data_9E6P # _entry.id 9E6P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9E6P pdb_00009e6p 10.2210/pdb9e6p/pdb WWPDB D_1000288858 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-11-12 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9E6P _pdbx_database_status.recvd_initial_deposition_date 2024-10-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Alternate assembly' _pdbx_database_related.db_id 9E6O _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email krrajara@utmb.edu _pdbx_contact_author.name_first Rajarathnam _pdbx_contact_author.name_last Krishna _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0077-700X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'White, M.A.' 1 0000-0003-1057-4203 'Sepuru, K.M.' 2 0000-0002-3675-6294 'Rajarathnam, K.' 3 0000-0002-0077-700X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of a Mouse KC dimeric mutant' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'White, M.A.' 1 0000-0003-1057-4203 primary 'Sepuru, K.M.' 2 0000-0002-3675-6294 primary 'Rajarathnam, K.' 3 0000-0002-0077-700X # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Growth-regulated alpha protein' _entity.formula_weight 7857.354 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation K28C _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'C-X-C motif chemokine 1,Platelet-derived growth factor-inducible protein KC,Secretory protein N51' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAPIANELRCQCLQTMAGIHLKNIQSLCVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK _entity_poly.pdbx_seq_one_letter_code_can GAPIANELRCQCLQTMAGIHLKNIQSLCVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 PRO n 1 4 ILE n 1 5 ALA n 1 6 ASN n 1 7 GLU n 1 8 LEU n 1 9 ARG n 1 10 CYS n 1 11 GLN n 1 12 CYS n 1 13 LEU n 1 14 GLN n 1 15 THR n 1 16 MET n 1 17 ALA n 1 18 GLY n 1 19 ILE n 1 20 HIS n 1 21 LEU n 1 22 LYS n 1 23 ASN n 1 24 ILE n 1 25 GLN n 1 26 SER n 1 27 LEU n 1 28 CYS n 1 29 VAL n 1 30 LEU n 1 31 PRO n 1 32 SER n 1 33 GLY n 1 34 PRO n 1 35 HIS n 1 36 CYS n 1 37 THR n 1 38 GLN n 1 39 THR n 1 40 GLU n 1 41 VAL n 1 42 ILE n 1 43 ALA n 1 44 THR n 1 45 LEU n 1 46 LYS n 1 47 ASN n 1 48 GLY n 1 49 ARG n 1 50 GLU n 1 51 ALA n 1 52 CYS n 1 53 LEU n 1 54 ASP n 1 55 PRO n 1 56 GLU n 1 57 ALA n 1 58 PRO n 1 59 LEU n 1 60 VAL n 1 61 GLN n 1 62 LYS n 1 63 ILE n 1 64 VAL n 1 65 GLN n 1 66 LYS n 1 67 MET n 1 68 LEU n 1 69 LYS n 1 70 GLY n 1 71 VAL n 1 72 PRO n 1 73 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 73 _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Cxcl1, Gro, Gro1, Mgsa, Scyb1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 PRO 3 3 ? ? ? A . n A 1 4 ILE 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 MET 67 67 67 MET MET A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 PRO 72 72 ? ? ? A . n A 1 73 LYS 73 73 ? ? ? A . n B 1 1 GLY 1 1 ? ? ? B . n B 1 2 ALA 2 2 ? ? ? B . n B 1 3 PRO 3 3 ? ? ? B . n B 1 4 ILE 4 4 ? ? ? B . n B 1 5 ALA 5 5 ? ? ? B . n B 1 6 ASN 6 6 ? ? ? B . n B 1 7 GLU 7 7 ? ? ? B . n B 1 8 LEU 8 8 8 LEU LEU B . n B 1 9 ARG 9 9 9 ARG ARG B . n B 1 10 CYS 10 10 10 CYS CYS B . n B 1 11 GLN 11 11 11 GLN GLN B . n B 1 12 CYS 12 12 12 CYS CYS B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 GLN 14 14 14 GLN GLN B . n B 1 15 THR 15 15 15 THR THR B . n B 1 16 MET 16 16 16 MET MET B . n B 1 17 ALA 17 17 17 ALA ALA B . n B 1 18 GLY 18 18 18 GLY GLY B . n B 1 19 ILE 19 19 19 ILE ILE B . n B 1 20 HIS 20 20 20 HIS HIS B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 LYS 22 22 22 LYS LYS B . n B 1 23 ASN 23 23 23 ASN ASN B . n B 1 24 ILE 24 24 24 ILE ILE B . n B 1 25 GLN 25 25 25 GLN GLN B . n B 1 26 SER 26 26 26 SER SER B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 CYS 28 28 28 CYS CYS B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 PRO 31 31 31 PRO PRO B . n B 1 32 SER 32 32 32 SER SER B . n B 1 33 GLY 33 33 33 GLY GLY B . n B 1 34 PRO 34 34 34 PRO PRO B . n B 1 35 HIS 35 35 35 HIS HIS B . n B 1 36 CYS 36 36 36 CYS CYS B . n B 1 37 THR 37 37 37 THR THR B . n B 1 38 GLN 38 38 38 GLN GLN B . n B 1 39 THR 39 39 39 THR THR B . n B 1 40 GLU 40 40 40 GLU GLU B . n B 1 41 VAL 41 41 41 VAL VAL B . n B 1 42 ILE 42 42 42 ILE ILE B . n B 1 43 ALA 43 43 43 ALA ALA B . n B 1 44 THR 44 44 44 THR THR B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 LYS 46 46 46 LYS LYS B . n B 1 47 ASN 47 47 47 ASN ASN B . n B 1 48 GLY 48 48 48 GLY GLY B . n B 1 49 ARG 49 49 49 ARG ARG B . n B 1 50 GLU 50 50 50 GLU GLU B . n B 1 51 ALA 51 51 51 ALA ALA B . n B 1 52 CYS 52 52 52 CYS CYS B . n B 1 53 LEU 53 53 53 LEU LEU B . n B 1 54 ASP 54 54 54 ASP ASP B . n B 1 55 PRO 55 55 55 PRO PRO B . n B 1 56 GLU 56 56 56 GLU GLU B . n B 1 57 ALA 57 57 57 ALA ALA B . n B 1 58 PRO 58 58 58 PRO PRO B . n B 1 59 LEU 59 59 59 LEU LEU B . n B 1 60 VAL 60 60 60 VAL VAL B . n B 1 61 GLN 61 61 61 GLN GLN B . n B 1 62 LYS 62 62 62 LYS LYS B . n B 1 63 ILE 63 63 63 ILE ILE B . n B 1 64 VAL 64 64 64 VAL VAL B . n B 1 65 GLN 65 65 65 GLN GLN B . n B 1 66 LYS 66 66 66 LYS LYS B . n B 1 67 MET 67 67 67 MET MET B . n B 1 68 LEU 68 68 68 LEU LEU B . n B 1 69 LYS 69 69 69 LYS LYS B . n B 1 70 GLY 70 70 70 GLY GLY B . n B 1 71 VAL 71 71 71 VAL VAL B . n B 1 72 PRO 72 72 ? ? ? B . n B 1 73 LYS 73 73 ? ? ? B . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 7 ? CG ? A GLU 7 CG 2 1 Y 1 A GLU 7 ? CD ? A GLU 7 CD 3 1 Y 1 A GLU 7 ? OE1 ? A GLU 7 OE1 4 1 Y 1 A GLU 7 ? OE2 ? A GLU 7 OE2 5 1 Y 1 A LYS 22 ? CG ? A LYS 22 CG 6 1 Y 1 A LYS 22 ? CD ? A LYS 22 CD 7 1 Y 1 A LYS 22 ? CE ? A LYS 22 CE 8 1 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 9 1 Y 1 A LEU 59 ? CG ? A LEU 59 CG 10 1 Y 1 A LEU 59 ? CD1 ? A LEU 59 CD1 11 1 Y 1 A LEU 59 ? CD2 ? A LEU 59 CD2 12 1 Y 1 A LYS 62 ? CD ? A LYS 62 CD 13 1 Y 1 A LYS 62 ? CE ? A LYS 62 CE 14 1 Y 1 A LYS 62 ? NZ ? A LYS 62 NZ 15 1 Y 1 A GLN 65 ? CG ? A GLN 65 CG 16 1 Y 1 A GLN 65 ? CD ? A GLN 65 CD 17 1 Y 1 A GLN 65 ? OE1 ? A GLN 65 OE1 18 1 Y 1 A GLN 65 ? NE2 ? A GLN 65 NE2 19 1 Y 1 A LYS 66 ? CD ? A LYS 66 CD 20 1 Y 1 A LYS 66 ? CE ? A LYS 66 CE 21 1 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 22 1 Y 1 B LYS 22 ? CG ? B LYS 22 CG 23 1 Y 1 B LYS 22 ? CD ? B LYS 22 CD 24 1 Y 1 B LYS 22 ? CE ? B LYS 22 CE 25 1 Y 1 B LYS 22 ? NZ ? B LYS 22 NZ 26 1 Y 1 B LYS 46 ? CG ? B LYS 46 CG 27 1 Y 1 B LYS 46 ? CD ? B LYS 46 CD 28 1 Y 1 B LYS 46 ? CE ? B LYS 46 CE 29 1 Y 1 B LYS 46 ? NZ ? B LYS 46 NZ 30 1 Y 1 B LEU 59 ? CG ? B LEU 59 CG 31 1 Y 1 B LEU 59 ? CD1 ? B LEU 59 CD1 32 1 Y 1 B LEU 59 ? CD2 ? B LEU 59 CD2 33 1 Y 1 B LYS 62 ? CG ? B LYS 62 CG 34 1 Y 1 B LYS 62 ? CD ? B LYS 62 CD 35 1 Y 1 B LYS 62 ? CE ? B LYS 62 CE 36 1 Y 1 B LYS 62 ? NZ ? B LYS 62 NZ 37 1 Y 1 B LYS 66 ? CG ? B LYS 66 CG 38 1 Y 1 B LYS 66 ? CD ? B LYS 66 CD 39 1 Y 1 B LYS 66 ? CE ? B LYS 66 CE 40 1 Y 1 B LYS 66 ? NZ ? B LYS 66 NZ 41 1 Y 1 B LYS 69 ? CE ? B LYS 69 CE 42 1 Y 1 B LYS 69 ? NZ ? B LYS 69 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? v722 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? v722 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9E6P _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.859 _cell.length_a_esd ? _cell.length_b 72.184 _cell.length_b_esd ? _cell.length_c 42.810 _cell.length_c_esd ? _cell.volume 138623.149 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9E6P _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall 'P 2 2ab' _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9E6P _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;12% PEG-500MME, 6% PEG-20000, 100 mM of Bicine-Tris (base) pH 8.5, with 100 mM of Molecular Dimension's Carboxylic acids mixture II ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-06-03 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Confocal Multilayer' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E+ SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 47.86 _reflns.entry_id 9E6P _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.2 _reflns.d_resolution_low 30.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 2854 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.894 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.351 _reflns.pdbx_Rpim_I_all 0.121 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.931 _reflns.pdbx_CC_star 0.982 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.2 _reflns_shell.d_res_low 3.35 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 302 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.1 _reflns_shell.pdbx_chi_squared 0.556 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.975 _reflns_shell.pdbx_Rpim_I_all 0.682 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.731 _reflns_shell.pdbx_CC_star 0.919 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 42.26 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9E6P _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.20 _refine.ls_d_res_low 28.46 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 2850 _refine.ls_number_reflns_R_free 287 _refine.ls_number_reflns_R_work 2563 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 64.45 _refine.ls_percent_reflns_R_free 10.07 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2365 _refine.ls_R_factor_R_free 0.2801 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2312 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.44 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.4855 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4259 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 28.46 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 929 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 929 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0030 ? 939 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7355 ? 1278 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0469 ? 163 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0052 ? 166 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 4.1822 ? 131 ? f_dihedral_angle_d ? ? # _refine_ls_restr_ncs.pdbx_ordinal 1 _refine_ls_restr_ncs.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_restr_ncs.dom_id d_2 _refine_ls_restr_ncs.pdbx_ens_id ens_1 _refine_ls_restr_ncs.rms_dev_position 1.11312318099 _refine_ls_restr_ncs.weight_position ? _refine_ls_restr_ncs.rms_dev_B_iso ? _refine_ls_restr_ncs.weight_B_iso ? _refine_ls_restr_ncs.pdbx_type 'Torsion NCS' _refine_ls_restr_ncs.pdbx_asym_id A _refine_ls_restr_ncs.pdbx_auth_asym_id A _refine_ls_restr_ncs.pdbx_number ? _refine_ls_restr_ncs.pdbx_rms ? _refine_ls_restr_ncs.pdbx_weight ? _refine_ls_restr_ncs.ncs_model_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.20 4.03 . . 90 860 43.06 . . . . 0.2939 . . . . . . . . . . . 0.3739 'X-RAY DIFFRACTION' 4.03 28.46 . . 197 1703 85.82 . . . . 0.2061 . . . . . . . . . . . 0.2495 # _struct_ncs_oper.id 1 _struct_ncs_oper.code given _struct_ncs_oper.matrix[1][1] -0.826986617907 _struct_ncs_oper.matrix[1][2] 0.147746418562 _struct_ncs_oper.matrix[1][3] 0.54246117797 _struct_ncs_oper.matrix[2][1] 0.184541565209 _struct_ncs_oper.matrix[2][2] -0.840062212013 _struct_ncs_oper.matrix[2][3] 0.510137129269 _struct_ncs_oper.matrix[3][1] 0.531072070922 _struct_ncs_oper.matrix[3][2] 0.521983214051 _struct_ncs_oper.matrix[3][3] 0.667454852208 _struct_ncs_oper.vector[1] -22.3730897817 _struct_ncs_oper.vector[2] 34.6458211793 _struct_ncs_oper.vector[3] -3.30314066403 _struct_ncs_oper.details ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details ens_1 d_1 ;(chain "A" and (resid 10 through 13 or resid 15 through 45 or (resid 46 and (name N or name CA or name C or name O or name CB )) or resid 47 through 61 or (resid 62 and (name N or name CA or name C or name O or name CB )) or resid 63 through 65 or (resid 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 68 or (resid 69 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 70 through 71)) ; ens_1 d_2 ;(chain "B" and (resid 10 through 13 or resid 15 through 64 or (resid 65 through 66 and (name N or name CA or name C or name O or name CB )) or resid 67 through 71)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details ens_1 d_1 1 A CYS 10 . A LEU 13 . A CYS 10 A LEU 13 ? ? ens_1 d_1 2 A THR 15 . A VAL 71 . A THR 15 A VAL 71 ? ? ens_1 d_2 1 B CYS 10 . B LEU 13 . B CYS 10 B LEU 13 ? ? ens_1 d_2 2 B THR 15 . B VAL 71 . B THR 15 B VAL 71 ? ? # _struct_ncs_ens.id ens_1 _struct_ncs_ens.details ? # _struct_ncs_ens_gen.ens_id ens_1 _struct_ncs_ens_gen.dom_id_1 d_2 _struct_ncs_ens_gen.dom_id_2 d_1 _struct_ncs_ens_gen.oper_id 1 # _struct.entry_id 9E6P _struct.title 'Structure of a Mouse KC dimeric mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9E6P _struct_keywords.text 'CHEMOKINE(GROWTH FACTOR), CYTOKINE' _struct_keywords.pdbx_keywords CYTOKINE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GROA_MOUSE _struct_ref.pdbx_db_accession P12850 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK _struct_ref.pdbx_align_begin 24 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9E6P A 1 ? 73 ? P12850 24 ? 96 ? 1 73 2 1 9E6P B 1 ? 73 ? P12850 24 ? 96 ? 1 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9E6P CYS A 28 ? UNP P12850 LYS 51 'engineered mutation' 28 1 2 9E6P CYS B 28 ? UNP P12850 LYS 51 'engineered mutation' 28 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1670 ? 1 MORE -13 ? 1 'SSA (A^2)' 7430 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR relaxation study' _pdbx_struct_assembly_auth_evidence.details 'NMR and analytical ultracentrufigation have both confirmed that the KC K28C mutation produces a dimer in solution.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 20 ? LYS A 22 ? HIS A 20 LYS A 22 5 ? 3 HELX_P HELX_P2 AA2 ALA A 57 ? LYS A 69 ? ALA A 57 LYS A 69 1 ? 13 HELX_P HELX_P3 AA3 ALA B 57 ? GLY B 70 ? ALA B 57 GLY B 70 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 10 A CYS 36 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 12 A CYS 52 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf3 disulf ? ? A CYS 28 SG ? ? ? 1_555 B CYS 28 SG ? ? A CYS 28 B CYS 28 1_555 ? ? ? ? ? ? ? 2.045 ? ? disulf4 disulf ? ? B CYS 10 SG ? ? ? 1_555 B CYS 36 SG ? ? B CYS 10 B CYS 36 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf5 disulf ? ? B CYS 12 SG ? ? ? 1_555 B CYS 52 SG ? ? B CYS 12 B CYS 52 1_555 ? ? ? ? ? ? ? 2.034 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 10 ? CYS A 36 ? CYS A 10 ? 1_555 CYS A 36 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 12 ? CYS A 52 ? CYS A 12 ? 1_555 CYS A 52 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 28 ? CYS B 28 ? CYS A 28 ? 1_555 CYS B 28 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS B 10 ? CYS B 36 ? CYS B 10 ? 1_555 CYS B 36 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS B 12 ? CYS B 52 ? CYS B 12 ? 1_555 CYS B 52 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 50 ? LEU A 53 ? GLU A 50 LEU A 53 AA1 2 GLU A 40 ? LEU A 45 ? GLU A 40 LEU A 45 AA1 3 ILE A 24 ? LEU A 30 ? ILE A 24 LEU A 30 AA1 4 ILE B 24 ? LEU B 30 ? ILE B 24 LEU B 30 AA1 5 GLU B 40 ? LEU B 45 ? GLU B 40 LEU B 45 AA1 6 GLU B 50 ? LEU B 53 ? GLU B 50 LEU B 53 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 53 ? O LEU A 53 N VAL A 41 ? N VAL A 41 AA1 2 3 O GLU A 40 ? O GLU A 40 N LEU A 30 ? N LEU A 30 AA1 3 4 N LEU A 27 ? N LEU A 27 O VAL B 29 ? O VAL B 29 AA1 4 5 N LEU B 30 ? N LEU B 30 O GLU B 40 ? O GLU B 40 AA1 5 6 N ALA B 43 ? N ALA B 43 O ALA B 51 ? O ALA B 51 # _pdbx_entry_details.entry_id 9E6P _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 14 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -173.58 _pdbx_validate_torsion.psi 146.68 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x+1/2,y+1/2,-z 4 -x,-y,z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -23.0588745787 10.4462873035 -9.74610951876 0.129792579747 ? -0.00921304946466 ? -0.065328731099 ? 0.194233437582 ? -0.0854494939627 ? 0.175712310502 ? 0.190215363833 ? 0.104597333819 ? -0.0527832823529 ? 0.151434074114 ? -0.0858165358493 ? 0.420060880726 ? -0.00607042978544 ? -0.0606352734396 ? 0.085952144294 ? 0.0554519019737 ? 0.0401699505722 ? -0.0111277861875 ? 0.114304170213 ? -0.161039808918 ? 0.211879294064 ? 2 'X-RAY DIFFRACTION' ? refined -19.4135564817 6.12009309734 -9.54458734945 0.254591910164 ? -0.223687297359 ? -0.0261564402928 ? 0.139136491309 ? -0.0710109594685 ? 0.126158009261 ? 0.233137003804 ? 0.092424794485 ? 0.126604229921 ? 0.163866068731 ? 0.110432862502 ? 0.0992054589244 ? -0.0452654929636 ? -0.0394870372336 ? 0.137751709336 ? -0.117253428909 ? 0.00181719765494 ? 0.0645911000974 ? 0.0990262559818 ? -0.0673252113097 ? -0.0515774660213 ? 3 'X-RAY DIFFRACTION' ? refined -9.65375929238 11.3246184463 -2.5109120349 0.560856362899 ? 0.073836380407 ? -0.181650327408 ? 0.590922736154 ? -0.190093954601 ? 0.389596429332 ? 0.278172991059 ? 0.0285638152381 ? -0.114243611211 ? 0.67764924317 ? -0.414461903345 ? 0.291126238743 ? 0.0525266029766 ? -0.125561678794 ? -0.105924236026 ? 0.0739827689451 ? 0.17213411425 ? -0.0612506401459 ? -0.372014318453 ? 0.0718060449933 ? 0.0707508830431 ? 4 'X-RAY DIFFRACTION' ? refined -7.61113606891 16.7456858614 -16.4244301651 0.262581277439 ? -0.356818858681 ? -0.270531920879 ? -0.00872296227288 ? -0.0421270959884 ? 0.211290699129 ? 0.563700068187 ? 0.203438203441 ? -0.00666607525528 ? 0.0771713132381 ? 0.0163696537715 ? 0.140555833294 ? 0.0710092826452 ? -0.118161146426 ? 0.206162495696 ? 0.0703390482327 ? -0.0196449764936 ? 0.086935432078 ? -0.103873545181 ? 0.0257132422692 ? 0.775359017386 ? 5 'X-RAY DIFFRACTION' ? refined -10.7505499065 22.3586334354 -17.1539948143 0.141860943322 ? -0.00145867604545 ? 0.0648895252123 ? 0.0784910508157 ? 0.00591818780737 ? 0.414289793022 ? 0.0737819865177 ? -0.153130765315 ? -0.020054608707 ? 0.602310003178 ? 0.306696361146 ? 0.247316249502 ? -0.000257101014246 ? 0.0631806008343 ? 0.0801257321709 ? 0.195950383971 ? 0.0796711291887 ? 0.188727118165 ? 0.0249910390548 ? -0.0573174151705 ? 0.103390271382 ? 6 'X-RAY DIFFRACTION' ? refined -13.7080975495 21.5039215929 -4.44426159331 0.282794046465 ? -0.0669939045127 ? -0.0418034236308 ? 0.581909263228 ? -0.116790207618 ? 0.18853748711 ? 0.0322324332734 ? 0.0201590887666 ? 0.00453232309197 ? 0.061658424513 ? -0.0352435095162 ? 0.0569463003107 ? 0.119438104286 ? 0.0247567782303 ? -0.0219870845182 ? 0.0816719143927 ? -0.110606015752 ? -0.00132216703813 ? 0.0924952197843 ? 0.100766619538 ? -0.0704157625859 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 7 ? A 33 A 39 ? ? ;chain 'A' and (resid 7 through 39 ) ; 2 'X-RAY DIFFRACTION' 2 A 34 A 40 ? A 51 A 57 ? ? ;chain 'A' and (resid 40 through 57 ) ; 3 'X-RAY DIFFRACTION' 3 A 52 A 58 ? A 65 A 71 ? ? ;chain 'A' and (resid 58 through 71 ) ; 4 'X-RAY DIFFRACTION' 4 B 1 B 8 ? B 35 B 42 ? ? ;chain 'B' and (resid 8 through 42 ) ; 5 'X-RAY DIFFRACTION' 5 B 36 B 43 ? B 50 B 57 ? ? ;chain 'B' and (resid 43 through 57 ) ; 6 'X-RAY DIFFRACTION' 6 B 51 B 58 ? B 64 B 71 ? ? ;chain 'B' and (resid 58 through 71 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A PRO 3 ? A PRO 3 4 1 Y 1 A ILE 4 ? A ILE 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A ASN 6 ? A ASN 6 7 1 Y 1 A PRO 72 ? A PRO 72 8 1 Y 1 A LYS 73 ? A LYS 73 9 1 Y 1 B GLY 1 ? B GLY 1 10 1 Y 1 B ALA 2 ? B ALA 2 11 1 Y 1 B PRO 3 ? B PRO 3 12 1 Y 1 B ILE 4 ? B ILE 4 13 1 Y 1 B ALA 5 ? B ALA 5 14 1 Y 1 B ASN 6 ? B ASN 6 15 1 Y 1 B GLU 7 ? B GLU 7 16 1 Y 1 B PRO 72 ? B PRO 72 17 1 Y 1 B LYS 73 ? B LYS 73 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PRO N N N N 247 PRO CA C N S 248 PRO C C N N 249 PRO O O N N 250 PRO CB C N N 251 PRO CG C N N 252 PRO CD C N N 253 PRO OXT O N N 254 PRO H H N N 255 PRO HA H N N 256 PRO HB2 H N N 257 PRO HB3 H N N 258 PRO HG2 H N N 259 PRO HG3 H N N 260 PRO HD2 H N N 261 PRO HD3 H N N 262 PRO HXT H N N 263 SER N N N N 264 SER CA C N S 265 SER C C N N 266 SER O O N N 267 SER CB C N N 268 SER OG O N N 269 SER OXT O N N 270 SER H H N N 271 SER H2 H N N 272 SER HA H N N 273 SER HB2 H N N 274 SER HB3 H N N 275 SER HG H N N 276 SER HXT H N N 277 THR N N N N 278 THR CA C N S 279 THR C C N N 280 THR O O N N 281 THR CB C N R 282 THR OG1 O N N 283 THR CG2 C N N 284 THR OXT O N N 285 THR H H N N 286 THR H2 H N N 287 THR HA H N N 288 THR HB H N N 289 THR HG1 H N N 290 THR HG21 H N N 291 THR HG22 H N N 292 THR HG23 H N N 293 THR HXT H N N 294 VAL N N N N 295 VAL CA C N S 296 VAL C C N N 297 VAL O O N N 298 VAL CB C N N 299 VAL CG1 C N N 300 VAL CG2 C N N 301 VAL OXT O N N 302 VAL H H N N 303 VAL H2 H N N 304 VAL HA H N N 305 VAL HB H N N 306 VAL HG11 H N N 307 VAL HG12 H N N 308 VAL HG13 H N N 309 VAL HG21 H N N 310 VAL HG22 H N N 311 VAL HG23 H N N 312 VAL HXT H N N 313 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PRO N CA sing N N 235 PRO N CD sing N N 236 PRO N H sing N N 237 PRO CA C sing N N 238 PRO CA CB sing N N 239 PRO CA HA sing N N 240 PRO C O doub N N 241 PRO C OXT sing N N 242 PRO CB CG sing N N 243 PRO CB HB2 sing N N 244 PRO CB HB3 sing N N 245 PRO CG CD sing N N 246 PRO CG HG2 sing N N 247 PRO CG HG3 sing N N 248 PRO CD HD2 sing N N 249 PRO CD HD3 sing N N 250 PRO OXT HXT sing N N 251 SER N CA sing N N 252 SER N H sing N N 253 SER N H2 sing N N 254 SER CA C sing N N 255 SER CA CB sing N N 256 SER CA HA sing N N 257 SER C O doub N N 258 SER C OXT sing N N 259 SER CB OG sing N N 260 SER CB HB2 sing N N 261 SER CB HB3 sing N N 262 SER OG HG sing N N 263 SER OXT HXT sing N N 264 THR N CA sing N N 265 THR N H sing N N 266 THR N H2 sing N N 267 THR CA C sing N N 268 THR CA CB sing N N 269 THR CA HA sing N N 270 THR C O doub N N 271 THR C OXT sing N N 272 THR CB OG1 sing N N 273 THR CB CG2 sing N N 274 THR CB HB sing N N 275 THR OG1 HG1 sing N N 276 THR CG2 HG21 sing N N 277 THR CG2 HG22 sing N N 278 THR CG2 HG23 sing N N 279 THR OXT HXT sing N N 280 VAL N CA sing N N 281 VAL N H sing N N 282 VAL N H2 sing N N 283 VAL CA C sing N N 284 VAL CA CB sing N N 285 VAL CA HA sing N N 286 VAL C O doub N N 287 VAL C OXT sing N N 288 VAL CB CG1 sing N N 289 VAL CB CG2 sing N N 290 VAL CB HB sing N N 291 VAL CG1 HG11 sing N N 292 VAL CG1 HG12 sing N N 293 VAL CG1 HG13 sing N N 294 VAL CG2 HG21 sing N N 295 VAL CG2 HG22 sing N N 296 VAL CG2 HG23 sing N N 297 VAL OXT HXT sing N N 298 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number AI160613 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list 1 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1mgs _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 21 2' _space_group.name_Hall 'P 2 2ab' _space_group.IT_number 18 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9E6P _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.022292 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013853 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023359 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.99627 ? ? ? 14.84254 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #