data_9E3Y # _entry.id 9E3Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9E3Y pdb_00009e3y 10.2210/pdb9e3y/pdb WWPDB D_1000289390 ? ? BMRB 31210 ? 10.13018/BMR31210 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-01-08 ? 2 'Structure model' 1 1 2025-03-19 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.year' 3 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9E3Y _pdbx_database_status.recvd_initial_deposition_date 2024-10-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Backbone Modification in the Fungal Defensin Plectasin: D- and Calpha-methyl-residues in the turns' _pdbx_database_related.db_id 31210 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email horne@pitt.edu _pdbx_contact_author.name_first William _pdbx_contact_author.name_last Horne _pdbx_contact_author.name_mi Seth _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2927-1739 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Harmon, T.W.' 1 ? 'Song, J.' 2 ? 'Gulewicz, A.J.' 3 ? 'Di, Y.P.' 4 ? 'Horne, W.S.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chembiochem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1439-7633 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 26 _citation.language ? _citation.page_first e202400951 _citation.page_last e202400951 _citation.title 'Structural and Functional Mimicry of the Antimicrobial Defensin Plectasin by Analogues with Engineered Backbone Composition.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cbic.202400951 _citation.pdbx_database_id_PubMed 39714882 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harmon, T.W.' 1 ? primary 'Song, J.' 2 ? primary 'Gulewicz, A.J.' 3 ? primary 'Di, Y.P.' 4 ? primary 'Horne, W.S.' 5 0000-0003-2927-1739 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Fungal defensin plectasin variant NZ2114' _entity.formula_weight 4473.151 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'GFGCNG(6ZS)WNEDDLRCHNHCKSIP(DPR)YKGGYCAK(DPR)GFVCKCY(NH2)' _entity_poly.pdbx_seq_one_letter_code_can GFGCNGXWNEDDLRCHNHCKSIPPYKGGYCAKPGFVCKCYX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PHE n 1 3 GLY n 1 4 CYS n 1 5 ASN n 1 6 GLY n 1 7 6ZS n 1 8 TRP n 1 9 ASN n 1 10 GLU n 1 11 ASP n 1 12 ASP n 1 13 LEU n 1 14 ARG n 1 15 CYS n 1 16 HIS n 1 17 ASN n 1 18 HIS n 1 19 CYS n 1 20 LYS n 1 21 SER n 1 22 ILE n 1 23 PRO n 1 24 DPR n 1 25 TYR n 1 26 LYS n 1 27 GLY n 1 28 GLY n 1 29 TYR n 1 30 CYS n 1 31 ALA n 1 32 LYS n 1 33 DPR n 1 34 GLY n 1 35 PHE n 1 36 VAL n 1 37 CYS n 1 38 LYS n 1 39 CYS n 1 40 TYR n 1 41 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 41 _pdbx_entity_src_syn.organism_scientific 'Pseudoplectania nigrella' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 96584 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6ZS 'L-peptide linking' . L-isovaline ? 'C5 H11 N O2' 117.146 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DPR 'D-peptide linking' . D-PROLINE ? 'C5 H9 N O2' 115.130 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 6ZS 7 7 7 6ZS IVA A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 DPR 24 24 24 DPR DPR A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 DPR 33 33 33 DPR DPR A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 NH2 41 41 41 NH2 NH2 A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 DPR ? ? DPR ? ? 'SUBJECT OF INVESTIGATION' ? 2 6ZS ? ? 6ZS ? ? 'SUBJECT OF INVESTIGATION' ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9E3Y _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9E3Y _struct.title 'Backbone Modification in the Fungal Defensin Plectasin: D- and Calpha-methyl-residues in the turns' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9E3Y _struct_keywords.text 'plectasin derivative, defensin, antibiotic, proteomimetic, ANTIMICROBIAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEFPL_PSENR _struct_ref.pdbx_db_accession Q53I06 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY _struct_ref.pdbx_align_begin 56 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9E3Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q53I06 _struct_ref_seq.db_align_beg 56 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 95 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9E3Y 6ZS A 7 ? UNP Q53I06 PRO 62 variant 7 1 1 9E3Y ASN A 9 ? UNP Q53I06 ASP 64 variant 9 2 1 9E3Y LEU A 13 ? UNP Q53I06 MET 68 variant 13 3 1 9E3Y ARG A 14 ? UNP Q53I06 GLN 69 variant 14 4 1 9E3Y PRO A 23 ? UNP Q53I06 LYS 78 variant 23 5 1 9E3Y DPR A 24 ? UNP Q53I06 GLY 79 variant 24 6 1 9E3Y DPR A 33 ? UNP Q53I06 GLY 88 variant 33 7 1 9E3Y NH2 A 41 ? UNP Q53I06 ? ? amidation 41 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 11 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 21 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 11 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 21 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 4 A CYS 30 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 15 A CYS 37 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 19 A CYS 39 1_555 ? ? ? ? ? ? ? 2.030 ? ? covale1 covale both ? A GLY 6 C ? ? ? 1_555 A 6ZS 7 N ? ? A GLY 6 A 6ZS 7 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? A 6ZS 7 C ? ? ? 1_555 A TRP 8 N ? ? A 6ZS 7 A TRP 8 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale3 covale both ? A PRO 23 C ? ? ? 1_555 A DPR 24 N ? ? A PRO 23 A DPR 24 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale4 covale both ? A DPR 24 C ? ? ? 1_555 A TYR 25 N ? ? A DPR 24 A TYR 25 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale5 covale both ? A LYS 32 C ? ? ? 1_555 A DPR 33 N ? ? A LYS 32 A DPR 33 1_555 ? ? ? ? ? ? ? 1.342 ? ? covale6 covale both ? A DPR 33 C ? ? ? 1_555 A GLY 34 N ? ? A DPR 33 A GLY 34 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale7 covale both ? A TYR 40 C ? ? ? 1_555 A NH2 41 N ? ? A TYR 40 A NH2 41 1_555 ? ? ? ? ? ? ? 1.319 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 6ZS A 7 ? . . . . 6ZS A 7 ? 1_555 . . . . . . . ? 1 6ZS None 'Non-standard residue' 2 NH2 A 41 ? TYR A 40 ? NH2 A 41 ? 1_555 TYR A 40 ? 1_555 . . TYR 5 NH2 None 'Terminal amidation' 3 CYS A 4 ? CYS A 30 ? CYS A 4 ? 1_555 CYS A 30 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 15 ? CYS A 37 ? CYS A 15 ? 1_555 CYS A 37 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 19 ? CYS A 39 ? CYS A 19 ? 1_555 CYS A 39 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 27 ? ALA A 31 ? GLY A 27 ALA A 31 AA1 2 VAL A 36 ? TYR A 40 ? VAL A 36 TYR A 40 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 29 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 29 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 38 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 38 # _pdbx_entry_details.entry_id 9E3Y _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 9 ? ? -140.42 53.30 2 1 LYS A 32 ? ? 53.09 72.56 3 2 ASN A 9 ? ? -153.32 61.79 4 2 ASP A 11 ? ? -114.23 77.04 5 2 LYS A 32 ? ? 55.87 74.25 6 3 ASN A 9 ? ? -153.35 55.21 7 4 PHE A 2 ? ? -97.05 57.12 8 4 LYS A 32 ? ? 52.25 74.57 9 5 PHE A 2 ? ? -102.38 76.62 10 5 LYS A 32 ? ? 53.82 72.45 11 6 ASN A 9 ? ? -142.43 59.52 12 6 LYS A 32 ? ? 52.77 72.60 13 7 ASN A 9 ? ? -144.43 56.79 14 7 LYS A 32 ? ? 52.95 71.03 15 8 ASN A 9 ? ? -145.67 49.55 16 8 LYS A 32 ? ? 55.87 71.64 17 9 ASN A 9 ? ? -142.08 54.04 18 9 ASP A 11 ? ? -113.28 79.61 19 9 LYS A 32 ? ? 53.73 70.49 20 10 ASP A 11 ? ? -103.22 79.94 21 10 LYS A 32 ? ? 53.21 76.34 # _pdbx_nmr_ensemble.entry_id 9E3Y _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9E3Y _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.48 mM Heterogeneous-backbone analogue of plectasin variant NZ2114: Iva7, Pro23, D-Pro24, D-Pro33, 20 mM [U-2H] sodium acetate, 0.11 mM DSS, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Heterogeneous-backbone analogue of plectasin variant NZ2114: Iva7, Pro23, D-Pro24, D-Pro33' 0.48 ? mM 'natural abundance' 1 'sodium acetate' 20 ? mM '[U-2H]' 1 DSS 0.11 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 3.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH* _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H COSY' 1 isotropic 3 1 1 '2D DQF-COSY' 1 isotropic 4 1 1 '2D 1H-1H NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 9E3Y _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin ? 'Bruker Biospin' 2 'data analysis' Poky ? 'Manthey, Tonelli, Clos II, Rahimi, Markley and Lee' 3 'peak picking' Poky ? 'Manthey, Tonelli, Clos II, Rahimi, Markley and Lee' 4 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 6ZS C2 C N N 1 6ZS N N N N 2 6ZS CA C N S 3 6ZS CB1 C N N 4 6ZS C C N N 5 6ZS O O N N 6 6ZS CB C N N 7 6ZS OXT O N N 8 6ZS H1 H N N 9 6ZS H4 H N N 10 6ZS H3 H N N 11 6ZS H H N N 12 6ZS H2 H N N 13 6ZS H7 H N N 14 6ZS H8 H N N 15 6ZS H9 H N N 16 6ZS H10 H N N 17 6ZS H11 H N N 18 6ZS HXT H N N 19 ALA N N N N 20 ALA CA C N S 21 ALA C C N N 22 ALA O O N N 23 ALA CB C N N 24 ALA OXT O N N 25 ALA H H N N 26 ALA H2 H N N 27 ALA HA H N N 28 ALA HB1 H N N 29 ALA HB2 H N N 30 ALA HB3 H N N 31 ALA HXT H N N 32 ARG N N N N 33 ARG CA C N S 34 ARG C C N N 35 ARG O O N N 36 ARG CB C N N 37 ARG CG C N N 38 ARG CD C N N 39 ARG NE N N N 40 ARG CZ C N N 41 ARG NH1 N N N 42 ARG NH2 N N N 43 ARG OXT O N N 44 ARG H H N N 45 ARG H2 H N N 46 ARG HA H N N 47 ARG HB2 H N N 48 ARG HB3 H N N 49 ARG HG2 H N N 50 ARG HG3 H N N 51 ARG HD2 H N N 52 ARG HD3 H N N 53 ARG HE H N N 54 ARG HH11 H N N 55 ARG HH12 H N N 56 ARG HH21 H N N 57 ARG HH22 H N N 58 ARG HXT H N N 59 ASN N N N N 60 ASN CA C N S 61 ASN C C N N 62 ASN O O N N 63 ASN CB C N N 64 ASN CG C N N 65 ASN OD1 O N N 66 ASN ND2 N N N 67 ASN OXT O N N 68 ASN H H N N 69 ASN H2 H N N 70 ASN HA H N N 71 ASN HB2 H N N 72 ASN HB3 H N N 73 ASN HD21 H N N 74 ASN HD22 H N N 75 ASN HXT H N N 76 ASP N N N N 77 ASP CA C N S 78 ASP C C N N 79 ASP O O N N 80 ASP CB C N N 81 ASP CG C N N 82 ASP OD1 O N N 83 ASP OD2 O N N 84 ASP OXT O N N 85 ASP H H N N 86 ASP H2 H N N 87 ASP HA H N N 88 ASP HB2 H N N 89 ASP HB3 H N N 90 ASP HD2 H N N 91 ASP HXT H N N 92 CYS N N N N 93 CYS CA C N R 94 CYS C C N N 95 CYS O O N N 96 CYS CB C N N 97 CYS SG S N N 98 CYS OXT O N N 99 CYS H H N N 100 CYS H2 H N N 101 CYS HA H N N 102 CYS HB2 H N N 103 CYS HB3 H N N 104 CYS HG H N N 105 CYS HXT H N N 106 DPR N N N N 107 DPR CA C N R 108 DPR CB C N N 109 DPR CG C N N 110 DPR CD C N N 111 DPR C C N N 112 DPR O O N N 113 DPR OXT O N N 114 DPR H H N N 115 DPR HA H N N 116 DPR HB2 H N N 117 DPR HB3 H N N 118 DPR HG2 H N N 119 DPR HG3 H N N 120 DPR HD2 H N N 121 DPR HD3 H N N 122 DPR HXT H N N 123 GLN N N N N 124 GLN CA C N S 125 GLN C C N N 126 GLN O O N N 127 GLN CB C N N 128 GLN CG C N N 129 GLN CD C N N 130 GLN OE1 O N N 131 GLN NE2 N N N 132 GLN OXT O N N 133 GLN H H N N 134 GLN H2 H N N 135 GLN HA H N N 136 GLN HB2 H N N 137 GLN HB3 H N N 138 GLN HG2 H N N 139 GLN HG3 H N N 140 GLN HE21 H N N 141 GLN HE22 H N N 142 GLN HXT H N N 143 GLU N N N N 144 GLU CA C N S 145 GLU C C N N 146 GLU O O N N 147 GLU CB C N N 148 GLU CG C N N 149 GLU CD C N N 150 GLU OE1 O N N 151 GLU OE2 O N N 152 GLU OXT O N N 153 GLU H H N N 154 GLU H2 H N N 155 GLU HA H N N 156 GLU HB2 H N N 157 GLU HB3 H N N 158 GLU HG2 H N N 159 GLU HG3 H N N 160 GLU HE2 H N N 161 GLU HXT H N N 162 GLY N N N N 163 GLY CA C N N 164 GLY C C N N 165 GLY O O N N 166 GLY OXT O N N 167 GLY H H N N 168 GLY H2 H N N 169 GLY HA2 H N N 170 GLY HA3 H N N 171 GLY HXT H N N 172 HIS N N N N 173 HIS CA C N S 174 HIS C C N N 175 HIS O O N N 176 HIS CB C N N 177 HIS CG C Y N 178 HIS ND1 N Y N 179 HIS CD2 C Y N 180 HIS CE1 C Y N 181 HIS NE2 N Y N 182 HIS OXT O N N 183 HIS H H N N 184 HIS H2 H N N 185 HIS HA H N N 186 HIS HB2 H N N 187 HIS HB3 H N N 188 HIS HD1 H N N 189 HIS HD2 H N N 190 HIS HE1 H N N 191 HIS HE2 H N N 192 HIS HXT H N N 193 ILE N N N N 194 ILE CA C N S 195 ILE C C N N 196 ILE O O N N 197 ILE CB C N S 198 ILE CG1 C N N 199 ILE CG2 C N N 200 ILE CD1 C N N 201 ILE OXT O N N 202 ILE H H N N 203 ILE H2 H N N 204 ILE HA H N N 205 ILE HB H N N 206 ILE HG12 H N N 207 ILE HG13 H N N 208 ILE HG21 H N N 209 ILE HG22 H N N 210 ILE HG23 H N N 211 ILE HD11 H N N 212 ILE HD12 H N N 213 ILE HD13 H N N 214 ILE HXT H N N 215 LEU N N N N 216 LEU CA C N S 217 LEU C C N N 218 LEU O O N N 219 LEU CB C N N 220 LEU CG C N N 221 LEU CD1 C N N 222 LEU CD2 C N N 223 LEU OXT O N N 224 LEU H H N N 225 LEU H2 H N N 226 LEU HA H N N 227 LEU HB2 H N N 228 LEU HB3 H N N 229 LEU HG H N N 230 LEU HD11 H N N 231 LEU HD12 H N N 232 LEU HD13 H N N 233 LEU HD21 H N N 234 LEU HD22 H N N 235 LEU HD23 H N N 236 LEU HXT H N N 237 LYS N N N N 238 LYS CA C N S 239 LYS C C N N 240 LYS O O N N 241 LYS CB C N N 242 LYS CG C N N 243 LYS CD C N N 244 LYS CE C N N 245 LYS NZ N N N 246 LYS OXT O N N 247 LYS H H N N 248 LYS H2 H N N 249 LYS HA H N N 250 LYS HB2 H N N 251 LYS HB3 H N N 252 LYS HG2 H N N 253 LYS HG3 H N N 254 LYS HD2 H N N 255 LYS HD3 H N N 256 LYS HE2 H N N 257 LYS HE3 H N N 258 LYS HZ1 H N N 259 LYS HZ2 H N N 260 LYS HZ3 H N N 261 LYS HXT H N N 262 MET N N N N 263 MET CA C N S 264 MET C C N N 265 MET O O N N 266 MET CB C N N 267 MET CG C N N 268 MET SD S N N 269 MET CE C N N 270 MET OXT O N N 271 MET H H N N 272 MET H2 H N N 273 MET HA H N N 274 MET HB2 H N N 275 MET HB3 H N N 276 MET HG2 H N N 277 MET HG3 H N N 278 MET HE1 H N N 279 MET HE2 H N N 280 MET HE3 H N N 281 MET HXT H N N 282 NH2 N N N N 283 NH2 HN1 H N N 284 NH2 HN2 H N N 285 PHE N N N N 286 PHE CA C N S 287 PHE C C N N 288 PHE O O N N 289 PHE CB C N N 290 PHE CG C Y N 291 PHE CD1 C Y N 292 PHE CD2 C Y N 293 PHE CE1 C Y N 294 PHE CE2 C Y N 295 PHE CZ C Y N 296 PHE OXT O N N 297 PHE H H N N 298 PHE H2 H N N 299 PHE HA H N N 300 PHE HB2 H N N 301 PHE HB3 H N N 302 PHE HD1 H N N 303 PHE HD2 H N N 304 PHE HE1 H N N 305 PHE HE2 H N N 306 PHE HZ H N N 307 PHE HXT H N N 308 PRO N N N N 309 PRO CA C N S 310 PRO C C N N 311 PRO O O N N 312 PRO CB C N N 313 PRO CG C N N 314 PRO CD C N N 315 PRO OXT O N N 316 PRO H H N N 317 PRO HA H N N 318 PRO HB2 H N N 319 PRO HB3 H N N 320 PRO HG2 H N N 321 PRO HG3 H N N 322 PRO HD2 H N N 323 PRO HD3 H N N 324 PRO HXT H N N 325 SER N N N N 326 SER CA C N S 327 SER C C N N 328 SER O O N N 329 SER CB C N N 330 SER OG O N N 331 SER OXT O N N 332 SER H H N N 333 SER H2 H N N 334 SER HA H N N 335 SER HB2 H N N 336 SER HB3 H N N 337 SER HG H N N 338 SER HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 6ZS C2 CB sing N N 1 6ZS CB CA sing N N 2 6ZS CA CB1 sing N N 3 6ZS CA C sing N N 4 6ZS CA N sing N N 5 6ZS C O doub N N 6 6ZS C OXT sing N N 7 6ZS C2 H1 sing N N 8 6ZS C2 H4 sing N N 9 6ZS C2 H3 sing N N 10 6ZS N H sing N N 11 6ZS N H2 sing N N 12 6ZS CB1 H7 sing N N 13 6ZS CB1 H8 sing N N 14 6ZS CB1 H9 sing N N 15 6ZS CB H10 sing N N 16 6ZS CB H11 sing N N 17 6ZS OXT HXT sing N N 18 ALA N CA sing N N 19 ALA N H sing N N 20 ALA N H2 sing N N 21 ALA CA C sing N N 22 ALA CA CB sing N N 23 ALA CA HA sing N N 24 ALA C O doub N N 25 ALA C OXT sing N N 26 ALA CB HB1 sing N N 27 ALA CB HB2 sing N N 28 ALA CB HB3 sing N N 29 ALA OXT HXT sing N N 30 ARG N CA sing N N 31 ARG N H sing N N 32 ARG N H2 sing N N 33 ARG CA C sing N N 34 ARG CA CB sing N N 35 ARG CA HA sing N N 36 ARG C O doub N N 37 ARG C OXT sing N N 38 ARG CB CG sing N N 39 ARG CB HB2 sing N N 40 ARG CB HB3 sing N N 41 ARG CG CD sing N N 42 ARG CG HG2 sing N N 43 ARG CG HG3 sing N N 44 ARG CD NE sing N N 45 ARG CD HD2 sing N N 46 ARG CD HD3 sing N N 47 ARG NE CZ sing N N 48 ARG NE HE sing N N 49 ARG CZ NH1 sing N N 50 ARG CZ NH2 doub N N 51 ARG NH1 HH11 sing N N 52 ARG NH1 HH12 sing N N 53 ARG NH2 HH21 sing N N 54 ARG NH2 HH22 sing N N 55 ARG OXT HXT sing N N 56 ASN N CA sing N N 57 ASN N H sing N N 58 ASN N H2 sing N N 59 ASN CA C sing N N 60 ASN CA CB sing N N 61 ASN CA HA sing N N 62 ASN C O doub N N 63 ASN C OXT sing N N 64 ASN CB CG sing N N 65 ASN CB HB2 sing N N 66 ASN CB HB3 sing N N 67 ASN CG OD1 doub N N 68 ASN CG ND2 sing N N 69 ASN ND2 HD21 sing N N 70 ASN ND2 HD22 sing N N 71 ASN OXT HXT sing N N 72 ASP N CA sing N N 73 ASP N H sing N N 74 ASP N H2 sing N N 75 ASP CA C sing N N 76 ASP CA CB sing N N 77 ASP CA HA sing N N 78 ASP C O doub N N 79 ASP C OXT sing N N 80 ASP CB CG sing N N 81 ASP CB HB2 sing N N 82 ASP CB HB3 sing N N 83 ASP CG OD1 doub N N 84 ASP CG OD2 sing N N 85 ASP OD2 HD2 sing N N 86 ASP OXT HXT sing N N 87 CYS N CA sing N N 88 CYS N H sing N N 89 CYS N H2 sing N N 90 CYS CA C sing N N 91 CYS CA CB sing N N 92 CYS CA HA sing N N 93 CYS C O doub N N 94 CYS C OXT sing N N 95 CYS CB SG sing N N 96 CYS CB HB2 sing N N 97 CYS CB HB3 sing N N 98 CYS SG HG sing N N 99 CYS OXT HXT sing N N 100 DPR N CA sing N N 101 DPR N CD sing N N 102 DPR N H sing N N 103 DPR CA CB sing N N 104 DPR CA C sing N N 105 DPR CA HA sing N N 106 DPR CB CG sing N N 107 DPR CB HB2 sing N N 108 DPR CB HB3 sing N N 109 DPR CG CD sing N N 110 DPR CG HG2 sing N N 111 DPR CG HG3 sing N N 112 DPR CD HD2 sing N N 113 DPR CD HD3 sing N N 114 DPR C O doub N N 115 DPR C OXT sing N N 116 DPR OXT HXT sing N N 117 GLN N CA sing N N 118 GLN N H sing N N 119 GLN N H2 sing N N 120 GLN CA C sing N N 121 GLN CA CB sing N N 122 GLN CA HA sing N N 123 GLN C O doub N N 124 GLN C OXT sing N N 125 GLN CB CG sing N N 126 GLN CB HB2 sing N N 127 GLN CB HB3 sing N N 128 GLN CG CD sing N N 129 GLN CG HG2 sing N N 130 GLN CG HG3 sing N N 131 GLN CD OE1 doub N N 132 GLN CD NE2 sing N N 133 GLN NE2 HE21 sing N N 134 GLN NE2 HE22 sing N N 135 GLN OXT HXT sing N N 136 GLU N CA sing N N 137 GLU N H sing N N 138 GLU N H2 sing N N 139 GLU CA C sing N N 140 GLU CA CB sing N N 141 GLU CA HA sing N N 142 GLU C O doub N N 143 GLU C OXT sing N N 144 GLU CB CG sing N N 145 GLU CB HB2 sing N N 146 GLU CB HB3 sing N N 147 GLU CG CD sing N N 148 GLU CG HG2 sing N N 149 GLU CG HG3 sing N N 150 GLU CD OE1 doub N N 151 GLU CD OE2 sing N N 152 GLU OE2 HE2 sing N N 153 GLU OXT HXT sing N N 154 GLY N CA sing N N 155 GLY N H sing N N 156 GLY N H2 sing N N 157 GLY CA C sing N N 158 GLY CA HA2 sing N N 159 GLY CA HA3 sing N N 160 GLY C O doub N N 161 GLY C OXT sing N N 162 GLY OXT HXT sing N N 163 HIS N CA sing N N 164 HIS N H sing N N 165 HIS N H2 sing N N 166 HIS CA C sing N N 167 HIS CA CB sing N N 168 HIS CA HA sing N N 169 HIS C O doub N N 170 HIS C OXT sing N N 171 HIS CB CG sing N N 172 HIS CB HB2 sing N N 173 HIS CB HB3 sing N N 174 HIS CG ND1 sing Y N 175 HIS CG CD2 doub Y N 176 HIS ND1 CE1 doub Y N 177 HIS ND1 HD1 sing N N 178 HIS CD2 NE2 sing Y N 179 HIS CD2 HD2 sing N N 180 HIS CE1 NE2 sing Y N 181 HIS CE1 HE1 sing N N 182 HIS NE2 HE2 sing N N 183 HIS OXT HXT sing N N 184 ILE N CA sing N N 185 ILE N H sing N N 186 ILE N H2 sing N N 187 ILE CA C sing N N 188 ILE CA CB sing N N 189 ILE CA HA sing N N 190 ILE C O doub N N 191 ILE C OXT sing N N 192 ILE CB CG1 sing N N 193 ILE CB CG2 sing N N 194 ILE CB HB sing N N 195 ILE CG1 CD1 sing N N 196 ILE CG1 HG12 sing N N 197 ILE CG1 HG13 sing N N 198 ILE CG2 HG21 sing N N 199 ILE CG2 HG22 sing N N 200 ILE CG2 HG23 sing N N 201 ILE CD1 HD11 sing N N 202 ILE CD1 HD12 sing N N 203 ILE CD1 HD13 sing N N 204 ILE OXT HXT sing N N 205 LEU N CA sing N N 206 LEU N H sing N N 207 LEU N H2 sing N N 208 LEU CA C sing N N 209 LEU CA CB sing N N 210 LEU CA HA sing N N 211 LEU C O doub N N 212 LEU C OXT sing N N 213 LEU CB CG sing N N 214 LEU CB HB2 sing N N 215 LEU CB HB3 sing N N 216 LEU CG CD1 sing N N 217 LEU CG CD2 sing N N 218 LEU CG HG sing N N 219 LEU CD1 HD11 sing N N 220 LEU CD1 HD12 sing N N 221 LEU CD1 HD13 sing N N 222 LEU CD2 HD21 sing N N 223 LEU CD2 HD22 sing N N 224 LEU CD2 HD23 sing N N 225 LEU OXT HXT sing N N 226 LYS N CA sing N N 227 LYS N H sing N N 228 LYS N H2 sing N N 229 LYS CA C sing N N 230 LYS CA CB sing N N 231 LYS CA HA sing N N 232 LYS C O doub N N 233 LYS C OXT sing N N 234 LYS CB CG sing N N 235 LYS CB HB2 sing N N 236 LYS CB HB3 sing N N 237 LYS CG CD sing N N 238 LYS CG HG2 sing N N 239 LYS CG HG3 sing N N 240 LYS CD CE sing N N 241 LYS CD HD2 sing N N 242 LYS CD HD3 sing N N 243 LYS CE NZ sing N N 244 LYS CE HE2 sing N N 245 LYS CE HE3 sing N N 246 LYS NZ HZ1 sing N N 247 LYS NZ HZ2 sing N N 248 LYS NZ HZ3 sing N N 249 LYS OXT HXT sing N N 250 MET N CA sing N N 251 MET N H sing N N 252 MET N H2 sing N N 253 MET CA C sing N N 254 MET CA CB sing N N 255 MET CA HA sing N N 256 MET C O doub N N 257 MET C OXT sing N N 258 MET CB CG sing N N 259 MET CB HB2 sing N N 260 MET CB HB3 sing N N 261 MET CG SD sing N N 262 MET CG HG2 sing N N 263 MET CG HG3 sing N N 264 MET SD CE sing N N 265 MET CE HE1 sing N N 266 MET CE HE2 sing N N 267 MET CE HE3 sing N N 268 MET OXT HXT sing N N 269 NH2 N HN1 sing N N 270 NH2 N HN2 sing N N 271 PHE N CA sing N N 272 PHE N H sing N N 273 PHE N H2 sing N N 274 PHE CA C sing N N 275 PHE CA CB sing N N 276 PHE CA HA sing N N 277 PHE C O doub N N 278 PHE C OXT sing N N 279 PHE CB CG sing N N 280 PHE CB HB2 sing N N 281 PHE CB HB3 sing N N 282 PHE CG CD1 doub Y N 283 PHE CG CD2 sing Y N 284 PHE CD1 CE1 sing Y N 285 PHE CD1 HD1 sing N N 286 PHE CD2 CE2 doub Y N 287 PHE CD2 HD2 sing N N 288 PHE CE1 CZ doub Y N 289 PHE CE1 HE1 sing N N 290 PHE CE2 CZ sing Y N 291 PHE CE2 HE2 sing N N 292 PHE CZ HZ sing N N 293 PHE OXT HXT sing N N 294 PRO N CA sing N N 295 PRO N CD sing N N 296 PRO N H sing N N 297 PRO CA C sing N N 298 PRO CA CB sing N N 299 PRO CA HA sing N N 300 PRO C O doub N N 301 PRO C OXT sing N N 302 PRO CB CG sing N N 303 PRO CB HB2 sing N N 304 PRO CB HB3 sing N N 305 PRO CG CD sing N N 306 PRO CG HG2 sing N N 307 PRO CG HG3 sing N N 308 PRO CD HD2 sing N N 309 PRO CD HD3 sing N N 310 PRO OXT HXT sing N N 311 SER N CA sing N N 312 SER N H sing N N 313 SER N H2 sing N N 314 SER CA C sing N N 315 SER CA CB sing N N 316 SER CA HA sing N N 317 SER C O doub N N 318 SER C OXT sing N N 319 SER CB OG sing N N 320 SER CB HB2 sing N N 321 SER CB HB3 sing N N 322 SER OG HG sing N N 323 SER OXT HXT sing N N 324 TRP N CA sing N N 325 TRP N H sing N N 326 TRP N H2 sing N N 327 TRP CA C sing N N 328 TRP CA CB sing N N 329 TRP CA HA sing N N 330 TRP C O doub N N 331 TRP C OXT sing N N 332 TRP CB CG sing N N 333 TRP CB HB2 sing N N 334 TRP CB HB3 sing N N 335 TRP CG CD1 doub Y N 336 TRP CG CD2 sing Y N 337 TRP CD1 NE1 sing Y N 338 TRP CD1 HD1 sing N N 339 TRP CD2 CE2 doub Y N 340 TRP CD2 CE3 sing Y N 341 TRP NE1 CE2 sing Y N 342 TRP NE1 HE1 sing N N 343 TRP CE2 CZ2 sing Y N 344 TRP CE3 CZ3 doub Y N 345 TRP CE3 HE3 sing N N 346 TRP CZ2 CH2 doub Y N 347 TRP CZ2 HZ2 sing N N 348 TRP CZ3 CH2 sing Y N 349 TRP CZ3 HZ3 sing N N 350 TRP CH2 HH2 sing N N 351 TRP OXT HXT sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R35GM149220 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9E3Y _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #