data_9E9A # _entry.id 9E9A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9E9A pdb_00009e9a 10.2210/pdb9e9a/pdb WWPDB D_1000289840 ? ? BMRB 31212 ? 10.13018/BMR31212 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-12-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9E9A _pdbx_database_status.recvd_initial_deposition_date 2024-11-07 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB ;Solution structure of an uncharacterized protein containing a DUF1893 domain from Borrelia burgdorferi, a pathogen responsible for Lyme disease. Seattle Structural Genomics Center for Infectious Disease target BobuA.17726.a.A1. ; 31212 unspecified TargetTrack . BobuA.17726.a.A1 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email garry.buchko@pnnl.gov _pdbx_contact_author.name_first Garry _pdbx_contact_author.name_last Buchko _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3639-1061 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Buchko, G.W.' 1 0000-0002-3639-1061 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structural characterization of a DUF1893 domain containing protein from Borrelia burgdorferi, a pathogen responsible for Lyme disease. ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 0000-0002-3639-1061 primary 'van Voorhis, W.C.' 2 ? primary 'Myler, P.J.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DUF1893 domain-containing protein' _entity.formula_weight 17005.676 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHMGTLEAQTQGPGSMISGLNPTLRLFKDHKILYSNMERGLKPLLEVDNFINKYIQNKEGLEIYDKVVGKAAAV IIYNIGLQNVQAGVVSQPAKDFLESRGIKVAYKKLVEKINDRAESLIESLENPEEVYKYMIKRGIIVNNL ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHMGTLEAQTQGPGSMISGLNPTLRLFKDHKILYSNMERGLKPLLEVDNFINKYIQNKEGLEIYDKVVGKAAAV IIYNIGLQNVQAGVVSQPAKDFLESRGIKVAYKKLVEKINDRAESLIESLENPEEVYKYMIKRGIIVNNL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BobuA.17726.a.A1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 MET n 1 10 GLY n 1 11 THR n 1 12 LEU n 1 13 GLU n 1 14 ALA n 1 15 GLN n 1 16 THR n 1 17 GLN n 1 18 GLY n 1 19 PRO n 1 20 GLY n 1 21 SER n 1 22 MET n 1 23 ILE n 1 24 SER n 1 25 GLY n 1 26 LEU n 1 27 ASN n 1 28 PRO n 1 29 THR n 1 30 LEU n 1 31 ARG n 1 32 LEU n 1 33 PHE n 1 34 LYS n 1 35 ASP n 1 36 HIS n 1 37 LYS n 1 38 ILE n 1 39 LEU n 1 40 TYR n 1 41 SER n 1 42 ASN n 1 43 MET n 1 44 GLU n 1 45 ARG n 1 46 GLY n 1 47 LEU n 1 48 LYS n 1 49 PRO n 1 50 LEU n 1 51 LEU n 1 52 GLU n 1 53 VAL n 1 54 ASP n 1 55 ASN n 1 56 PHE n 1 57 ILE n 1 58 ASN n 1 59 LYS n 1 60 TYR n 1 61 ILE n 1 62 GLN n 1 63 ASN n 1 64 LYS n 1 65 GLU n 1 66 GLY n 1 67 LEU n 1 68 GLU n 1 69 ILE n 1 70 TYR n 1 71 ASP n 1 72 LYS n 1 73 VAL n 1 74 VAL n 1 75 GLY n 1 76 LYS n 1 77 ALA n 1 78 ALA n 1 79 ALA n 1 80 VAL n 1 81 ILE n 1 82 ILE n 1 83 TYR n 1 84 ASN n 1 85 ILE n 1 86 GLY n 1 87 LEU n 1 88 GLN n 1 89 ASN n 1 90 VAL n 1 91 GLN n 1 92 ALA n 1 93 GLY n 1 94 VAL n 1 95 VAL n 1 96 SER n 1 97 GLN n 1 98 PRO n 1 99 ALA n 1 100 LYS n 1 101 ASP n 1 102 PHE n 1 103 LEU n 1 104 GLU n 1 105 SER n 1 106 ARG n 1 107 GLY n 1 108 ILE n 1 109 LYS n 1 110 VAL n 1 111 ALA n 1 112 TYR n 1 113 LYS n 1 114 LYS n 1 115 LEU n 1 116 VAL n 1 117 GLU n 1 118 LYS n 1 119 ILE n 1 120 ASN n 1 121 ASP n 1 122 ARG n 1 123 ALA n 1 124 GLU n 1 125 SER n 1 126 LEU n 1 127 ILE n 1 128 GLU n 1 129 SER n 1 130 LEU n 1 131 GLU n 1 132 ASN n 1 133 PRO n 1 134 GLU n 1 135 GLU n 1 136 VAL n 1 137 TYR n 1 138 LYS n 1 139 TYR n 1 140 MET n 1 141 ILE n 1 142 LYS n 1 143 ARG n 1 144 GLY n 1 145 ILE n 1 146 ILE n 1 147 VAL n 1 148 ASN n 1 149 ASN n 1 150 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 150 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BB_0429 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Borreliella burgdorferi B31' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224326 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 LEU 150 150 150 LEU LEU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9E9A _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9E9A _struct.title ;Solution structure of an uncharacterized protein containing a DUF1893 domain from Borrelia burgdorferi, a pathogen responsible for Lyme disease. Seattle Structural Genomics Center for Infectious Disease target BobuA.17726.a.A1. ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9E9A _struct_keywords.text ;Lyme disease, DUFs, cytosine deaminase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, UNKNOWN FUNCTION ; _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O51390_BORBU _struct_ref.pdbx_db_accession O51390 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MISGLNPTLRLFKDHKILYSNMERGLKPLLEVDNFINKYIQNKEGLEIYDKVVGKAAAVIIYNIGLQNVQAGVVSQPAKD FLESRGIKVAYKKLVEKINDRAESLIESLENPEEVYKYMIKRGIIVNNL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9E9A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 150 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O51390 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 129 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 22 _struct_ref_seq.pdbx_auth_seq_align_end 150 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9E9A MET A 1 ? UNP O51390 ? ? 'initiating methionine' 1 1 1 9E9A ALA A 2 ? UNP O51390 ? ? 'expression tag' 2 2 1 9E9A HIS A 3 ? UNP O51390 ? ? 'expression tag' 3 3 1 9E9A HIS A 4 ? UNP O51390 ? ? 'expression tag' 4 4 1 9E9A HIS A 5 ? UNP O51390 ? ? 'expression tag' 5 5 1 9E9A HIS A 6 ? UNP O51390 ? ? 'expression tag' 6 6 1 9E9A HIS A 7 ? UNP O51390 ? ? 'expression tag' 7 7 1 9E9A HIS A 8 ? UNP O51390 ? ? 'expression tag' 8 8 1 9E9A MET A 9 ? UNP O51390 ? ? 'expression tag' 9 9 1 9E9A GLY A 10 ? UNP O51390 ? ? 'expression tag' 10 10 1 9E9A THR A 11 ? UNP O51390 ? ? 'expression tag' 11 11 1 9E9A LEU A 12 ? UNP O51390 ? ? 'expression tag' 12 12 1 9E9A GLU A 13 ? UNP O51390 ? ? 'expression tag' 13 13 1 9E9A ALA A 14 ? UNP O51390 ? ? 'expression tag' 14 14 1 9E9A GLN A 15 ? UNP O51390 ? ? 'expression tag' 15 15 1 9E9A THR A 16 ? UNP O51390 ? ? 'expression tag' 16 16 1 9E9A GLN A 17 ? UNP O51390 ? ? 'expression tag' 17 17 1 9E9A GLY A 18 ? UNP O51390 ? ? 'expression tag' 18 18 1 9E9A PRO A 19 ? UNP O51390 ? ? 'expression tag' 19 19 1 9E9A GLY A 20 ? UNP O51390 ? ? 'expression tag' 20 20 1 9E9A SER A 21 ? UNP O51390 ? ? 'expression tag' 21 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ;Size exclusion chromatography was consistent with a monomer as was a NMR measured tauC. Moreover, at 150 residues poorer NMR data would be expected if it was a dimer (deuteration would be necessary to make the assignments). One oddity is that it was not possible to assign any of the methyl groups for the 15 leucine residues. ; # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 49 ? PHE A 56 ? PRO A 49 PHE A 56 1 ? 8 HELX_P HELX_P2 AA2 PHE A 56 ? ILE A 61 ? PHE A 56 ILE A 61 1 ? 6 HELX_P HELX_P3 AA3 GLY A 75 ? GLY A 86 ? GLY A 75 GLY A 86 1 ? 12 HELX_P HELX_P4 AA4 SER A 96 ? ARG A 106 ? SER A 96 ARG A 106 1 ? 11 HELX_P HELX_P5 AA5 ARG A 122 ? ILE A 127 ? ARG A 122 ILE A 127 1 ? 6 HELX_P HELX_P6 AA6 ASN A 132 ? GLY A 144 ? ASN A 132 GLY A 144 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 37 ? ASN A 42 ? LYS A 37 ASN A 42 AA1 2 LEU A 30 ? LYS A 34 ? LEU A 30 LYS A 34 AA1 3 GLU A 68 ? TYR A 70 ? GLU A 68 TYR A 70 AA1 4 ASN A 89 ? GLN A 91 ? ASN A 89 GLN A 91 AA1 5 LYS A 109 ? ALA A 111 ? LYS A 109 ALA A 111 AA2 1 VAL A 73 ? VAL A 74 ? VAL A 73 VAL A 74 AA2 2 VAL A 94 ? VAL A 95 ? VAL A 94 VAL A 95 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ASN A 42 ? O ASN A 42 N LEU A 30 ? N LEU A 30 AA1 2 3 N PHE A 33 ? N PHE A 33 O GLU A 68 ? O GLU A 68 AA1 3 4 N ILE A 69 ? N ILE A 69 O ASN A 89 ? O ASN A 89 AA1 4 5 N VAL A 90 ? N VAL A 90 O LYS A 109 ? O LYS A 109 AA2 1 2 N VAL A 74 ? N VAL A 74 O VAL A 94 ? O VAL A 94 # _pdbx_entry_details.entry_id 9E9A _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 27 ? ? 70.10 155.66 2 1 PRO A 28 ? ? -69.94 97.63 3 1 ASN A 63 ? ? -97.05 34.29 4 1 LYS A 72 ? ? -91.66 -63.90 5 1 LYS A 114 ? ? -173.35 136.02 6 1 ASN A 120 ? ? -66.40 88.85 7 2 ASN A 27 ? ? 68.35 127.63 8 2 PHE A 56 ? ? -113.30 64.41 9 2 ASN A 63 ? ? -140.63 17.98 10 2 LYS A 64 ? ? -98.68 34.99 11 2 LYS A 114 ? ? -171.30 144.31 12 2 ASN A 120 ? ? -67.27 85.10 13 3 HIS A 7 ? ? -167.05 102.85 14 3 GLU A 13 ? ? -165.52 114.76 15 3 THR A 16 ? ? 68.77 85.27 16 3 LEU A 26 ? ? -132.08 -82.69 17 3 PRO A 28 ? ? -69.47 93.51 18 3 LYS A 72 ? ? -101.68 -64.01 19 3 LYS A 114 ? ? -170.90 115.95 20 4 GLU A 13 ? ? -174.41 137.92 21 4 ALA A 14 ? ? -134.21 -56.67 22 4 PRO A 19 ? ? -58.38 103.40 23 4 SER A 41 ? ? -161.89 103.15 24 4 LYS A 48 ? ? 36.98 74.22 25 4 LYS A 64 ? ? 61.35 -1.13 26 4 ASP A 71 ? ? -118.98 -169.40 27 4 LYS A 72 ? ? -104.72 -62.47 28 4 ASN A 149 ? ? -97.12 39.49 29 5 HIS A 5 ? ? -103.93 -168.88 30 5 GLU A 13 ? ? -161.70 95.06 31 5 LEU A 47 ? ? -75.37 -168.47 32 5 LYS A 114 ? ? -171.93 125.17 33 6 LYS A 48 ? ? 60.86 87.91 34 6 PHE A 56 ? ? -117.89 64.39 35 6 LYS A 72 ? ? -91.01 -63.76 36 6 ILE A 127 ? ? -55.67 105.12 37 7 SER A 24 ? ? -112.83 -158.22 38 7 LEU A 26 ? ? -102.78 -66.27 39 7 LYS A 48 ? ? -162.74 58.98 40 7 LYS A 72 ? ? -101.42 -62.64 41 7 LYS A 114 ? ? -171.82 144.01 42 7 GLU A 117 ? ? -127.10 -62.26 43 7 ASN A 120 ? ? -64.37 88.55 44 7 ASN A 149 ? ? -95.61 45.83 45 8 LYS A 34 ? ? -164.33 112.17 46 8 LYS A 48 ? ? 62.12 92.59 47 8 ILE A 61 ? ? -119.72 76.63 48 8 LYS A 72 ? ? -104.67 -63.92 49 9 PRO A 19 ? ? -64.88 98.67 50 9 SER A 21 ? ? -68.86 96.86 51 9 LEU A 26 ? ? -163.55 -73.79 52 9 HIS A 36 ? ? 71.00 -3.76 53 9 LYS A 48 ? ? 64.36 78.27 54 9 PRO A 49 ? ? -62.72 -173.22 55 9 ILE A 61 ? ? -119.52 71.52 56 9 ASN A 132 ? ? -114.82 76.11 57 10 MET A 22 ? ? -102.94 -164.31 58 10 LYS A 34 ? ? -172.83 146.66 59 10 ASN A 132 ? ? -142.11 54.31 60 10 ILE A 146 ? ? -136.09 -32.55 61 11 HIS A 3 ? ? -160.11 110.42 62 11 LEU A 12 ? ? -92.29 32.04 63 11 GLU A 13 ? ? -163.91 91.93 64 11 LYS A 72 ? ? -104.27 -64.26 65 11 GLU A 117 ? ? -125.05 -56.78 66 11 SER A 129 ? ? -58.23 90.95 67 12 GLU A 13 ? ? -166.72 96.74 68 12 SER A 41 ? ? -165.35 113.42 69 12 ASN A 63 ? ? -140.12 25.55 70 12 LYS A 64 ? ? -92.44 39.15 71 12 LYS A 72 ? ? -97.74 -64.69 72 12 ASN A 120 ? ? -69.41 84.63 73 12 ILE A 127 ? ? -67.45 88.56 74 12 ASN A 132 ? ? -143.20 53.66 75 12 PRO A 133 ? ? -68.41 2.88 76 13 ALA A 2 ? ? -170.16 115.54 77 13 GLU A 13 ? ? -162.78 72.67 78 13 ILE A 38 ? ? -57.32 108.90 79 13 ILE A 61 ? ? -102.75 43.18 80 13 ASN A 63 ? ? -141.34 16.00 81 13 LYS A 64 ? ? -91.35 43.74 82 13 LYS A 72 ? ? -104.47 -64.44 83 13 GLU A 117 ? ? -123.40 -60.19 84 13 ILE A 146 ? ? -140.45 -32.31 85 14 HIS A 3 ? ? 65.50 -2.49 86 14 GLU A 13 ? ? -166.44 107.21 87 14 ALA A 14 ? ? -110.78 77.62 88 14 SER A 21 ? ? 60.61 101.97 89 14 LEU A 26 ? ? -161.80 108.24 90 14 LYS A 48 ? ? 69.15 74.03 91 14 ILE A 61 ? ? -119.48 58.13 92 14 ILE A 146 ? ? -141.25 -33.82 93 15 HIS A 3 ? ? -62.62 99.70 94 15 GLN A 15 ? ? -100.12 -155.52 95 15 ILE A 38 ? ? -58.56 107.21 96 15 ASN A 63 ? ? -91.50 33.64 97 15 LYS A 64 ? ? -69.22 4.35 98 15 LYS A 114 ? ? -171.94 113.15 99 15 ASN A 120 ? ? -69.96 84.28 100 16 HIS A 7 ? ? 73.29 101.91 101 16 MET A 9 ? ? -175.58 121.64 102 16 LEU A 12 ? ? -98.55 -80.42 103 16 GLU A 13 ? ? 173.59 162.30 104 16 HIS A 36 ? ? 69.96 -1.74 105 16 SER A 41 ? ? -162.93 103.13 106 16 LYS A 48 ? ? 70.18 131.33 107 16 ASN A 63 ? ? -99.56 32.98 108 16 LYS A 114 ? ? -171.21 112.98 109 16 ASN A 120 ? ? -68.67 97.35 110 17 ILE A 61 ? ? -115.47 65.00 111 17 ASN A 63 ? ? -141.46 16.93 112 17 GLU A 117 ? ? -75.73 -71.30 113 17 LEU A 130 ? ? 48.56 26.99 114 18 MET A 9 ? ? -104.36 -60.19 115 18 ASN A 120 ? ? -66.51 93.98 116 18 LEU A 130 ? ? -82.01 39.15 117 18 ASN A 132 ? ? -117.99 78.76 118 19 GLU A 13 ? ? -171.68 129.03 119 19 ALA A 14 ? ? -133.76 -77.17 120 19 PHE A 56 ? ? -102.07 63.79 121 19 LYS A 64 ? ? 46.21 28.11 122 19 LYS A 114 ? ? -172.21 112.70 123 20 HIS A 8 ? ? -164.80 101.90 124 20 GLU A 13 ? ? -165.47 111.16 125 20 ILE A 38 ? ? -69.40 98.30 126 20 LYS A 48 ? ? 41.09 84.06 127 20 PRO A 49 ? ? -64.78 -170.98 128 20 ASN A 63 ? ? -93.24 33.81 129 20 LYS A 72 ? ? -103.26 -65.26 130 20 LYS A 114 ? ? -171.77 138.11 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # _pdbx_nmr_ensemble.entry_id 9E9A _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9E9A _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1 mM [U-98% 13C; U-98% 15N] B26, 100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 93% H2O/7% D2O' '93% H2O/7% D2O' CN1 solution ? 2 '1 mM [U-98% 13C; U-98% 15N] B26, 100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 93% H2O/7% D2O' '93% H2O/7% D2O' CN2 solution 'Used for the deuterium exchange experiment. Sample was lyophilized and then redissolved into d2o. HSQC collected within 15 min.' 3 '1 mM [U-10% 13C; U-98% 15N] B26, 100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 93% H2O/7% D2O' '93% H2O/7% D2O' C10N solution 'Used for the deuterium exchange experiment. Sample was lyophilized and then redissolved into d2o. HSQC collected within 15 min.' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 B26 1 ? mM '[U-98% 13C; U-98% 15N]' 1 'sodium chloride' 100 ? mM 'natural abundance' 1 TRIS 20 ? mM 'natural abundance' 1 DTT 1 ? mM 'natural abundance' 2 B26 1 ? mM '[U-98% 13C; U-98% 15N]' 2 'sodium chloride' 100 ? mM 'natural abundance' 2 TRIS 20 ? mM 'natural abundance' 2 DTT 1 ? mM 'natural abundance' 3 B26 1 ? mM '[U-10% 13C; U-98% 15N]' 3 'sodium chloride' 100 ? mM 'natural abundance' 3 TRIS 20 ? mM 'natural abundance' 3 DTT 1 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 278 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label Con-1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.1 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err 0.5 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D 1H-15N NOESY' 1 isotropic 5 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 15 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 14 1 1 '3D HNCACB' 1 isotropic 13 1 1 '3D CBCA(CO)NH' 1 isotropic 12 1 1 '3D HCACO' 1 isotropic 11 1 1 '3D HNCO' 1 isotropic 10 1 1 '3D HNCA' 1 isotropic 9 1 1 '3D C(CO)NH' 1 isotropic 8 1 1 '3D HBHA(CO)NH' 2 isotropic 7 1 1 '3D H(CCO)NH' 2 isotropic 6 1 2 '2D 1H-15N HSQC' 2 isotropic 16 1 2 '3D 1H-13C NOESY aliphatic' 2 isotropic 17 1 3 '2D 1H-13C HSQC aliphatic' 2 isotropic # _pdbx_nmr_refine.entry_id 9E9A _pdbx_nmr_refine.method 'water refinement' _pdbx_nmr_refine.details ;STRUCTURE CALCULATIONS WERE PERFORMED ITERATIVELY USING CYANA (AUTOMATED NOESY ASSIGNMENTS). A TOTAL OF 20 STRUCTURES OUT OF 100 WITH LOWEST TARGET FUNCTION FROM THE FINAL CYANA CALCULATION WERE TAKEN AND REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS) AFTER ADDING 0% TO THE UPPER BOUNDARY LIMIT OF THE DISTANCE RESTRAINTS AND THE VDW FOR THE LOWER LIMIT. HYDROGEN BOND RESTRAINTS WERE INTRODUCED ON THE BASIS OF SLOWLY EXCHANGING AMIDE RESONANCES OBSERVED IN THE DEUTERIUM EXCHANGE EXPERIMENT AND PROXIMITY IN EARLY STRUCTURE CALCULATIONS. STERO-ASSIGNMENTS WERE MADE FOR 10/11ON THE BASIS OF 1H-13C HSQC SPECTRUM FOR THE 10%-CARBON-13 LABELLED SAMPLE. ; _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'data analysis' Poky ? 'Manthey, Tonelli, Clos II, Rahimi, Markley and Lee' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 refinement TALOS+ ? Bax 4 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 5 refinement CNS 1.3 'Brunger, Adams, Clore, Gros, Nilges and Read' 6 'chemical shift assignment' NMRtist ? 'Klukowski, Riek and Guntert' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 75N93022C00036 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 VNMRS ? Varian 600 ? 2 Ascend ? Bruker 700 ? # _atom_sites.entry_id 9E9A _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #