 201 LEU D 219 1 ? 19 HELX_P HELX_P6 AA6 THR D 30 ? GLY D 43 ? THR D 222 GLY D 235 1 ? 14 HELX_P HELX_P7 AA7 SER D 47 ? LEU D 57 ? SER D 239 LEU D 249 1 ? 11 HELX_P HELX_P8 AA8 SER D 60 ? THR D 80 ? SER D 252 THR D 272 1 ? 21 HELX_P HELX_P9 AA9 GLU E 115 ? ASN E 129 ? GLU E 305 ASN E 319 1 ? 15 HELX_P HELX_P10 AB1 THR E 133 ? HIS E 145 ? THR E 323 HIS E 335 1 ? 13 HELX_P HELX_P11 AB2 GLU E 147 ? LYS E 163 ? GLU E 337 LYS E 353 1 ? 17 HELX_P HELX_P12 AB3 THR F 116 ? ASN F 129 ? THR F 306 ASN F 319 1 ? 14 HELX_P HELX_P13 AB4 THR F 133 ? HIS F 145 ? THR F 323 HIS F 335 1 ? 13 HELX_P HELX_P14 AB5 GLU F 147 ? LYS F 163 ? GLU F 337 LYS F 353 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role hydrog1 hydrog ? ? A DT 1 N3 ? ? ? 1_555 B DA 22 N1 ? ? A DT 201 B DA 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog2 hydrog ? ? A DT 1 O4 ? ? ? 1_555 B DA 22 N6 ? ? A DT 201 B DA 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog3 hydrog ? ? A DC 2 N3 ? ? ? 1_555 B DG 21 N1 ? ? A DC 202 B DG 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog4 hydrog ? ? A DC 2 N4 ? ? ? 1_555 B DG 21 O6 ? ? A DC 202 B DG 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog5 hydrog ? ? A DC 2 O2 ? ? ? 1_555 B DG 21 N2 ? ? A DC 202 B DG 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? A DC 3 N3 ? ? ? 1_555 B DG 20 N1 ? ? A DC 203 B DG 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog7 hydrog ? ? A DC 3 N4 ? ? ? 1_555 B DG 20 O6 ? ? A DC 203 B DG 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog8 hydrog ? ? A DC 3 O2 ? ? ? 1_555 B DG 20 N2 ? ? A DC 203 B DG 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog9 hydrog ? ? A DT 4 N3 ? ? ? 1_555 B DA 19 N1 ? ? A DT 204 B DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog10 hydrog ? ? A DT 4 O4 ? ? ? 1_555 B DA 19 N6 ? ? A DT 204 B DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog11 hydrog ? ? A DC 5 N3 ? ? ? 1_555 B DG 18 N2 ? ? A DC 205 B DG 218 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? hydrog12 hydrog ? ? A DC 5 O2 ? ? ? 1_555 B DG 18 N1 ? ? A DC 205 B DG 218 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? ? hydrog13 hydrog ? ? A DA 6 N1 ? ? ? 1_555 B DT 17 N3 ? ? A DA 206 B DT 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog14 hydrog ? ? A DA 6 N6 ? ? ? 1_555 B DT 17 O4 ? ? A DA 206 B DT 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog15 hydrog ? ? A DT 7 N3 ? ? ? 1_555 B DA 16 N1 ? ? A DT 207 B DA 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog16 hydrog ? ? A DT 7 O4 ? ? ? 1_555 B DA 16 N6 ? ? A DT 207 B DA 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog17 hydrog ? ? A DG 8 N1 ? ? ? 1_555 B DC 15 N3 ? ? A DG 208 B DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog18 hydrog ? ? A DG 8 N2 ? ? ? 1_555 B DC 15 O2 ? ? A DG 208 B DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog19 hydrog ? ? A DG 8 O6 ? ? ? 1_555 B DC 15 N4 ? ? A DG 208 B DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog20 hydrog ? ? A DC 9 N3 ? ? ? 1_555 B DG 14 N1 ? ? A DC 209 B DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog21 hydrog ? ? A DC 9 N4 ? ? ? 1_555 B DG 14 O6 ? ? A DC 209 B DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog22 hydrog ? ? A DC 9 O2 ? ? ? 1_555 B DG 14 N2 ? ? A DC 209 B DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog23 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 13 N3 ? ? A DA 210 B DT 213 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog24 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 13 O4 ? ? A DA 210 B DT 213 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog25 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 12 N1 ? ? A DT 211 B DA 212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog26 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 12 N6 ? ? A DT 211 B DA 212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog27 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 11 N3 ? ? A DA 212 B DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog28 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 11 O4 ? ? A DA 212 B DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog29 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 10 N1 ? ? A DT 213 B DA 210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog30 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 10 N6 ? ? A DT 213 B DA 210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog31 hydrog ? ? A DG 14 N1 ? ? ? 1_555 B DC 9 N3 ? ? A DG 214 B DC 209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog32 hydrog ? ? A DG 14 N2 ? ? ? 1_555 B DC 9 O2 ? ? A DG 214 B DC 209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog33 hydrog ? ? A DG 14 O6 ? ? ? 1_555 B DC 9 N4 ? ? A DG 214 B DC 209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog34 hydrog ? ? A DC 15 N3 ? ? ? 1_555 B DG 8 N1 ? ? A DC 215 B DG 208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog35 hydrog ? ? A DC 15 N4 ? ? ? 1_555 B DG 8 O6 ? ? A DC 215 B DG 208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog36 hydrog ? ? A DC 15 O2 ? ? ? 1_555 B DG 8 N2 ? ? A DC 215 B DG 208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog37 hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT 7 N3 ? ? A DA 216 B DT 207 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog38 hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DT 7 O4 ? ? A DA 216 B DT 207 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog39 hydrog ? ? A DT 17 N3 ? ? ? 1_555 B DA 6 N1 ? ? A DT 217 B DA 206 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog40 hydrog ? ? A DT 17 O4 ? ? ? 1_555 B DA 6 N6 ? ? A DT 217 B DA 206 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog41 hydrog ? ? A DG 18 N1 ? ? ? 1_555 B DC 5 N3 ? ? A DG 218 B DC 205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog42 hydrog ? ? A DG 18 N2 ? ? ? 1_555 B DC 5 O2 ? ? A DG 218 B DC 205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog43 hydrog ? ? A DG 18 O6 ? ? ? 1_555 B DC 5 N4 ? ? A DG 218 B DC 205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog44 hydrog ? ? A DA 19 N1 ? ? ? 1_555 B DT 4 N3 ? ? A DA 219 B DT 204 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog45 hydrog ? ? A DA 19 N6 ? ? ? 1_555 B DT 4 O4 ? ? A DA 219 B DT 204 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog46 hydrog ? ? A DG 20 N1 ? ? ? 1_555 B DC 3 N3 ? ? A DG 220 B DC 203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog47 hydrog ? ? A DG 20 N2 ? ? ? 1_555 B DC 3 O2 ? ? A DG 220 B DC 203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog48 hydrog ? ? A DG 20 O6 ? ? ? 1_555 B DC 3 N4 ? ? A DG 220 B DC 203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog49 hydrog ? ? A DG 21 N1 ? ? ? 1_555 B DC 2 N3 ? ? A DG 221 B DC 202 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog50 hydrog ? ? A DG 21 N2 ? ? ? 1_555 B DC 2 O2 ? ? A DG 221 B DC 202 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog51 hydrog ? ? A DG 21 O6 ? ? ? 1_555 B DC 2 N4 ? ? A DG 221 B DC 202 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog52 hydrog ? ? B DT 1 O2 ? ? ? 1_555 B DC 3 N4 ? ? B DT 201 B DC 203 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? ? # _struct_conn_type.id hydrog _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_entry_details.entry_id 9DZM _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 DC _pdbx_validate_close_contact.auth_seq_id_1 205 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 N2 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 DG _pdbx_validate_close_contact.auth_seq_id_2 218 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 "O4'" _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 DC _pdbx_validate_rmsd_angle.auth_seq_id_1 202 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 "C1'" _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 DC _pdbx_validate_rmsd_angle.auth_seq_id_2 202 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 N1 _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 DC _pdbx_validate_rmsd_angle.auth_seq_id_3 202 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 111.95 _pdbx_validate_rmsd_angle.angle_target_value 108.30 _pdbx_validate_rmsd_angle.angle_deviation 3.65 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN C 250 ? ? -85.52 48.67 2 1 ASP D 201 ? ? 95.44 -40.23 3 1 ASN D 250 ? ? -89.12 38.66 4 1 GLU F 305 ? ? -49.42 -73.39 5 1 THR F 306 ? ? 169.32 -52.59 6 1 LEU F 334 ? ? -85.59 -73.76 7 1 HIS F 335 ? ? 151.47 -28.54 8 1 ASN F 356 ? ? -91.43 -71.79 # _space_group_symop.id 1 _space_group_symop.operation_xyz x,y,z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C GLY 193 ? C GLY 1 2 1 Y 1 C SER 194 ? C SER 2 3 1 Y 1 C HIS 195 ? C HIS 3 4 1 Y 1 C MET 196 ? C MET 4 5 1 Y 1 C SER 278 ? C SER 86 6 1 Y 1 C LEU 279 ? C LEU 87 7 1 Y 1 C PRO 280 ? C PRO 88 8 1 Y 1 C SER 281 ? C SER 89 9 1 Y 1 C PRO 282 ? C PRO 90 10 1 Y 1 C ASN 283 ? C ASN 91 11 1 Y 1 C GLN 284 ? C GLN 92 12 1 Y 1 C LEU 285 ? C LEU 93 13 1 Y 1 C SER 286 ? C SER 94 14 1 Y 1 C SER 287 ? C SER 95 15 1 Y 1 C PRO 288 ? C PRO 96 16 1 Y 1 C SER 289 ? C SER 97 17 1 Y 1 C LEU 290 ? C LEU 98 18 1 Y 1 C GLY 291 ? C GLY 99 19 1 Y 1 C PHE 292 ? C PHE 100 20 1 Y 1 C ASP 293 ? C ASP 101 21 1 Y 1 C GLY 294 ? C GLY 102 22 1 Y 1 C LEU 295 ? C LEU 103 23 1 Y 1 C PRO 296 ? C PRO 104 24 1 Y 1 C GLY 297 ? C GLY 105 25 1 Y 1 C ARG 298 ? C ARG 106 26 1 Y 1 C ARG 299 ? C ARG 107 27 1 Y 1 C ARG 300 ? C ARG 108 28 1 Y 1 C LYS 301 ? C LYS 109 29 1 Y 1 C LYS 302 ? C LYS 110 30 1 Y 1 C ARG 303 ? C ARG 111 31 1 Y 1 C THR 304 ? C THR 112 32 1 Y 1 C SER 305 ? C SER 113 33 1 Y 1 C ILE 306 ? C ILE 114 34 1 Y 1 C GLU 307 ? C GLU 115 35 1 Y 1 C THR 308 ? C THR 116 36 1 Y 1 C ASN 309 ? C ASN 117 37 1 Y 1 C VAL 310 ? C VAL 118 38 1 Y 1 C ARG 311 ? C ARG 119 39 1 Y 1 C PHE 312 ? C PHE 120 40 1 Y 1 C ALA 313 ? C ALA 121 41 1 Y 1 C LEU 314 ? C LEU 122 42 1 Y 1 C GLU 315 ? C GLU 123 43 1 Y 1 C LYS 316 ? C LYS 124 44 1 Y 1 C SER 317 ? C SER 125 45 1 Y 1 C PHE 318 ? C PHE 126 46 1 Y 1 C LEU 319 ? C LEU 127 47 1 Y 1 C ALA 320 ? C ALA 128 48 1 Y 1 C ASN 321 ? C ASN 129 49 1 Y 1 C GLN 322 ? C GLN 130 50 1 Y 1 C LYS 323 ? C LYS 131 51 1 Y 1 C PRO 324 ? C PRO 132 52 1 Y 1 C THR 325 ? C THR 133 53 1 Y 1 C SER 326 ? C SER 134 54 1 Y 1 C GLU 327 ? C GLU 135 55 1 Y 1 C GLU 328 ? C GLU 136 56 1 Y 1 C ILE 329 ? C ILE 137 57 1 Y 1 C LEU 330 ? C LEU 138 58 1 Y 1 C LEU 331 ? C LEU 139 59 1 Y 1 C ILE 332 ? C ILE 140 60 1 Y 1 C ALA 333 ? C ALA 141 61 1 Y 1 C GLU 334 ? C GLU 142 62 1 Y 1 C GLN 335 ? C GLN 143 63 1 Y 1 C LEU 336 ? C LEU 144 64 1 Y 1 C HIS 337 ? C HIS 145 65 1 Y 1 C MET 338 ? C MET 146 66 1 Y 1 C GLU 339 ? C GLU 147 67 1 Y 1 C LYS 340 ? C LYS 148 68 1 Y 1 C GLU 341 ? C GLU 149 69 1 Y 1 C VAL 342 ? C VAL 150 70 1 Y 1 C ILE 343 ? C ILE 151 71 1 Y 1 C ARG 344 ? C ARG 152 72 1 Y 1 C VAL 345 ? C VAL 153 73 1 Y 1 C TRP 346 ? C TRP 154 74 1 Y 1 C PHE 347 ? C PHE 155 75 1 Y 1 C CYS 348 ? C CYS 156 76 1 Y 1 C ASN 349 ? C ASN 157 77 1 Y 1 C ARG 350 ? C ARG 158 78 1 Y 1 C ARG 351 ? C ARG 159 79 1 Y 1 C GLN 352 ? C GLN 160 80 1 Y 1 C LYS 353 ? C LYS 161 81 1 Y 1 C GLU 354 ? C GLU 162 82 1 Y 1 C LYS 355 ? C LYS 163 83 1 Y 1 C ARG 356 ? C ARG 164 84 1 Y 1 C ILE 357 ? C ILE 165 85 1 Y 1 C ASN 358 ? C ASN 166 86 1 Y 1 C PRO 359 ? C PRO 167 87 1 Y 1 D GLY 193 ? D GLY 1 88 1 Y 1 D SER 194 ? D SER 2 89 1 Y 1 D HIS 195 ? D HIS 3 90 1 Y 1 D MET 196 ? D MET 4 91 1 Y 1 D GLU 197 ? D GLU 5 92 1 Y 1 D GLU 198 ? D GLU 6 93 1 Y 1 D SER 277 ? D SER 85 94 1 Y 1 D SER 278 ? D SER 86 95 1 Y 1 D LEU 279 ? D LEU 87 96 1 Y 1 D PRO 280 ? D PRO 88 97 1 Y 1 D SER 281 ? D SER 89 98 1 Y 1 D PRO 282 ? D PRO 90 99 1 Y 1 D ASN 283 ? D ASN 91 100 1 Y 1 D GLN 284 ? D GLN 92 101 1 Y 1 D LEU 285 ? D LEU 93 102 1 Y 1 D SER 286 ? D SER 94 103 1 Y 1 D SER 287 ? D SER 95 104 1 Y 1 D PRO 288 ? D PRO 96 105 1 Y 1 D SER 289 ? D SER 97 106 1 Y 1 D LEU 290 ? D LEU 98 107 1 Y 1 D GLY 291 ? D GLY 99 108 1 Y 1 D PHE 292 ? D PHE 100 109 1 Y 1 D ASP 293 ? D ASP 101 110 1 Y 1 D GLY 294 ? D GLY 102 111 1 Y 1 D LEU 295 ? D LEU 103 112 1 Y 1 D PRO 296 ? D PRO 104 113 1 Y 1 D GLY 297 ? D GLY 105 114 1 Y 1 D ARG 298 ? D ARG 106 115 1 Y 1 D ARG 299 ? D ARG 107 116 1 Y 1 D ARG 300 ? D ARG 108 117 1 Y 1 D LYS 301 ? D LYS 109 118 1 Y 1 D LYS 302 ? D LYS 110 119 1 Y 1 D ARG 303 ? D ARG 111 120 1 Y 1 D THR 304 ? D THR 112 121 1 Y 1 D SER 305 ? D SER 113 122 1 Y 1 D ILE 306 ? D ILE 114 123 1 Y 1 D GLU 307 ? D GLU 115 124 1 Y 1 D THR 308 ? D THR 116 125 1 Y 1 D ASN 309 ? D ASN 117 126 1 Y 1 D VAL 310 ? D VAL 118 127 1 Y 1 D ARG 311 ? D ARG 119 128 1 Y 1 D PHE 312 ? D PHE 120 129 1 Y 1 D ALA 313 ? D ALA 121 130 1 Y 1 D LEU 314 ? D LEU 122 131 1 Y 1 D GLU 315 ? D GLU 123 132 1 Y 1 D LYS 316 ? D LYS 124 133 1 Y 1 D SER 317 ? D SER 125 134 1 Y 1 D PHE 318 ? D PHE 126 135 1 Y 1 D LEU 319 ? D LEU 127 136 1 Y 1 D ALA 320 ? D ALA 128 137 1 Y 1 D ASN 321 ? D ASN 129 138 1 Y 1 D GLN 322 ? D GLN 130 139 1 Y 1 D LYS 323 ? D LYS 131 140 1 Y 1 D PRO 324 ? D PRO 132 141 1 Y 1 D THR 325 ? D THR 133 142 1 Y 1 D SER 326 ? D SER 134 143 1 Y 1 D GLU 327 ? D GLU 135 144 1 Y 1 D GLU 328 ? D GLU 136 145 1 Y 1 D ILE 329 ? D ILE 137 146 1 Y 1 D LEU 330 ? D LEU 138 147 1 Y 1 D LEU 331 ? D LEU 139 148 1 Y 1 D ILE 332 ? D ILE 140 149 1 Y 1 D ALA 333 ? D ALA 141 150 1 Y 1 D GLU 334 ? D GLU 142 151 1 Y 1 D GLN 335 ? D GLN 143 152 1 Y 1 D LEU 336 ? D LEU 144 153 1 Y 1 D HIS 337 ? D HIS 145 154 1 Y 1 D MET 338 ? D MET 146 155 1 Y 1 D GLU 339 ? D GLU 147 156 1 Y 1 D LYS 340 ? D LYS 148 157 1 Y 1 D GLU 341 ? D GLU 149 158 1 Y 1 D VAL 342 ? D VAL 150 159 1 Y 1 D ILE 343 ? D ILE 151 160 1 Y 1 D ARG 344 ? D ARG 152 161 1 Y 1 D VAL 345 ? D VAL 153 162 1 Y 1 D TRP 346 ? D TRP 154 163 1 Y 1 D PHE 347 ? D PHE 155 164 1 Y 1 D CYS 348 ? D CYS 156 165 1 Y 1 D ASN 349 ? D ASN 157 166 1 Y 1 D ARG 350 ? D ARG 158 167 1 Y 1 D ARG 351 ? D ARG 159 168 1 Y 1 D GLN 352 ? D GLN 160 169 1 Y 1 D LYS 353 ? D LYS 161 170 1 Y 1 D GLU 354 ? D GLU 162 171 1 Y 1 D LYS 355 ? D LYS 163 172 1 Y 1 D ARG 356 ? D ARG 164 173 1 Y 1 D ILE 357 ? D ILE 165 174 1 Y 1 D ASN 358 ? D ASN 166 175 1 Y 1 D PRO 359 ? D PRO 167 176 1 Y 1 E GLY 191 ? E GLY 1 177 1 Y 1 E SER 192 ? E SER 2 178 1 Y 1 E HIS 193 ? E HIS 3 179 1 Y 1 E MET 194 ? E MET 4 180 1 Y 1 E GLU 195 ? E GLU 5 181 1 Y 1 E GLU 196 ? E GLU 6 182 1 Y 1 E PRO 197 ? E PRO 7 183 1 Y 1 E SER 198 ? E SER 8 184 1 Y 1 E ASP 199 ? E ASP 9 185 1 Y 1 E LEU 200 ? E LEU 10 186 1 Y 1 E GLU 201 ? E GLU 11 187 1 Y 1 E GLU 202 ? E GLU 12 188 1 Y 1 E LEU 203 ? E LEU 13 189 1 Y 1 E GLU 204 ? E GLU 14 190 1 Y 1 E GLN 205 ? E GLN 15 191 1 Y 1 E PHE 206 ? E PHE 16 192 1 Y 1 E ALA 207 ? E ALA 17 193 1 Y 1 E ARG 208 ? E ARG 18 194 1 Y 1 E THR 209 ? E THR 19 195 1 Y 1 E PHE 210 ? E PHE 20 196 1 Y 1 E LYS 211 ? E LYS 21 197 1 Y 1 E GLN 212 ? E GLN 22 198 1 Y 1 E ARG 213 ? E ARG 23 199 1 Y 1 E ARG 214 ? E ARG 24 200 1 Y 1 E ILE 215 ? E ILE 25 201 1 Y 1 E LYS 216 ? E LYS 26 202 1 Y 1 E LEU 217 ? E LEU 27 203 1 Y 1 E GLY 218 ? E GLY 28 204 1 Y 1 E PHE 219 ? E PHE 29 205 1 Y 1 E THR 220 ? E THR 30 206 1 Y 1 E GLN 221 ? E GLN 31 207 1 Y 1 E GLY 222 ? E GLY 32 208 1 Y 1 E ASP 223 ? E ASP 33 209 1 Y 1 E VAL 224 ? E VAL 34 210 1 Y 1 E GLY 225 ? E GLY 35 211 1 Y 1 E LEU 226 ? E LEU 36 212 1 Y 1 E ALA 227 ? E ALA 37 213 1 Y 1 E MET 228 ? E MET 38 214 1 Y 1 E GLY 229 ? E GLY 39 215 1 Y 1 E LYS 230 ? E LYS 40 216 1 Y 1 E LEU 231 ? E LEU 41 217 1 Y 1 E TYR 232 ? E TYR 42 218 1 Y 1 E GLY 233 ? E GLY 43 219 1 Y 1 E ASN 234 ? E ASN 44 220 1 Y 1 E ASP 235 ? E ASP 45 221 1 Y 1 E PHE 236 ? E PHE 46 222 1 Y 1 E SER 237 ? E SER 47 223 1 Y 1 E GLN 238 ? E GLN 48 224 1 Y 1 E THR 239 ? E THR 49 225 1 Y 1 E THR 240 ? E THR 50 226 1 Y 1 E ILE 241 ? E ILE 51 227 1 Y 1 E SER 242 ? E SER 52 228 1 Y 1 E ARG 243 ? E ARG 53 229 1 Y 1 E PHE 244 ? E PHE 54 230 1 Y 1 E GLU 245 ? E GLU 55 231 1 Y 1 E ALA 246 ? E ALA 56 232 1 Y 1 E LEU 247 ? E LEU 57 233 1 Y 1 E ASN 248 ? E ASN 58 234 1 Y 1 E LEU 249 ? E LEU 59 235 1 Y 1 E SER 250 ? E SER 60 236 1 Y 1 E PHE 251 ? E PHE 61 237 1 Y 1 E LYS 252 ? E LYS 62 238 1 Y 1 E ASN 253 ? E ASN 63 239 1 Y 1 E MET 254 ? E MET 64 240 1 Y 1 E CYS 255 ? E CYS 65 241 1 Y 1 E LYS 256 ? E LYS 66 242 1 Y 1 E LEU 257 ? E LEU 67 243 1 Y 1 E LYS 258 ? E LYS 68 244 1 Y 1 E PRO 259 ? E PRO 69 245 1 Y 1 E LEU 260 ? E LEU 70 246 1 Y 1 E LEU 261 ? E LEU 71 247 1 Y 1 E GLU 262 ? E GLU 72 248 1 Y 1 E LYS 263 ? E LYS 73 249 1 Y 1 E TRP 264 ? E TRP 74 250 1 Y 1 E LEU 265 ? E LEU 75 251 1 Y 1 E ASN 266 ? E ASN 76 252 1 Y 1 E ASP 267 ? E ASP 77 253 1 Y 1 E ALA 268 ? E ALA 78 254 1 Y 1 E GLU 269 ? E GLU 79 255 1 Y 1 E THR 270 ? E THR 80 256 1 Y 1 E MET 271 ? E MET 81 257 1 Y 1 E SER 272 ? E SER 82 258 1 Y 1 E VAL 273 ? E VAL 83 259 1 Y 1 E ASP 274 ? E ASP 84 260 1 Y 1 E SER 275 ? E SER 85 261 1 Y 1 E SER 276 ? E SER 86 262 1 Y 1 E LEU 277 ? E LEU 87 263 1 Y 1 E PRO 278 ? E PRO 88 264 1 Y 1 E SER 279 ? E SER 89 265 1 Y 1 E PRO 280 ? E PRO 90 266 1 Y 1 E ASN 281 ? E ASN 91 267 1 Y 1 E GLN 282 ? E GLN 92 268 1 Y 1 E LEU 283 ? E LEU 93 269 1 Y 1 E SER 284 ? E SER 94 270 1 Y 1 E SER 285 ? E SER 95 271 1 Y 1 E PRO 286 ? E PRO 96 272 1 Y 1 E SER 287 ? E SER 97 273 1 Y 1 E LEU 288 ? E LEU 98 274 1 Y 1 E GLY 289 ? E GLY 99 275 1 Y 1 E PHE 290 ? E PHE 100 276 1 Y 1 E ASP 291 ? E ASP 101 277 1 Y 1 E GLY 292 ? E GLY 102 278 1 Y 1 E LEU 293 ? E LEU 103 279 1 Y 1 E PRO 294 ? E PRO 104 280 1 Y 1 E GLY 295 ? E GLY 105 281 1 Y 1 E ARG 296 ? E ARG 106 282 1 Y 1 E ARG 297 ? E ARG 107 283 1 Y 1 E ARG 298 ? E ARG 108 284 1 Y 1 E LYS 299 ? E LYS 109 285 1 Y 1 F GLY 191 ? F GLY 1 286 1 Y 1 F SER 192 ? F SER 2 287 1 Y 1 F HIS 193 ? F HIS 3 288 1 Y 1 F MET 194 ? F MET 4 289 1 Y 1 F GLU 195 ? F GLU 5 290 1 Y 1 F GLU 196 ? F GLU 6 291 1 Y 1 F PRO 197 ? F PRO 7 292 1 Y 1 F SER 198 ? F SER 8 293 1 Y 1 F ASP 199 ? F ASP 9 294 1 Y 1 F LEU 200 ? F LEU 10 295 1 Y 1 F GLU 201 ? F GLU 11 296 1 Y 1 F GLU 202 ? F GLU 12 297 1 Y 1 F LEU 203 ? F LEU 13 298 1 Y 1 F GLU 204 ? F GLU 14 299 1 Y 1 F GLN 205 ? F GLN 15 300 1 Y 1 F PHE 206 ? F PHE 16 301 1 Y 1 F ALA 207 ? F ALA 17 302 1 Y 1 F ARG 208 ? F ARG 18 303 1 Y 1 F THR 209 ? F THR 19 304 1 Y 1 F PHE 210 ? F PHE 20 305 1 Y 1 F LYS 211 ? F LYS 21 306 1 Y 1 F GLN 212 ? F GLN 22 307 1 Y 1 F ARG 213 ? F ARG 23 308 1 Y 1 F ARG 214 ? F ARG 24 309 1 Y 1 F ILE 215 ? F ILE 25 310 1 Y 1 F LYS 216 ? F LYS 26 311 1 Y 1 F LEU 217 ? F LEU 27 312 1 Y 1 F GLY 218 ? F GLY 28 313 1 Y 1 F PHE 219 ? F PHE 29 314 1 Y 1 F THR 220 ? F THR 30 315 1 Y 1 F GLN 221 ? F GLN 31 316 1 Y 1 F GLY 222 ? F GLY 32 317 1 Y 1 F ASP 223 ? F ASP 33 318 1 Y 1 F VAL 224 ? F VAL 34 319 1 Y 1 F GLY 225 ? F GLY 35 320 1 Y 1 F LEU 226 ? F LEU 36 321 1 Y 1 F ALA 227 ? F ALA 37 322 1 Y 1 F MET 228 ? F MET 38 323 1 Y 1 F GLY 229 ? F GLY 39 324 1 Y 1 F LYS 230 ? F LYS 40 325 1 Y 1 F LEU 231 ? F LEU 41 326 1 Y 1 F TYR 232 ? F TYR 42 327 1 Y 1 F GLY 233 ? F GLY 43 328 1 Y 1 F ASN 234 ? F ASN 44 329 1 Y 1 F ASP 235 ? F ASP 45 330 1 Y 1 F PHE 236 ? F PHE 46 331 1 Y 1 F SER 237 ? F SER 47 332 1 Y 1 F GLN 238 ? F GLN 48 333 1 Y 1 F THR 239 ? F THR 49 334 1 Y 1 F THR 240 ? F THR 50 335 1 Y 1 F ILE 241 ? F ILE 51 336 1 Y 1 F SER 242 ? F SER 52 337 1 Y 1 F ARG 243 ? F ARG 53 338 1 Y 1 F PHE 244 ? F PHE 54 339 1 Y 1 F GLU 245 ? F GLU 55 340 1 Y 1 F ALA 246 ? F ALA 56 341 1 Y 1 F LEU 247 ? F LEU 57 342 1 Y 1 F ASN 248 ? F ASN 58 343 1 Y 1 F LEU 249 ? F LEU 59 344 1 Y 1 F SER 250 ? F SER 60 345 1 Y 1 F PHE 251 ? F PHE 61 346 1 Y 1 F LYS 252 ? F LYS 62 347 1 Y 1 F ASN 253 ? F ASN 63 348 1 Y 1 F MET 254 ? F MET 64 349 1 Y 1 F CYS 255 ? F CYS 65 350 1 Y 1 F LYS 256 ? F LYS 66 351 1 Y 1 F LEU 257 ? F LEU 67 352 1 Y 1 F LYS 258 ? F LYS 68 353 1 Y 1 F PRO 259 ? F PRO 69 354 1 Y 1 F LEU 260 ? F LEU 70 355 1 Y 1 F LEU 261 ? F LEU 71 356 1 Y 1 F GLU 262 ? F GLU 72 357 1 Y 1 F LYS 263 ? F LYS 73 358 1 Y 1 F TRP 264 ? F TRP 74 359 1 Y 1 F LEU 265 ? F LEU 75 360 1 Y 1 F ASN 266 ? F ASN 76 361 1 Y 1 F ASP 267 ? F ASP 77 362 1 Y 1 F ALA 268 ? F ALA 78 363 1 Y 1 F GLU 269 ? F GLU 79 364 1 Y 1 F THR 270 ? F THR 80 365 1 Y 1 F MET 271 ? F MET 81 366 1 Y 1 F SER 272 ? F SER 82 367 1 Y 1 F VAL 273 ? F VAL 83 368 1 Y 1 F ASP 274 ? F ASP 84 369 1 Y 1 F SER 275 ? F SER 85 370 1 Y 1 F SER 276 ? F SER 86 371 1 Y 1 F LEU 277 ? F LEU 87 372 1 Y 1 F PRO 278 ? F PRO 88 373 1 Y 1 F SER 279 ? F SER 89 374 1 Y 1 F PRO 280 ? F PRO 90 375 1 Y 1 F ASN 281 ? F ASN 91 376 1 Y 1 F GLN 282 ? F GLN 92 377 1 Y 1 F LEU 283 ? F LEU 93 378 1 Y 1 F SER 284 ? F SER 94 379 1 Y 1 F SER 285 ? F SER 95 380 1 Y 1 F PRO 286 ? F PRO 96 381 1 Y 1 F SER 287 ? F SER 97 382 1 Y 1 F LEU 288 ? F LEU 98 383 1 Y 1 F GLY 289 ? F GLY 99 384 1 Y 1 F PHE 290 ? F PHE 100 385 1 Y 1 F ASP 291 ? F ASP 101 386 1 Y 1 F GLY 292 ? F GLY 102 387 1 Y 1 F LEU 293 ? F LEU 103 388 1 Y 1 F PRO 294 ? F PRO 104 389 1 Y 1 F GLY 295 ? F GLY 105 390 1 Y 1 F ARG 296 ? F ARG 106 391 1 Y 1 F ARG 297 ? F ARG 107 392 1 Y 1 F ARG 298 ? F ARG 108 393 1 Y 1 F LYS 299 ? F LYS 109 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BR BR BR N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 DA OP3 O N N 89 DA P P N N 90 DA OP1 O N N 91 DA OP2 O N N 92 DA "O5'" O N N 93 DA "C5'" C N N 94 DA "C4'" C N R 95 DA "O4'" O N N 96 DA "C3'" C N S 97 DA "O3'" O N N 98 DA "C2'" C N N 99 DA "C1'" C N R 100 DA N9 N Y N 101 DA C8 C Y N 102 DA N7 N Y N 103 DA C5 C Y N 104 DA C6 C Y N 105 DA N6 N N N 106 DA N1 N Y N 107 DA C2 C Y N 108 DA N3 N Y N 109 DA C4 C Y N 110 DA HOP3 H N N 111 DA HOP2 H N N 112 DA "H5'" H N N 113 DA "H5''" H N N 114 DA "H4'" H N N 115 DA "H3'" H N N 116 DA "HO3'" H N N 117 DA "H2'" H N N 118 DA "H2''" H N N 119 DA "H1'" H N N 120 DA H8 H N N 121 DA H61 H N N 122 DA H62 H N N 123 DA H2 H N N 124 DC OP3 O N N 125 DC P P N N 126 DC OP1 O N N 127 DC OP2 O N N 128 DC "O5'" O N N 129 DC "C5'" C N N 130 DC "C4'" C N R 131 DC "O4'" O N N 132 DC "C3'" C N S 133 DC "O3'" O N N 134 DC "C2'" C N N 135 DC "C1'" C N R 136 DC N1 N N N 137 DC C2 C N N 138 DC O2 O N N 139 DC N3 N N N 140 DC C4 C N N 141 DC N4 N N N 142 DC C5 C N N 143 DC C6 C N N 144 DC HOP3 H N N 145 DC HOP2 H N N 146 DC "H5'" H N N 147 DC "H5''" H N N 148 DC "H4'" H N N 149 DC "H3'" H N N 150 DC "HO3'" H N N 151 DC "H2'" H N N 152 DC "H2''" H N N 153 DC "H1'" H N N 154 DC H41 H N N 155 DC H42 H N N 156 DC H5 H N N 157 DC H6 H N N 158 DG OP3 O N N 159 DG P P N N 160 DG OP1 O N N 161 DG OP2 O N N 162 DG "O5'" O N N 163 DG "C5'" C N N 164 DG "C4'" C N R 165 DG "O4'" O N N 166 DG "C3'" C N S 167 DG "O3'" O N N 168 DG "C2'" C N N 169 DG "C1'" C N R 170 DG N9 N Y N 171 DG C8 C Y N 172 DG N7 N Y N 173 DG C5 C Y N 174 DG C6 C N N 175 DG O6 O N N 176 DG N1 N N N 177 DG C2 C N N 178 DG N2 N N N 179 DG N3 N N N 180 DG C4 C Y N 181 DG HOP3 H N N 182 DG HOP2 H N N 183 DG "H5'" H N N 184 DG "H5''" H N N 185 DG "H4'" H N N 186 DG "H3'" H N N 187 DG "HO3'" H N N 188 DG "H2'" H N N 189 DG "H2''" H N N 190 DG "H1'" H N N 191 DG H8 H N N 192 DG H1 H N N 193 DG H21 H N N 194 DG H22 H N N 195 DT OP3 O N N 196 DT P P N N 197 DT OP1 O N N 198 DT OP2 O N N 199 DT "O5'" O N N 200 DT "C5'" C N N 201 DT "C4'" C N R 202 DT "O4'" O N N 203 DT "C3'" C N S 204 DT "O3'" O N N 205 DT "C2'" C N N 206 DT "C1'" C N R 207 DT N1 N N N 208 DT C2 C N N 209 DT O2 O N N 210 DT N3 N N N 211 DT C4 C N N 212 DT O4 O N N 213 DT C5 C N N 214 DT C7 C N N 215 DT C6 C N N 216 DT HOP3 H N N 217 DT HOP2 H N N 218 DT "H5'" H N N 219 DT "H5''" H N N 220 DT "H4'" H N N 221 DT "H3'" H N N 222 DT "HO3'" H N N 223 DT "H2'" H N N 224 DT "H2''" H N N 225 DT "H1'" H N N 226 DT H3 H N N 227 DT H71 H N N 228 DT H72 H N N 229 DT H73 H N N 230 DT H6 H N N 231 GLN N N N N 232 GLN CA C N S 233 GLN C C N N 234 GLN O O N N 235 GLN CB C N N 236 GLN CG C N N 237 GLN CD C N N 238 GLN OE1 O N N 239 GLN NE2 N N N 240 GLN OXT O N N 241 GLN H H N N 242 GLN H2 H N N 243 GLN HA H N N 244 GLN HB2 H N N 245 GLN HB3 H N N 246 GLN HG2 H N N 247 GLN HG3 H N N 248 GLN HE21 H N N 249 GLN HE22 H N N 250 GLN HXT H N N 251 GLU N N N N 252 GLU CA C N S 253 GLU C C N N 254 GLU O O N N 255 GLU CB C N N 256 GLU CG C N N 257 GLU CD C N N 258 GLU OE1 O N N 259 GLU OE2 O N N 260 GLU OXT O N N 261 GLU H H N N 262 GLU H2 H N N 263 GLU HA H N N 264 GLU HB2 H N N 265 GLU HB3 H N N 266 GLU HG2 H N N 267 GLU HG3 H N N 268 GLU HE2 H N N 269 GLU HXT H N N 270 GLY N N N N 271 GLY CA C N N 272 GLY C C N N 273 GLY O O N N 274 GLY OXT O N N 275 GLY H H N N 276 GLY H2 H N N 277 GLY HA2 H N N 278 GLY HA3 H N N 279 GLY HXT H N N 280 HIS N N N N 281 HIS CA C N S 282 HIS C C N N 283 HIS O O N N 284 HIS CB C N N 285 HIS CG C Y N 286 HIS ND1 N Y N 287 HIS CD2 C Y N 288 HIS CE1 C Y N 289 HIS NE2 N Y N 290 HIS OXT O N N 291 HIS H H N N 292 HIS H2 H N N 293 HIS HA H N N 294 HIS HB2 H N N 295 HIS HB3 H N N 296 HIS HD1 H N N 297 HIS HD2 H N N 298 HIS HE1 H N N 299 HIS HE2 H N N 300 HIS HXT H N N 301 HOH O O N N 302 HOH H1 H N N 303 HOH H2 H N N 304 ILE N N N N 305 ILE CA C N S 306 ILE C C N N 307 ILE O O N N 308 ILE CB C N S 309 ILE CG1 C N N 310 ILE CG2 C N N 311 ILE CD1 C N N 312 ILE OXT O N N 313 ILE H H N N 314 ILE H2 H N N 315 ILE HA H N N 316 ILE HB H N N 317 ILE HG12 H N N 318 ILE HG13 H N N 319 ILE HG21 H N N 320 ILE HG22 H N N 321 ILE HG23 H N N 322 ILE HD11 H N N 323 ILE HD12 H N N 324 ILE HD13 H N N 325 ILE HXT H N N 326 LEU N N N N 327 LEU CA C N S 328 LEU C C N N 329 LEU O O N N 330 LEU CB C N N 331 LEU CG C N N 332 LEU CD1 C N N 333 LEU CD2 C N N 334 LEU OXT O N N 335 LEU H H N N 336 LEU H2 H N N 337 LEU HA H N N 338 LEU HB2 H N N 339 LEU HB3 H N N 340 LEU HG H N N 341 LEU HD11 H N N 342 LEU HD12 H N N 343 LEU HD13 H N N 344 LEU HD21 H N N 345 LEU HD22 H N N 346 LEU HD23 H N N 347 LEU HXT H N N 348 LYS N N N N 349 LYS CA C N S 350 LYS C C N N 351 LYS O O N N 352 LYS CB C N N 353 LYS CG C N N 354 LYS CD C N N 355 LYS CE C N N 356 LYS NZ N N N 357 LYS OXT O N N 358 LYS H H N N 359 LYS H2 H N N 360 LYS HA H N N 361 LYS HB2 H N N 362 LYS HB3 H N N 363 LYS HG2 H N N 364 LYS HG3 H N N 365 LYS HD2 H N N 366 LYS HD3 H N N 367 LYS HE2 H N N 368 LYS HE3 H N N 369 LYS HZ1 H N N 370 LYS HZ2 H N N 371 LYS HZ3 H N N 372 LYS HXT H N N 373 MET N N N N 374 MET CA C N S 375 MET C C N N 376 MET O O N N 377 MET CB C N N 378 MET CG C N N 379 MET SD S N N 380 MET CE C N N 381 MET OXT O N N 382 MET H H N N 383 MET H2 H N N 384 MET HA H N N 385 MET HB2 H N N 386 MET HB3 H N N 387 MET HG2 H N N 388 MET HG3 H N N 389 MET HE1 H N N 390 MET HE2 H N N 391 MET HE3 H N N 392 MET HXT H N N 393 PHE N N N N 394 PHE CA C N S 395 PHE C C N N 396 PHE O O N N 397 PHE CB C N N 398 PHE CG C Y N 399 PHE CD1 C Y N 400 PHE CD2 C Y N 401 PHE CE1 C Y N 402 PHE CE2 C Y N 403 PHE CZ C Y N 404 PHE OXT O N N 405 PHE H H N N 406 PHE H2 H N N 407 PHE HA H N N 408 PHE HB2 H N N 409 PHE HB3 H N N 410 PHE HD1 H N N 411 PHE HD2 H N N 412 PHE HE1 H N N 413 PHE HE2 H N N 414 PHE HZ H N N 415 PHE HXT H N N 416 PRO N N N N 417 PRO CA C N S 418 PRO C C N N 419 PRO O O N N 420 PRO CB C N N 421 PRO CG C N N 422 PRO CD C N N 423 PRO OXT O N N 424 PRO H H N N 425 PRO HA H N N 426 PRO HB2 H N N 427 PRO HB3 H N N 428 PRO HG2 H N N 429 PRO HG3 H N N 430 PRO HD2 H N N 431 PRO HD3 H N N 432 PRO HXT H N N 433 SER N N N N 434 SER CA C N S 435 SER C C N N 436 SER O O N N 437 SER CB C N N 438 SER OG O N N 439 SER OXT O N N 440 SER H H N N 441 SER H2 H N N 442 SER HA H N N 443 SER HB2 H N N 444 SER HB3 H N N 445 SER HG H N N 446 SER HXT H N N 447 THR N N N N 448 THR CA C N S 449 THR C C N N 450 THR O O N N 451 THR CB C N R 452 THR OG1 O N N 453 THR CG2 C N N 454 THR OXT O N N 455 THR H H N N 456 THR H2 H N N 457 THR HA H N N 458 THR HB H N N 459 THR HG1 H N N 460 THR HG21 H N N 461 THR HG22 H N N 462 THR HG23 H N N 463 THR HXT H N N 464 TRP N N N N 465 TRP CA C N S 466 TRP C C N N 467 TRP O O N N 468 TRP CB C N N 469 TRP CG C Y N 470 TRP CD1 C Y N 471 TRP CD2 C Y N 472 TRP NE1 N Y N 473 TRP CE2 C Y N 474 TRP CE3 C Y N 475 TRP CZ2 C Y N 476 TRP CZ3 C Y N 477 TRP CH2 C Y N 478 TRP OXT O N N 479 TRP H H N N 480 TRP H2 H N N 481 TRP HA H N N 482 TRP HB2 H N N 483 TRP HB3 H N N 484 TRP HD1 H N N 485 TRP HE1 H N N 486 TRP HE3 H N N 487 TRP HZ2 H N N 488 TRP HZ3 H N N 489 TRP HH2 H N N 490 TRP HXT H N N 491 TYR N N N N 492 TYR CA C N S 493 TYR C C N N 494 TYR O O N N 495 TYR CB C N N 496 TYR CG C Y N 497 TYR CD1 C Y N 498 TYR CD2 C Y N 499 TYR CE1 C Y N 500 TYR CE2 C Y N 501 TYR CZ C Y N 502 TYR OH O N N 503 TYR OXT O N N 504 TYR H H N N 505 TYR H2 H N N 506 TYR HA H N N 507 TYR HB2 H N N 508 TYR HB3 H N N 509 TYR HD1 H N N 510 TYR HD2 H N N 511 TYR HE1 H N N 512 TYR HE2 H N N 513 TYR HH H N N 514 TYR HXT H N N 515 VAL N N N N 516 VAL CA C N S 517 VAL C C N N 518 VAL O O N N 519 VAL CB C N N 520 VAL CG1 C N N 521 VAL CG2 C N N 522 VAL OXT O N N 523 VAL H H N N 524 VAL H2 H N N 525 VAL HA H N N 526 VAL HB H N N 527 VAL HG11 H N N 528 VAL HG12 H N N 529 VAL HG13 H N N 530 VAL HG21 H N N 531 VAL HG22 H N N 532 VAL HG23 H N N 533 VAL HXT H N N 534 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DA OP3 P sing N N 83 DA OP3 HOP3 sing N N 84 DA P OP1 doub N N 85 DA P OP2 sing N N 86 DA P "O5'" sing N N 87 DA OP2 HOP2 sing N N 88 DA "O5'" "C5'" sing N N 89 DA "C5'" "C4'" sing N N 90 DA "C5'" "H5'" sing N N 91 DA "C5'" "H5''" sing N N 92 DA "C4'" "O4'" sing N N 93 DA "C4'" "C3'" sing N N 94 DA "C4'" "H4'" sing N N 95 DA "O4'" "C1'" sing N N 96 DA "C3'" "O3'" sing N N 97 DA "C3'" "C2'" sing N N 98 DA "C3'" "H3'" sing N N 99 DA "O3'" "HO3'" sing N N 100 DA "C2'" "C1'" sing N N 101 DA "C2'" "H2'" sing N N 102 DA "C2'" "H2''" sing N N 103 DA "C1'" N9 sing N N 104 DA "C1'" "H1'" sing N N 105 DA N9 C8 sing Y N 106 DA N9 C4 sing Y N 107 DA C8 N7 doub Y N 108 DA C8 H8 sing N N 109 DA N7 C5 sing Y N 110 DA C5 C6 sing Y N 111 DA C5 C4 doub Y N 112 DA C6 N6 sing N N 113 DA C6 N1 doub Y N 114 DA N6 H61 sing N N 115 DA N6 H62 sing N N 116 DA N1 C2 sing Y N 117 DA C2 N3 doub Y N 118 DA C2 H2 sing N N 119 DA N3 C4 sing Y N 120 DC OP3 P sing N N 121 DC OP3 HOP3 sing N N 122 DC P OP1 doub N N 123 DC P OP2 sing N N 124 DC P "O5'" sing N N 125 DC OP2 HOP2 sing N N 126 DC "O5'" "C5'" sing N N 127 DC "C5'" "C4'" sing N N 128 DC "C5'" "H5'" sing N N 129 DC "C5'" "H5''" sing N N 130 DC "C4'" "O4'" sing N N 131 DC "C4'" "C3'" sing N N 132 DC "C4'" "H4'" sing N N 133 DC "O4'" "C1'" sing N N 134 DC "C3'" "O3'" sing N N 135 DC "C3'" "C2'" sing N N 136 DC "C3'" "H3'" sing N N 137 DC "O3'" "HO3'" sing N N 138 DC "C2'" "C1'" sing N N 139 DC "C2'" "H2'" sing N N 140 DC "C2'" "H2''" sing N N 141 DC "C1'" N1 sing N N 142 DC "C1'" "H1'" sing N N 143 DC N1 C2 sing N N 144 DC N1 C6 sing N N 145 DC C2 O2 doub N N 146 DC C2 N3 sing N N 147 DC N3 C4 doub N N 148 DC C4 N4 sing N N 149 DC C4 C5 sing N N 150 DC N4 H41 sing N N 151 DC N4 H42 sing N N 152 DC C5 C6 doub N N 153 DC C5 H5 sing N N 154 DC C6 H6 sing N N 155 DG OP3 P sing N N 156 DG OP3 HOP3 sing N N 157 DG P OP1 doub N N 158 DG P OP2 sing N N 159 DG P "O5'" sing N N 160 DG OP2 HOP2 sing N N 161 DG "O5'" "C5'" sing N N 162 DG "C5'" "C4'" sing N N 163 DG "C5'" "H5'" sing N N 164 DG "C5'" "H5''" sing N N 165 DG "C4'" "O4'" sing N N 166 DG "C4'" "C3'" sing N N 167 DG "C4'" "H4'" sing N N 168 DG "O4'" "C1'" sing N N 169 DG "C3'" "O3'" sing N N 170 DG "C3'" "C2'" sing N N 171 DG "C3'" "H3'" sing N N 172 DG "O3'" "HO3'" sing N N 173 DG "C2'" "C1'" sing N N 174 DG "C2'" "H2'" sing N N 175 DG "C2'" "H2''" sing N N 176 DG "C1'" N9 sing N N 177 DG "C1'" "H1'" sing N N 178 DG N9 C8 sing Y N 179 DG N9 C4 sing Y N 180 DG C8 N7 doub Y N 181 DG C8 H8 sing N N 182 DG N7 C5 sing Y N 183 DG C5 C6 sing N N 184 DG C5 C4 doub Y N 185 DG C6 O6 doub N N 186 DG C6 N1 sing N N 187 DG N1 C2 sing N N 188 DG N1 H1 sing N N 189 DG C2 N2 sing N N 190 DG C2 N3 doub N N 191 DG N2 H21 sing N N 192 DG N2 H22 sing N N 193 DG N3 C4 sing N N 194 DT OP3 P sing N N 195 DT OP3 HOP3 sing N N 196 DT P OP1 doub N N 197 DT P OP2 sing N N 198 DT P "O5'" sing N N 199 DT OP2 HOP2 sing N N 200 DT "O5'" "C5'" sing N N 201 DT "C5'" "C4'" sing N N 202 DT "C5'" "H5'" sing N N 203 DT "C5'" "H5''" sing N N 204 DT "C4'" "O4'" sing N N 205 DT "C4'" "C3'" sing N N 206 DT "C4'" "H4'" sing N N 207 DT "O4'" "C1'" sing N N 208 DT "C3'" "O3'" sing N N 209 DT "C3'" "C2'" sing N N 210 DT "C3'" "H3'" sing N N 211 DT "O3'" "HO3'" sing N N 212 DT "C2'" "C1'" sing N N 213 DT "C2'" "H2'" sing N N 214 DT "C2'" "H2''" sing N N 215 DT "C1'" N1 sing N N 216 DT "C1'" "H1'" sing N N 217 DT N1 C2 sing N N 218 DT N1 C6 sing N N 219 DT C2 O2 doub N N 220 DT C2 N3 sing N N 221 DT N3 C4 sing N N 222 DT N3 H3 sing N N 223 DT C4 O4 doub N N 224 DT C4 C5 sing N N 225 DT C5 C7 sing N N 226 DT C5 C6 doub N N 227 DT C7 H71 sing N N 228 DT C7 H72 sing N N 229 DT C7 H73 sing N N 230 DT C6 H6 sing N N 231 GLN N CA sing N N 232 GLN N H sing N N 233 GLN N H2 sing N N 234 GLN CA C sing N N 235 GLN CA CB sing N N 236 GLN CA HA sing N N 237 GLN C O doub N N 238 GLN C OXT sing N N 239 GLN CB CG sing N N 240 GLN CB HB2 sing N N 241 GLN CB HB3 sing N N 242 GLN CG CD sing N N 243 GLN CG HG2 sing N N 244 GLN CG HG3 sing N N 245 GLN CD OE1 doub N N 246 GLN CD NE2 sing N N 247 GLN NE2 HE21 sing N N 248 GLN NE2 HE22 sing N N 249 GLN OXT HXT sing N N 250 GLU N CA sing N N 251 GLU N H sing N N 252 GLU N H2 sing N N 253 GLU CA C sing N N 254 GLU CA CB sing N N 255 GLU CA HA sing N N 256 GLU C O doub N N 257 GLU C OXT sing N N 258 GLU CB CG sing N N 259 GLU CB HB2 sing N N 260 GLU CB HB3 sing N N 261 GLU CG CD sing N N 262 GLU CG HG2 sing N N 263 GLU CG HG3 sing N N 264 GLU CD OE1 doub N N 265 GLU CD OE2 sing N N 266 GLU OE2 HE2 sing N N 267 GLU OXT HXT sing N N 268 GLY N CA sing N N 269 GLY N H sing N N 270 GLY N H2 sing N N 271 GLY CA C sing N N 272 GLY CA HA2 sing N N 273 GLY CA HA3 sing N N 274 GLY C O doub N N 275 GLY C OXT sing N N 276 GLY OXT HXT sing N N 277 HIS N CA sing N N 278 HIS N H sing N N 279 HIS N H2 sing N N 280 HIS CA C sing N N 281 HIS CA CB sing N N 282 HIS CA HA sing N N 283 HIS C O doub N N 284 HIS C OXT sing N N 285 HIS CB CG sing N N 286 HIS CB HB2 sing N N 287 HIS CB HB3 sing N N 288 HIS CG ND1 sing Y N 289 HIS CG CD2 doub Y N 290 HIS ND1 CE1 doub Y N 291 HIS ND1 HD1 sing N N 292 HIS CD2 NE2 sing Y N 293 HIS CD2 HD2 sing N N 294 HIS CE1 NE2 sing Y N 295 HIS CE1 HE1 sing N N 296 HIS NE2 HE2 sing N N 297 HIS OXT HXT sing N N 298 HOH O H1 sing N N 299 HOH O H2 sing N N 300 ILE N CA sing N N 301 ILE N H sing N N 302 ILE N H2 sing N N 303 ILE CA C sing N N 304 ILE CA CB sing N N 305 ILE CA HA sing N N 306 ILE C O doub N N 307 ILE C OXT sing N N 308 ILE CB CG1 sing N N 309 ILE CB CG2 sing N N 310 ILE CB HB sing N N 311 ILE CG1 CD1 sing N N 312 ILE CG1 HG12 sing N N 313 ILE CG1 HG13 sing N N 314 ILE CG2 HG21 sing N N 315 ILE CG2 HG22 sing N N 316 ILE CG2 HG23 sing N N 317 ILE CD1 HD11 sing N N 318 ILE CD1 HD12 sing N N 319 ILE CD1 HD13 sing N N 320 ILE OXT HXT sing N N 321 LEU N CA sing N N 322 LEU N H sing N N 323 LEU N H2 sing N N 324 LEU CA C sing N N 325 LEU CA CB sing N N 326 LEU CA HA sing N N 327 LEU C O doub N N 328 LEU C OXT sing N N 329 LEU CB CG sing N N 330 LEU CB HB2 sing N N 331 LEU CB HB3 sing N N 332 LEU CG CD1 sing N N 333 LEU CG CD2 sing N N 334 LEU CG HG sing N N 335 LEU CD1 HD11 sing N N 336 LEU CD1 HD12 sing N N 337 LEU CD1 HD13 sing N N 338 LEU CD2 HD21 sing N N 339 LEU CD2 HD22 sing N N 340 LEU CD2 HD23 sing N N 341 LEU OXT HXT sing N N 342 LYS N CA sing N N 343 LYS N H sing N N 344 LYS N H2 sing N N 345 LYS CA C sing N N 346 LYS CA CB sing N N 347 LYS CA HA sing N N 348 LYS C O doub N N 349 LYS C OXT sing N N 350 LYS CB CG sing N N 351 LYS CB HB2 sing N N 352 LYS CB HB3 sing N N 353 LYS CG CD sing N N 354 LYS CG HG2 sing N N 355 LYS CG HG3 sing N N 356 LYS CD CE sing N N 357 LYS CD HD2 sing N N 358 LYS CD HD3 sing N N 359 LYS CE NZ sing N N 360 LYS CE HE2 sing N N 361 LYS CE HE3 sing N N 362 LYS NZ HZ1 sing N N 363 LYS NZ HZ2 sing N N 364 LYS NZ HZ3 sing N N 365 LYS OXT HXT sing N N 366 MET N CA sing N N 367 MET N H sing N N 368 MET N H2 sing N N 369 MET CA C sing N N 370 MET CA CB sing N N 371 MET CA HA sing N N 372 MET C O doub N N 373 MET C OXT sing N N 374 MET CB CG sing N N 375 MET CB HB2 sing N N 376 MET CB HB3 sing N N 377 MET CG SD sing N N 378 MET CG HG2 sing N N 379 MET CG HG3 sing N N 380 MET SD CE sing N N 381 MET CE HE1 sing N N 382 MET CE HE2 sing N N 383 MET CE HE3 sing N N 384 MET OXT HXT sing N N 385 PHE N CA sing N N 386 PHE N H sing N N 387 PHE N H2 sing N N 388 PHE CA C sing N N 389 PHE CA CB sing N N 390 PHE CA HA sing N N 391 PHE C O doub N N 392 PHE C OXT sing N N 393 PHE CB CG sing N N 394 PHE CB HB2 sing N N 395 PHE CB HB3 sing N N 396 PHE CG CD1 doub Y N 397 PHE CG CD2 sing Y N 398 PHE CD1 CE1 sing Y N 399 PHE CD1 HD1 sing N N 400 PHE CD2 CE2 doub Y N 401 PHE CD2 HD2 sing N N 402 PHE CE1 CZ doub Y N 403 PHE CE1 HE1 sing N N 404 PHE CE2 CZ sing Y N 405 PHE CE2 HE2 sing N N 406 PHE CZ HZ sing N N 407 PHE OXT HXT sing N N 408 PRO N CA sing N N 409 PRO N CD sing N N 410 PRO N H sing N N 411 PRO CA C sing N N 412 PRO CA CB sing N N 413 PRO CA HA sing N N 414 PRO C O doub N N 415 PRO C OXT sing N N 416 PRO CB CG sing N N 417 PRO CB HB2 sing N N 418 PRO CB HB3 sing N N 419 PRO CG CD sing N N 420 PRO CG HG2 sing N N 421 PRO CG HG3 sing N N 422 PRO CD HD2 sing N N 423 PRO CD HD3 sing N N 424 PRO OXT HXT sing N N 425 SER N CA sing N N 426 SER N H sing N N 427 SER N H2 sing N N 428 SER CA C sing N N 429 SER CA CB sing N N 430 SER CA HA sing N N 431 SER C O doub N N 432 SER C OXT sing N N 433 SER CB OG sing N N 434 SER CB HB2 sing N N 435 SER CB HB3 sing N N 436 SER OG HG sing N N 437 SER OXT HXT sing N N 438 THR N CA sing N N 439 THR N H sing N N 440 THR N H2 sing N N 441 THR CA C sing N N 442 THR CA CB sing N N 443 THR CA HA sing N N 444 THR C O doub N N 445 THR C OXT sing N N 446 THR CB OG1 sing N N 447 THR CB CG2 sing N N 448 THR CB HB sing N N 449 THR OG1 HG1 sing N N 450 THR CG2 HG21 sing N N 451 THR CG2 HG22 sing N N 452 THR CG2 HG23 sing N N 453 THR OXT HXT sing N N 454 TRP N CA sing N N 455 TRP N H sing N N 456 TRP N H2 sing N N 457 TRP CA C sing N N 458 TRP CA CB sing N N 459 TRP CA HA sing N N 460 TRP C O doub N N 461 TRP C OXT sing N N 462 TRP CB CG sing N N 463 TRP CB HB2 sing N N 464 TRP CB HB3 sing N N 465 TRP CG CD1 doub Y N 466 TRP CG CD2 sing Y N 467 TRP CD1 NE1 sing Y N 468 TRP CD1 HD1 sing N N 469 TRP CD2 CE2 doub Y N 470 TRP CD2 CE3 sing Y N 471 TRP NE1 CE2 sing Y N 472 TRP NE1 HE1 sing N N 473 TRP CE2 CZ2 sing Y N 474 TRP CE3 CZ3 doub Y N 475 TRP CE3 HE3 sing N N 476 TRP CZ2 CH2 doub Y N 477 TRP CZ2 HZ2 sing N N 478 TRP CZ3 CH2 sing Y N 479 TRP CZ3 HZ3 sing N N 480 TRP CH2 HH2 sing N N 481 TRP OXT HXT sing N N 482 TYR N CA sing N N 483 TYR N H sing N N 484 TYR N H2 sing N N 485 TYR CA C sing N N 486 TYR CA CB sing N N 487 TYR CA HA sing N N 488 TYR C O doub N N 489 TYR C OXT sing N N 490 TYR CB CG sing N N 491 TYR CB HB2 sing N N 492 TYR CB HB3 sing N N 493 TYR CG CD1 doub Y N 494 TYR CG CD2 sing Y N 495 TYR CD1 CE1 sing Y N 496 TYR CD1 HD1 sing N N 497 TYR CD2 CE2 doub Y N 498 TYR CD2 HD2 sing N N 499 TYR CE1 CZ doub Y N 500 TYR CE1 HE1 sing N N 501 TYR CE2 CZ sing Y N 502 TYR CE2 HE2 sing N N 503 TYR CZ OH sing N N 504 TYR OH HH sing N N 505 TYR OXT HXT sing N N 506 VAL N CA sing N N 507 VAL N H sing N N 508 VAL N H2 sing N N 509 VAL CA C sing N N 510 VAL CA CB sing N N 511 VAL CA HA sing N N 512 VAL C O doub N N 513 VAL C OXT sing N N 514 VAL CB CG1 sing N N 515 VAL CB CG2 sing N N 516 VAL CB HB sing N N 517 VAL CG1 HG11 sing N N 518 VAL CG1 HG12 sing N N 519 VAL CG1 HG13 sing N N 520 VAL CG2 HG21 sing N N 521 VAL CG2 HG22 sing N N 522 VAL CG2 HG23 sing N N 523 VAL OXT HXT sing N N 524 # loop_ _ndb_struct_conf_na.entry_id _ndb_struct_conf_na.feature 9DZM 'double helix' 9DZM 'b-form double helix' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 A DT 1 1_555 B DA 22 1_555 -0.181 -0.131 0.095 4.318 -15.002 8.668 1 A_DT201:DA222_B A 201 ? B 222 ? 20 1 1 A DC 2 1_555 B DG 21 1_555 -0.618 0.200 -0.208 9.308 -21.896 -3.320 2 A_DC202:DG221_B A 202 ? B 221 ? 19 1 1 A DC 3 1_555 B DG 20 1_555 -0.395 0.088 0.470 -3.548 -23.491 7.706 3 A_DC203:DG220_B A 203 ? B 220 ? 19 1 1 A DT 4 1_555 B DA 19 1_555 0.049 -0.243 0.280 -8.986 -12.684 -0.275 4 A_DT204:DA219_B A 204 ? B 219 ? 20 1 1 A DC 5 1_555 B DG 18 1_555 0.036 -0.211 0.165 -12.201 -8.235 10.756 5 A_DC205:DG218_B A 205 ? B 218 ? 22 1 1 A DA 6 1_555 B DT 17 1_555 -0.126 -0.245 -0.253 -4.765 -10.662 -0.276 6 A_DA206:DT217_B A 206 ? B 217 ? 20 1 1 A DT 7 1_555 B DA 16 1_555 0.284 -0.080 0.121 4.243 -3.061 8.240 7 A_DT207:DA216_B A 207 ? B 216 ? 20 1 1 A DG 8 1_555 B DC 15 1_555 -0.402 -0.312 -0.065 6.553 5.316 0.684 8 A_DG208:DC215_B A 208 ? B 215 ? 19 1 1 A DC 9 1_555 B DG 14 1_555 -0.104 -0.241 0.242 9.494 -24.752 -5.500 9 A_DC209:DG214_B A 209 ? B 214 ? 19 1 1 A DA 10 1_555 B DT 13 1_555 0.152 -0.159 0.203 1.441 -14.140 9.053 10 A_DA210:DT213_B A 210 ? B 213 ? 20 1 1 A DT 11 1_555 B DA 12 1_555 -0.161 -0.089 0.069 -1.847 -13.783 6.652 11 A_DT211:DA212_B A 211 ? B 212 ? 20 1 1 A DA 12 1_555 B DT 11 1_555 0.157 -0.174 0.110 0.736 -11.675 8.858 12 A_DA212:DT211_B A 212 ? B 211 ? 20 1 1 A DT 13 1_555 B DA 10 1_555 -0.278 -0.243 0.392 -4.108 -12.367 5.374 13 A_DT213:DA210_B A 213 ? B 210 ? 20 1 1 A DG 14 1_555 B DC 9 1_555 0.046 -0.190 0.501 -8.723 -23.091 -1.634 14 A_DG214:DC209_B A 214 ? B 209 ? 19 1 1 A DC 15 1_555 B DG 8 1_555 0.310 -0.225 -0.068 -4.730 -0.127 1.954 15 A_DC215:DG208_B A 215 ? B 208 ? 19 1 1 A DA 16 1_555 B DT 7 1_555 -0.035 -0.048 0.117 -6.857 -6.107 7.659 16 A_DA216:DT207_B A 216 ? B 207 ? 20 1 1 A DT 17 1_555 B DA 6 1_555 0.230 -0.106 0.193 2.363 -6.649 -0.574 17 A_DT217:DA206_B A 217 ? B 206 ? 20 1 1 A DG 18 1_555 B DC 5 1_555 -0.062 -0.049 0.200 13.565 -8.861 7.346 18 A_DG218:DC205_B A 218 ? B 205 ? 19 1 1 A DA 19 1_555 B DT 4 1_555 0.275 -0.152 0.269 5.820 -13.937 -2.676 19 A_DA219:DT204_B A 219 ? B 204 ? 20 1 1 A DG 20 1_555 B DC 3 1_555 0.315 -0.332 0.415 6.931 -14.367 4.688 20 A_DG220:DC203_B A 220 ? B 203 ? 19 1 1 A DG 21 1_555 B DC 2 1_555 -0.536 0.119 -0.212 -9.981 -11.163 1.274 21 A_DG221:DC202_B A 221 ? B 202 ? 19 1 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 A DT 1 1_555 B DA 22 1_555 A DC 2 1_555 B DG 21 1_555 -0.118 0.233 3.120 0.988 -5.401 34.372 1.169 0.341 3.045 -9.067 -1.659 34.794 1 AA_DT201DC202:DG221DA222_BB A 201 ? B 222 ? A 202 ? B 221 ? 1 A DC 2 1_555 B DG 21 1_555 A DC 3 1_555 B DG 20 1_555 0.955 -0.309 3.491 -0.964 5.343 38.702 -1.143 -1.552 3.396 8.014 1.446 39.066 2 AA_DC202DC203:DG220DG221_BB A 202 ? B 221 ? A 203 ? B 220 ? 1 A DC 3 1_555 B DG 20 1_555 A DT 4 1_555 B DA 19 1_555 -0.738 -0.428 3.494 0.020 9.274 36.721 -1.917 1.141 3.293 14.439 -0.031 37.834 3 AA_DC203DT204:DA219DG220_BB A 203 ? B 220 ? A 204 ? B 219 ? 1 A DT 4 1_555 B DA 19 1_555 A DC 5 1_555 B DG 18 1_555 1.077 0.330 3.343 5.401 -0.492 36.653 0.588 -0.938 3.457 -0.777 -8.531 37.038 4 AA_DT204DC205:DG218DA219_BB A 204 ? B 219 ? A 205 ? B 218 ? 1 A DC 5 1_555 B DG 18 1_555 A DA 6 1_555 B DT 17 1_555 -0.664 0.586 3.158 3.311 10.058 30.718 -0.691 1.762 3.104 18.316 -6.030 32.450 5 AA_DC205DA206:DT217DG218_BB A 205 ? B 218 ? A 206 ? B 217 ? 1 A DA 6 1_555 B DT 17 1_555 A DT 7 1_555 B DA 16 1_555 1.321 -0.679 3.169 -4.251 3.352 30.956 -1.839 -3.182 2.878 6.221 7.889 31.415 6 AA_DA206DT207:DA216DT217_BB A 206 ? B 217 ? A 207 ? B 216 ? 1 A DT 7 1_555 B DA 16 1_555 A DG 8 1_555 B DC 15 1_555 -0.714 -1.052 3.173 0.736 5.143 26.375 -3.502 1.714 2.898 11.135 -1.594 26.873 7 AA_DT207DG208:DC215DA216_BB A 207 ? B 216 ? A 208 ? B 215 ? 1 A DG 8 1_555 B DC 15 1_555 A DC 9 1_555 B DG 14 1_555 -1.143 0.323 3.397 -0.447 -10.099 39.301 1.628 1.599 3.233 -14.721 0.651 40.531 8 AA_DG208DC209:DG214DC215_BB A 208 ? B 215 ? A 209 ? B 214 ? 1 A DC 9 1_555 B DG 14 1_555 A DA 10 1_555 B DT 13 1_555 1.844 0.860 3.477 7.172 0.728 41.993 1.102 -1.734 3.742 1.007 -9.920 42.580 9 AA_DC209DA210:DT213DG214_BB A 209 ? B 214 ? A 210 ? B 213 ? 1 A DA 10 1_555 B DT 13 1_555 A DT 11 1_555 B DA 12 1_555 -0.109 -0.401 3.305 0.401 8.891 25.827 -3.047 0.331 3.001 19.181 -0.866 27.293 10 AA_DA210DT211:DA212DT213_BB A 210 ? B 213 ? A 211 ? B 212 ? 1 A DT 11 1_555 B DA 12 1_555 A DA 12 1_555 B DT 11 1_555 0.110 0.702 3.472 -0.854 4.689 44.012 0.464 -0.231 3.522 6.235 1.136 44.257 11 AA_DT211DA212:DT211DA212_BB A 211 ? B 212 ? A 212 ? B 211 ? 1 A DA 12 1_555 B DT 11 1_555 A DT 13 1_555 B DA 10 1_555 -0.280 -0.549 3.413 -1.360 7.569 25.400 -3.242 0.242 3.131 16.731 3.006 26.520 12 AA_DA212DT213:DA210DT211_BB A 212 ? B 211 ? A 213 ? B 210 ? 1 A DT 13 1_555 B DA 10 1_555 A DG 14 1_555 B DC 9 1_555 -1.570 0.837 3.395 -5.652 -0.590 42.153 1.218 1.554 3.555 -0.816 7.815 42.517 13 AA_DT213DG214:DC209DA210_BB A 213 ? B 210 ? A 214 ? B 209 ? 1 A DG 14 1_555 B DC 9 1_555 A DC 15 1_555 B DG 8 1_555 1.088 0.506 3.392 3.079 -10.107 39.299 1.889 -1.213 3.243 -14.708 -4.481 40.640 14 AA_DG214DC215:DG208DC209_BB A 214 ? B 209 ? A 215 ? B 208 ? 1 A DC 15 1_555 B DG 8 1_555 A DA 16 1_555 B DT 7 1_555 0.713 -0.984 3.300 -0.937 4.319 28.329 -2.947 -1.649 3.094 8.757 1.900 28.665 15 AA_DC215DA216:DT207DG208_BB A 215 ? B 208 ? A 216 ? B 207 ? 1 A DA 16 1_555 B DT 7 1_555 A DT 17 1_555 B DA 6 1_555 -1.178 -0.794 3.118 1.680 2.840 31.915 -1.913 2.413 2.974 5.148 -3.044 32.081 16 AA_DA216DT217:DA206DT207_BB A 216 ? B 207 ? A 217 ? B 206 ? 1 A DT 17 1_555 B DA 6 1_555 A DG 18 1_555 B DC 5 1_555 0.353 0.351 3.048 -1.019 8.041 29.699 -0.826 -0.855 3.024 15.331 1.943 30.761 17 AA_DT217DG218:DC205DA206_BB A 217 ? B 206 ? A 218 ? B 205 ? 1 A DG 18 1_555 B DC 5 1_555 A DA 19 1_555 B DT 4 1_555 -1.034 0.096 3.371 -4.413 2.413 37.187 -0.182 1.002 3.466 3.762 6.882 37.514 18 AA_DG218DA219:DT204DC205_BB A 218 ? B 205 ? A 219 ? B 204 ? 1 A DA 19 1_555 B DT 4 1_555 A DG 20 1_555 B DC 3 1_555 0.736 -0.561 3.322 -2.615 7.493 33.756 -2.082 -1.634 3.067 12.687 4.427 34.649 19 AA_DA219DG220:DC203DT204_BB A 219 ? B 204 ? A 220 ? B 203 ? 1 A DG 20 1_555 B DC 3 1_555 A DG 21 1_555 B DC 2 1_555 -0.208 -0.631 3.689 3.598 0.687 36.613 -1.104 0.880 3.641 1.090 -5.710 36.789 20 AA_DG220DG221:DC202DC203_BB A 220 ? B 203 ? A 221 ? B 202 ? # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Heart, Lung, and Blood Institute (NIH/NHLBI)' 'United States' HL155178 1 'National Science Foundation (NSF, United States)' 'United States' MCB2028902 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM137160 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1E3O _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 1' _space_group.name_Hall 'P 1' _space_group.IT_number 1 _space_group.crystal_system triclinic _space_group.id 1 # _atom_sites.entry_id 9DZM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.026296 _atom_sites.fract_transf_matrix[1][2] -0.008661 _atom_sites.fract_transf_matrix[1][3] -0.004103 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019170 _atom_sites.fract_transf_matrix[2][3] -0.001576 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014747 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source BR ? ? 25.79822 9.11301 ? ? 1.35700 25.34896 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #