data_9E9L # _entry.id 9E9L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9E9L pdb_00009e9l 10.2210/pdb9e9l/pdb WWPDB D_1000289837 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-12-11 ? 2 'Structure model' 1 1 2025-12-24 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9E9L _pdbx_database_status.recvd_initial_deposition_date 2024-11-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email sean.johnson@usu.edu _pdbx_contact_author.name_first Sean _pdbx_contact_author.name_last Johnson _pdbx_contact_author.name_mi J _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7992-2494 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Denson, J.M.' 1 0000-0001-9616-6969 'Shen, R.' 2 0000-0003-2670-1035 'Hengge, A.C.' 3 0000-0002-5696-2087 'Johnson, S.J.' 4 0000-0001-7992-2494 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Jacs Au' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2691-3704 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Conformational Dynamics and Catalytic Backups in a Hyper-thermostable Engineered Archaeal Protein Tyrosine Phosphatase' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacsau.5c00756 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yehorova, D.' 1 ? primary 'Alansson, N.' 2 ? primary 'Shen, R.' 3 ? primary 'Denson, J.M.' 4 ? primary 'Robinson, M.' 5 ? primary 'Risso, V.A.' 6 ? primary 'Ramirez Molina, N.' 7 ? primary 'Loria, J.P.' 8 ? primary 'Gaucher, E.A.' 9 ? primary 'Sanchez-Ruiz, J.M.' 10 ? primary 'Hengge, A.C.' 11 ? primary 'Johnson, S.J.' 12 ? primary 'Kamerlin, S.C.L.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ShufPTP 17429.184 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 non-polymer syn 'VANADATE ION' 114.939 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 18 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MWPSARFVDDNVAFSRMPTERELDEVAKDFDAVVVLVEEYELPYSLEEWKKRGVEVLHSPIPDFTAPSLEQLLEILRWIE ARVREGKKVLIH(CSO)MGGLGRSGTVAVAWLMYSKGLPLREALRRVRSLRPGAVETYEQMEVLKELEKFLRSR ; _entity_poly.pdbx_seq_one_letter_code_can ;MWPSARFVDDNVAFSRMPTERELDEVAKDFDAVVVLVEEYELPYSLEEWKKRGVEVLHSPIPDFTAPSLEQLLEILRWIE ARVREGKKVLIHCMGGLGRSGTVAVAWLMYSKGLPLREALRRVRSLRPGAVETYEQMEVLKELEKFLRSR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 'VANADATE ION' VO4 4 GLYCEROL GOL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 TRP n 1 3 PRO n 1 4 SER n 1 5 ALA n 1 6 ARG n 1 7 PHE n 1 8 VAL n 1 9 ASP n 1 10 ASP n 1 11 ASN n 1 12 VAL n 1 13 ALA n 1 14 PHE n 1 15 SER n 1 16 ARG n 1 17 MET n 1 18 PRO n 1 19 THR n 1 20 GLU n 1 21 ARG n 1 22 GLU n 1 23 LEU n 1 24 ASP n 1 25 GLU n 1 26 VAL n 1 27 ALA n 1 28 LYS n 1 29 ASP n 1 30 PHE n 1 31 ASP n 1 32 ALA n 1 33 VAL n 1 34 VAL n 1 35 VAL n 1 36 LEU n 1 37 VAL n 1 38 GLU n 1 39 GLU n 1 40 TYR n 1 41 GLU n 1 42 LEU n 1 43 PRO n 1 44 TYR n 1 45 SER n 1 46 LEU n 1 47 GLU n 1 48 GLU n 1 49 TRP n 1 50 LYS n 1 51 LYS n 1 52 ARG n 1 53 GLY n 1 54 VAL n 1 55 GLU n 1 56 VAL n 1 57 LEU n 1 58 HIS n 1 59 SER n 1 60 PRO n 1 61 ILE n 1 62 PRO n 1 63 ASP n 1 64 PHE n 1 65 THR n 1 66 ALA n 1 67 PRO n 1 68 SER n 1 69 LEU n 1 70 GLU n 1 71 GLN n 1 72 LEU n 1 73 LEU n 1 74 GLU n 1 75 ILE n 1 76 LEU n 1 77 ARG n 1 78 TRP n 1 79 ILE n 1 80 GLU n 1 81 ALA n 1 82 ARG n 1 83 VAL n 1 84 ARG n 1 85 GLU n 1 86 GLY n 1 87 LYS n 1 88 LYS n 1 89 VAL n 1 90 LEU n 1 91 ILE n 1 92 HIS n 1 93 CSO n 1 94 MET n 1 95 GLY n 1 96 GLY n 1 97 LEU n 1 98 GLY n 1 99 ARG n 1 100 SER n 1 101 GLY n 1 102 THR n 1 103 VAL n 1 104 ALA n 1 105 VAL n 1 106 ALA n 1 107 TRP n 1 108 LEU n 1 109 MET n 1 110 TYR n 1 111 SER n 1 112 LYS n 1 113 GLY n 1 114 LEU n 1 115 PRO n 1 116 LEU n 1 117 ARG n 1 118 GLU n 1 119 ALA n 1 120 LEU n 1 121 ARG n 1 122 ARG n 1 123 VAL n 1 124 ARG n 1 125 SER n 1 126 LEU n 1 127 ARG n 1 128 PRO n 1 129 GLY n 1 130 ALA n 1 131 VAL n 1 132 GLU n 1 133 THR n 1 134 TYR n 1 135 GLU n 1 136 GLN n 1 137 MET n 1 138 GLU n 1 139 VAL n 1 140 LEU n 1 141 LYS n 1 142 GLU n 1 143 LEU n 1 144 GLU n 1 145 LYS n 1 146 PHE n 1 147 LEU n 1 148 ARG n 1 149 SER n 1 150 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 150 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 VO4 non-polymer . 'VANADATE ION' ? 'O4 V -3' 114.939 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 TRP 2 2 2 TRP TRP A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 CSO 93 93 93 CSO CSO A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 TRP 107 107 107 TRP TRP A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 MET 137 137 137 MET MET A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 ARG 150 150 ? ? ? A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 VO4 ? ? VO4 ? ? 'SUBJECT OF INVESTIGATION' ? 2 CSO ? ? CSO ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 1 SO4 SO4 A . C 2 SO4 1 202 2 SO4 SO4 A . D 3 VO4 1 203 3 VO4 VO4 A . E 4 GOL 1 204 4 GOL GOL A . F 5 HOH 1 301 11 HOH HOH A . F 5 HOH 2 302 9 HOH HOH A . F 5 HOH 3 303 15 HOH HOH A . F 5 HOH 4 304 1 HOH HOH A . F 5 HOH 5 305 4 HOH HOH A . F 5 HOH 6 306 3 HOH HOH A . F 5 HOH 7 307 10 HOH HOH A . F 5 HOH 8 308 2 HOH HOH A . F 5 HOH 9 309 8 HOH HOH A . F 5 HOH 10 310 5 HOH HOH A . F 5 HOH 11 311 13 HOH HOH A . F 5 HOH 12 312 17 HOH HOH A . F 5 HOH 13 313 7 HOH HOH A . F 5 HOH 14 314 6 HOH HOH A . F 5 HOH 15 315 19 HOH HOH A . F 5 HOH 16 316 18 HOH HOH A . F 5 HOH 17 317 16 HOH HOH A . F 5 HOH 18 318 14 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 21 ? CG ? A ARG 21 CG 2 1 Y 1 A ARG 21 ? CD ? A ARG 21 CD 3 1 Y 1 A ARG 21 ? NE ? A ARG 21 NE 4 1 Y 1 A ARG 21 ? CZ ? A ARG 21 CZ 5 1 Y 1 A ARG 21 ? NH1 ? A ARG 21 NH1 6 1 Y 1 A ARG 21 ? NH2 ? A ARG 21 NH2 7 1 Y 1 A GLU 39 ? OE1 ? A GLU 39 OE1 8 1 Y 1 A TYR 40 ? OH ? A TYR 40 OH 9 1 Y 1 A GLU 70 ? CG ? A GLU 70 CG 10 1 Y 1 A GLU 70 ? CD ? A GLU 70 CD 11 1 Y 1 A GLU 70 ? OE1 ? A GLU 70 OE1 12 1 Y 1 A GLU 70 ? OE2 ? A GLU 70 OE2 13 1 Y 1 A ARG 77 ? CD ? A ARG 77 CD 14 1 Y 1 A ARG 77 ? NE ? A ARG 77 NE 15 1 Y 1 A ARG 77 ? CZ ? A ARG 77 CZ 16 1 Y 1 A ARG 77 ? NH1 ? A ARG 77 NH1 17 1 Y 1 A ARG 77 ? NH2 ? A ARG 77 NH2 18 1 Y 1 A GLU 132 ? OE1 ? A GLU 132 OE1 19 1 Y 1 A GLU 132 ? OE2 ? A GLU 132 OE2 20 1 Y 1 A LYS 145 ? CG ? A LYS 145 CG 21 1 Y 1 A LYS 145 ? CD ? A LYS 145 CD 22 1 Y 1 A LYS 145 ? CE ? A LYS 145 CE 23 1 Y 1 A LYS 145 ? NZ ? A LYS 145 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9E9L _cell.details ? _cell.formula_units_Z ? _cell.length_a 85.718 _cell.length_a_esd ? _cell.length_b 85.718 _cell.length_b_esd ? _cell.length_c 32.374 _cell.length_c_esd ? _cell.volume 206001.818 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9E9L _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 _symmetry.space_group_name_Hall 'P 61' _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9E9L _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.03 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.6 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 10.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;8 mg/mL protein, 0.1 M CAPS, 30% PEG 400, 5 mM sodium metavanadate at a 1:1:0.2 protein/well/additive screen. The additive screen contains 0.2 M (NH4)2SO4, 20-30% PEG 4000, and 10-35% glycerol. ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-05-15 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator M _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 34.12 _reflns.entry_id 9E9L _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.10 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7921 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.993 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.180 _reflns.pdbx_Rpim_I_all 0.046 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 112232 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star 0.998 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.174 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.10 2.18 ? ? ? ? ? ? 694 ? ? ? ? ? ? ? ? ? ? ? 11.1 1.023 ? ? 0.469 0.125 ? 1 1 0.942 0.985 ? 86.1 ? 0.451 ? ? ? ? ? ? ? ? ? 2.18 2.26 ? ? ? ? ? ? 751 ? ? ? ? ? ? ? ? ? ? ? 11.6 0.965 ? ? 0.422 0.112 ? 2 1 0.956 0.989 ? 93.9 ? 0.406 ? ? ? ? ? ? ? ? ? 2.26 2.37 ? ? ? ? ? ? 755 ? ? ? ? ? ? ? ? ? ? ? 12.4 0.970 ? ? 0.375 0.097 ? 3 1 0.969 0.992 ? 94.8 ? 0.362 ? ? ? ? ? ? ? ? ? 2.37 2.49 ? ? ? ? ? ? 813 ? ? ? ? ? ? ? ? ? ? ? 12.0 1.008 ? ? 0.359 0.095 ? 4 1 0.971 0.993 ? 98.9 ? 0.345 ? ? ? ? ? ? ? ? ? 2.49 2.65 ? ? ? ? ? ? 795 ? ? ? ? ? ? ? ? ? ? ? 14.8 0.998 ? ? 0.307 0.077 ? 5 1 0.977 0.994 ? 100.0 ? 0.297 ? ? ? ? ? ? ? ? ? 2.65 2.85 ? ? ? ? ? ? 802 ? ? ? ? ? ? ? ? ? ? ? 15.8 0.973 ? ? 0.274 0.068 ? 6 1 0.984 0.996 ? 100.0 ? 0.265 ? ? ? ? ? ? ? ? ? 2.85 3.14 ? ? ? ? ? ? 807 ? ? ? ? ? ? ? ? ? ? ? 15.9 0.978 ? ? 0.232 0.057 ? 7 1 0.983 0.996 ? 100.0 ? 0.225 ? ? ? ? ? ? ? ? ? 3.14 3.59 ? ? ? ? ? ? 830 ? ? ? ? ? ? ? ? ? ? ? 15.6 0.992 ? ? 0.191 0.048 ? 8 1 0.991 0.998 ? 100.0 ? 0.184 ? ? ? ? ? ? ? ? ? 3.59 4.52 ? ? ? ? ? ? 814 ? ? ? ? ? ? ? ? ? ? ? 16.1 1.028 ? ? 0.156 0.039 ? 9 1 0.989 0.997 ? 100.0 ? 0.150 ? ? ? ? ? ? ? ? ? 4.52 50.00 ? ? ? ? ? ? 860 ? ? ? ? ? ? ? ? ? ? ? 15.6 0.993 ? ? 0.147 0.038 ? 10 1 0.988 0.997 ? 100.0 ? 0.142 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 37.38 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9E9L _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 37.12 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7893 _refine.ls_number_reflns_R_free 392 _refine.ls_number_reflns_R_work 7501 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.93 _refine.ls_percent_reflns_R_free 4.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1857 _refine.ls_R_factor_R_free 0.2238 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1836 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.8607 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1977 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 37.12 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 1229 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1190 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0084 ? 1233 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0514 ? 1668 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0524 ? 185 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0075 ? 208 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.5930 ? 460 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.10 2.40 . . 119 2317 91.13 . . . . 0.2079 . . . . . . . . . . . 0.2511 'X-RAY DIFFRACTION' 2.40 3.03 . . 136 2551 99.59 . . . . 0.2148 . . . . . . . . . . . 0.2537 'X-RAY DIFFRACTION' 3.03 37.12 . . 137 2633 99.93 . . . . 0.1681 . . . . . . . . . . . 0.2081 # _struct.entry_id 9E9L _struct.title 'Vanadate-bound Putative Ancestral Protein Tyrosine Phosphatase ShufPTP - Intermediate p-loop Conformation' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9E9L _struct_keywords.text 'phosphatase, inhibitor, ASR, CSO, Oxidized Cystine, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9E9L _struct_ref.pdbx_db_accession 9E9L _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9E9L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 150 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9E9L _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 150 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 19 ? ARG A 21 ? THR A 19 ARG A 21 5 ? 3 HELX_P HELX_P2 AA2 GLU A 22 ? PHE A 30 ? GLU A 22 PHE A 30 1 ? 9 HELX_P HELX_P3 AA3 GLU A 38 ? LEU A 42 ? GLU A 38 LEU A 42 5 ? 5 HELX_P HELX_P4 AA4 LEU A 46 ? LYS A 51 ? LEU A 46 LYS A 51 1 ? 6 HELX_P HELX_P5 AA5 SER A 68 ? GLU A 85 ? SER A 68 GLU A 85 1 ? 18 HELX_P HELX_P6 AA6 LEU A 97 ? GLY A 113 ? LEU A 97 GLY A 113 1 ? 17 HELX_P HELX_P7 AA7 PRO A 115 ? ARG A 127 ? PRO A 115 ARG A 127 1 ? 13 HELX_P HELX_P8 AA8 THR A 133 ? ARG A 148 ? THR A 133 ARG A 148 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A HIS 92 C ? ? ? 1_555 A CSO 93 N ? ? A HIS 92 A CSO 93 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale2 covale both ? A CSO 93 C ? ? ? 1_555 A MET 94 N ? ? A CSO 93 A MET 94 1_555 ? ? ? ? ? ? ? 1.324 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CSO _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 93 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id CSO _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 93 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id CSO _pdbx_modification_feature.type Hydroxylation _pdbx_modification_feature.category 'Named protein modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 6 ? PHE A 7 ? ARG A 6 PHE A 7 AA1 2 VAL A 12 ? SER A 15 ? VAL A 12 SER A 15 AA1 3 VAL A 89 ? HIS A 92 ? VAL A 89 HIS A 92 AA1 4 ALA A 32 ? VAL A 35 ? ALA A 32 VAL A 35 AA1 5 GLU A 55 ? HIS A 58 ? GLU A 55 HIS A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 6 ? N ARG A 6 O PHE A 14 ? O PHE A 14 AA1 2 3 N ALA A 13 ? N ALA A 13 O ILE A 91 ? O ILE A 91 AA1 3 4 O LEU A 90 ? O LEU A 90 N VAL A 34 ? N VAL A 34 AA1 4 5 N VAL A 35 ? N VAL A 35 O LEU A 57 ? O LEU A 57 # _pdbx_entry_details.entry_id 9E9L _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CSO A 93 ? ? -118.67 -124.80 2 1 MET A 94 ? ? -94.80 -119.02 3 1 VAL A 131 ? ? 59.25 93.45 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x-y,x,z+1/6 3 y,-x+y,z+5/6 4 -y,x-y,z+1/3 5 -x+y,-x,z+2/3 6 -x,-y,z+1/2 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id ARG _pdbx_unobs_or_zero_occ_residues.auth_seq_id 150 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id ARG _pdbx_unobs_or_zero_occ_residues.label_seq_id 150 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CSO N N N N 74 CSO CA C N R 75 CSO CB C N N 76 CSO SG S N N 77 CSO C C N N 78 CSO O O N N 79 CSO OXT O N N 80 CSO OD O N N 81 CSO H H N N 82 CSO H2 H N N 83 CSO HA H N N 84 CSO HB2 H N N 85 CSO HB3 H N N 86 CSO HXT H N N 87 CSO HD H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 GOL C1 C N N 138 GOL O1 O N N 139 GOL C2 C N N 140 GOL O2 O N N 141 GOL C3 C N N 142 GOL O3 O N N 143 GOL H11 H N N 144 GOL H12 H N N 145 GOL HO1 H N N 146 GOL H2 H N N 147 GOL HO2 H N N 148 GOL H31 H N N 149 GOL H32 H N N 150 GOL HO3 H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HOH O O N N 173 HOH H1 H N N 174 HOH H2 H N N 175 ILE N N N N 176 ILE CA C N S 177 ILE C C N N 178 ILE O O N N 179 ILE CB C N S 180 ILE CG1 C N N 181 ILE CG2 C N N 182 ILE CD1 C N N 183 ILE OXT O N N 184 ILE H H N N 185 ILE H2 H N N 186 ILE HA H N N 187 ILE HB H N N 188 ILE HG12 H N N 189 ILE HG13 H N N 190 ILE HG21 H N N 191 ILE HG22 H N N 192 ILE HG23 H N N 193 ILE HD11 H N N 194 ILE HD12 H N N 195 ILE HD13 H N N 196 ILE HXT H N N 197 LEU N N N N 198 LEU CA C N S 199 LEU C C N N 200 LEU O O N N 201 LEU CB C N N 202 LEU CG C N N 203 LEU CD1 C N N 204 LEU CD2 C N N 205 LEU OXT O N N 206 LEU H H N N 207 LEU H2 H N N 208 LEU HA H N N 209 LEU HB2 H N N 210 LEU HB3 H N N 211 LEU HG H N N 212 LEU HD11 H N N 213 LEU HD12 H N N 214 LEU HD13 H N N 215 LEU HD21 H N N 216 LEU HD22 H N N 217 LEU HD23 H N N 218 LEU HXT H N N 219 LYS N N N N 220 LYS CA C N S 221 LYS C C N N 222 LYS O O N N 223 LYS CB C N N 224 LYS CG C N N 225 LYS CD C N N 226 LYS CE C N N 227 LYS NZ N N N 228 LYS OXT O N N 229 LYS H H N N 230 LYS H2 H N N 231 LYS HA H N N 232 LYS HB2 H N N 233 LYS HB3 H N N 234 LYS HG2 H N N 235 LYS HG3 H N N 236 LYS HD2 H N N 237 LYS HD3 H N N 238 LYS HE2 H N N 239 LYS HE3 H N N 240 LYS HZ1 H N N 241 LYS HZ2 H N N 242 LYS HZ3 H N N 243 LYS HXT H N N 244 MET N N N N 245 MET CA C N S 246 MET C C N N 247 MET O O N N 248 MET CB C N N 249 MET CG C N N 250 MET SD S N N 251 MET CE C N N 252 MET OXT O N N 253 MET H H N N 254 MET H2 H N N 255 MET HA H N N 256 MET HB2 H N N 257 MET HB3 H N N 258 MET HG2 H N N 259 MET HG3 H N N 260 MET HE1 H N N 261 MET HE2 H N N 262 MET HE3 H N N 263 MET HXT H N N 264 PHE N N N N 265 PHE CA C N S 266 PHE C C N N 267 PHE O O N N 268 PHE CB C N N 269 PHE CG C Y N 270 PHE CD1 C Y N 271 PHE CD2 C Y N 272 PHE CE1 C Y N 273 PHE CE2 C Y N 274 PHE CZ C Y N 275 PHE OXT O N N 276 PHE H H N N 277 PHE H2 H N N 278 PHE HA H N N 279 PHE HB2 H N N 280 PHE HB3 H N N 281 PHE HD1 H N N 282 PHE HD2 H N N 283 PHE HE1 H N N 284 PHE HE2 H N N 285 PHE HZ H N N 286 PHE HXT H N N 287 PRO N N N N 288 PRO CA C N S 289 PRO C C N N 290 PRO O O N N 291 PRO CB C N N 292 PRO CG C N N 293 PRO CD C N N 294 PRO OXT O N N 295 PRO H H N N 296 PRO HA H N N 297 PRO HB2 H N N 298 PRO HB3 H N N 299 PRO HG2 H N N 300 PRO HG3 H N N 301 PRO HD2 H N N 302 PRO HD3 H N N 303 PRO HXT H N N 304 SER N N N N 305 SER CA C N S 306 SER C C N N 307 SER O O N N 308 SER CB C N N 309 SER OG O N N 310 SER OXT O N N 311 SER H H N N 312 SER H2 H N N 313 SER HA H N N 314 SER HB2 H N N 315 SER HB3 H N N 316 SER HG H N N 317 SER HXT H N N 318 SO4 S S N N 319 SO4 O1 O N N 320 SO4 O2 O N N 321 SO4 O3 O N N 322 SO4 O4 O N N 323 THR N N N N 324 THR CA C N S 325 THR C C N N 326 THR O O N N 327 THR CB C N R 328 THR OG1 O N N 329 THR CG2 C N N 330 THR OXT O N N 331 THR H H N N 332 THR H2 H N N 333 THR HA H N N 334 THR HB H N N 335 THR HG1 H N N 336 THR HG21 H N N 337 THR HG22 H N N 338 THR HG23 H N N 339 THR HXT H N N 340 TRP N N N N 341 TRP CA C N S 342 TRP C C N N 343 TRP O O N N 344 TRP CB C N N 345 TRP CG C Y N 346 TRP CD1 C Y N 347 TRP CD2 C Y N 348 TRP NE1 N Y N 349 TRP CE2 C Y N 350 TRP CE3 C Y N 351 TRP CZ2 C Y N 352 TRP CZ3 C Y N 353 TRP CH2 C Y N 354 TRP OXT O N N 355 TRP H H N N 356 TRP H2 H N N 357 TRP HA H N N 358 TRP HB2 H N N 359 TRP HB3 H N N 360 TRP HD1 H N N 361 TRP HE1 H N N 362 TRP HE3 H N N 363 TRP HZ2 H N N 364 TRP HZ3 H N N 365 TRP HH2 H N N 366 TRP HXT H N N 367 TYR N N N N 368 TYR CA C N S 369 TYR C C N N 370 TYR O O N N 371 TYR CB C N N 372 TYR CG C Y N 373 TYR CD1 C Y N 374 TYR CD2 C Y N 375 TYR CE1 C Y N 376 TYR CE2 C Y N 377 TYR CZ C Y N 378 TYR OH O N N 379 TYR OXT O N N 380 TYR H H N N 381 TYR H2 H N N 382 TYR HA H N N 383 TYR HB2 H N N 384 TYR HB3 H N N 385 TYR HD1 H N N 386 TYR HD2 H N N 387 TYR HE1 H N N 388 TYR HE2 H N N 389 TYR HH H N N 390 TYR HXT H N N 391 VAL N N N N 392 VAL CA C N S 393 VAL C C N N 394 VAL O O N N 395 VAL CB C N N 396 VAL CG1 C N N 397 VAL CG2 C N N 398 VAL OXT O N N 399 VAL H H N N 400 VAL H2 H N N 401 VAL HA H N N 402 VAL HB H N N 403 VAL HG11 H N N 404 VAL HG12 H N N 405 VAL HG13 H N N 406 VAL HG21 H N N 407 VAL HG22 H N N 408 VAL HG23 H N N 409 VAL HXT H N N 410 VO4 V V N N 411 VO4 O1 O N N 412 VO4 O2 O N N 413 VO4 O3 O N N 414 VO4 O4 O N N 415 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CSO N CA sing N N 70 CSO N H sing N N 71 CSO N H2 sing N N 72 CSO CA CB sing N N 73 CSO CA C sing N N 74 CSO CA HA sing N N 75 CSO CB SG sing N N 76 CSO CB HB2 sing N N 77 CSO CB HB3 sing N N 78 CSO SG OD sing N N 79 CSO C O doub N N 80 CSO C OXT sing N N 81 CSO OXT HXT sing N N 82 CSO OD HD sing N N 83 GLN N CA sing N N 84 GLN N H sing N N 85 GLN N H2 sing N N 86 GLN CA C sing N N 87 GLN CA CB sing N N 88 GLN CA HA sing N N 89 GLN C O doub N N 90 GLN C OXT sing N N 91 GLN CB CG sing N N 92 GLN CB HB2 sing N N 93 GLN CB HB3 sing N N 94 GLN CG CD sing N N 95 GLN CG HG2 sing N N 96 GLN CG HG3 sing N N 97 GLN CD OE1 doub N N 98 GLN CD NE2 sing N N 99 GLN NE2 HE21 sing N N 100 GLN NE2 HE22 sing N N 101 GLN OXT HXT sing N N 102 GLU N CA sing N N 103 GLU N H sing N N 104 GLU N H2 sing N N 105 GLU CA C sing N N 106 GLU CA CB sing N N 107 GLU CA HA sing N N 108 GLU C O doub N N 109 GLU C OXT sing N N 110 GLU CB CG sing N N 111 GLU CB HB2 sing N N 112 GLU CB HB3 sing N N 113 GLU CG CD sing N N 114 GLU CG HG2 sing N N 115 GLU CG HG3 sing N N 116 GLU CD OE1 doub N N 117 GLU CD OE2 sing N N 118 GLU OE2 HE2 sing N N 119 GLU OXT HXT sing N N 120 GLY N CA sing N N 121 GLY N H sing N N 122 GLY N H2 sing N N 123 GLY CA C sing N N 124 GLY CA HA2 sing N N 125 GLY CA HA3 sing N N 126 GLY C O doub N N 127 GLY C OXT sing N N 128 GLY OXT HXT sing N N 129 GOL C1 O1 sing N N 130 GOL C1 C2 sing N N 131 GOL C1 H11 sing N N 132 GOL C1 H12 sing N N 133 GOL O1 HO1 sing N N 134 GOL C2 O2 sing N N 135 GOL C2 C3 sing N N 136 GOL C2 H2 sing N N 137 GOL O2 HO2 sing N N 138 GOL C3 O3 sing N N 139 GOL C3 H31 sing N N 140 GOL C3 H32 sing N N 141 GOL O3 HO3 sing N N 142 HIS N CA sing N N 143 HIS N H sing N N 144 HIS N H2 sing N N 145 HIS CA C sing N N 146 HIS CA CB sing N N 147 HIS CA HA sing N N 148 HIS C O doub N N 149 HIS C OXT sing N N 150 HIS CB CG sing N N 151 HIS CB HB2 sing N N 152 HIS CB HB3 sing N N 153 HIS CG ND1 sing Y N 154 HIS CG CD2 doub Y N 155 HIS ND1 CE1 doub Y N 156 HIS ND1 HD1 sing N N 157 HIS CD2 NE2 sing Y N 158 HIS CD2 HD2 sing N N 159 HIS CE1 NE2 sing Y N 160 HIS CE1 HE1 sing N N 161 HIS NE2 HE2 sing N N 162 HIS OXT HXT sing N N 163 HOH O H1 sing N N 164 HOH O H2 sing N N 165 ILE N CA sing N N 166 ILE N H sing N N 167 ILE N H2 sing N N 168 ILE CA C sing N N 169 ILE CA CB sing N N 170 ILE CA HA sing N N 171 ILE C O doub N N 172 ILE C OXT sing N N 173 ILE CB CG1 sing N N 174 ILE CB CG2 sing N N 175 ILE CB HB sing N N 176 ILE CG1 CD1 sing N N 177 ILE CG1 HG12 sing N N 178 ILE CG1 HG13 sing N N 179 ILE CG2 HG21 sing N N 180 ILE CG2 HG22 sing N N 181 ILE CG2 HG23 sing N N 182 ILE CD1 HD11 sing N N 183 ILE CD1 HD12 sing N N 184 ILE CD1 HD13 sing N N 185 ILE OXT HXT sing N N 186 LEU N CA sing N N 187 LEU N H sing N N 188 LEU N H2 sing N N 189 LEU CA C sing N N 190 LEU CA CB sing N N 191 LEU CA HA sing N N 192 LEU C O doub N N 193 LEU C OXT sing N N 194 LEU CB CG sing N N 195 LEU CB HB2 sing N N 196 LEU CB HB3 sing N N 197 LEU CG CD1 sing N N 198 LEU CG CD2 sing N N 199 LEU CG HG sing N N 200 LEU CD1 HD11 sing N N 201 LEU CD1 HD12 sing N N 202 LEU CD1 HD13 sing N N 203 LEU CD2 HD21 sing N N 204 LEU CD2 HD22 sing N N 205 LEU CD2 HD23 sing N N 206 LEU OXT HXT sing N N 207 LYS N CA sing N N 208 LYS N H sing N N 209 LYS N H2 sing N N 210 LYS CA C sing N N 211 LYS CA CB sing N N 212 LYS CA HA sing N N 213 LYS C O doub N N 214 LYS C OXT sing N N 215 LYS CB CG sing N N 216 LYS CB HB2 sing N N 217 LYS CB HB3 sing N N 218 LYS CG CD sing N N 219 LYS CG HG2 sing N N 220 LYS CG HG3 sing N N 221 LYS CD CE sing N N 222 LYS CD HD2 sing N N 223 LYS CD HD3 sing N N 224 LYS CE NZ sing N N 225 LYS CE HE2 sing N N 226 LYS CE HE3 sing N N 227 LYS NZ HZ1 sing N N 228 LYS NZ HZ2 sing N N 229 LYS NZ HZ3 sing N N 230 LYS OXT HXT sing N N 231 MET N CA sing N N 232 MET N H sing N N 233 MET N H2 sing N N 234 MET CA C sing N N 235 MET CA CB sing N N 236 MET CA HA sing N N 237 MET C O doub N N 238 MET C OXT sing N N 239 MET CB CG sing N N 240 MET CB HB2 sing N N 241 MET CB HB3 sing N N 242 MET CG SD sing N N 243 MET CG HG2 sing N N 244 MET CG HG3 sing N N 245 MET SD CE sing N N 246 MET CE HE1 sing N N 247 MET CE HE2 sing N N 248 MET CE HE3 sing N N 249 MET OXT HXT sing N N 250 PHE N CA sing N N 251 PHE N H sing N N 252 PHE N H2 sing N N 253 PHE CA C sing N N 254 PHE CA CB sing N N 255 PHE CA HA sing N N 256 PHE C O doub N N 257 PHE C OXT sing N N 258 PHE CB CG sing N N 259 PHE CB HB2 sing N N 260 PHE CB HB3 sing N N 261 PHE CG CD1 doub Y N 262 PHE CG CD2 sing Y N 263 PHE CD1 CE1 sing Y N 264 PHE CD1 HD1 sing N N 265 PHE CD2 CE2 doub Y N 266 PHE CD2 HD2 sing N N 267 PHE CE1 CZ doub Y N 268 PHE CE1 HE1 sing N N 269 PHE CE2 CZ sing Y N 270 PHE CE2 HE2 sing N N 271 PHE CZ HZ sing N N 272 PHE OXT HXT sing N N 273 PRO N CA sing N N 274 PRO N CD sing N N 275 PRO N H sing N N 276 PRO CA C sing N N 277 PRO CA CB sing N N 278 PRO CA HA sing N N 279 PRO C O doub N N 280 PRO C OXT sing N N 281 PRO CB CG sing N N 282 PRO CB HB2 sing N N 283 PRO CB HB3 sing N N 284 PRO CG CD sing N N 285 PRO CG HG2 sing N N 286 PRO CG HG3 sing N N 287 PRO CD HD2 sing N N 288 PRO CD HD3 sing N N 289 PRO OXT HXT sing N N 290 SER N CA sing N N 291 SER N H sing N N 292 SER N H2 sing N N 293 SER CA C sing N N 294 SER CA CB sing N N 295 SER CA HA sing N N 296 SER C O doub N N 297 SER C OXT sing N N 298 SER CB OG sing N N 299 SER CB HB2 sing N N 300 SER CB HB3 sing N N 301 SER OG HG sing N N 302 SER OXT HXT sing N N 303 SO4 S O1 doub N N 304 SO4 S O2 doub N N 305 SO4 S O3 sing N N 306 SO4 S O4 sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TRP N CA sing N N 324 TRP N H sing N N 325 TRP N H2 sing N N 326 TRP CA C sing N N 327 TRP CA CB sing N N 328 TRP CA HA sing N N 329 TRP C O doub N N 330 TRP C OXT sing N N 331 TRP CB CG sing N N 332 TRP CB HB2 sing N N 333 TRP CB HB3 sing N N 334 TRP CG CD1 doub Y N 335 TRP CG CD2 sing Y N 336 TRP CD1 NE1 sing Y N 337 TRP CD1 HD1 sing N N 338 TRP CD2 CE2 doub Y N 339 TRP CD2 CE3 sing Y N 340 TRP NE1 CE2 sing Y N 341 TRP NE1 HE1 sing N N 342 TRP CE2 CZ2 sing Y N 343 TRP CE3 CZ3 doub Y N 344 TRP CE3 HE3 sing N N 345 TRP CZ2 CH2 doub Y N 346 TRP CZ2 HZ2 sing N N 347 TRP CZ3 CH2 sing Y N 348 TRP CZ3 HZ3 sing N N 349 TRP CH2 HH2 sing N N 350 TRP OXT HXT sing N N 351 TYR N CA sing N N 352 TYR N H sing N N 353 TYR N H2 sing N N 354 TYR CA C sing N N 355 TYR CA CB sing N N 356 TYR CA HA sing N N 357 TYR C O doub N N 358 TYR C OXT sing N N 359 TYR CB CG sing N N 360 TYR CB HB2 sing N N 361 TYR CB HB3 sing N N 362 TYR CG CD1 doub Y N 363 TYR CG CD2 sing Y N 364 TYR CD1 CE1 sing Y N 365 TYR CD1 HD1 sing N N 366 TYR CD2 CE2 doub Y N 367 TYR CD2 HD2 sing N N 368 TYR CE1 CZ doub Y N 369 TYR CE1 HE1 sing N N 370 TYR CE2 CZ sing Y N 371 TYR CE2 HE2 sing N N 372 TYR CZ OH sing N N 373 TYR OH HH sing N N 374 TYR OXT HXT sing N N 375 VAL N CA sing N N 376 VAL N H sing N N 377 VAL N H2 sing N N 378 VAL CA C sing N N 379 VAL CA CB sing N N 380 VAL CA HA sing N N 381 VAL C O doub N N 382 VAL C OXT sing N N 383 VAL CB CG1 sing N N 384 VAL CB CG2 sing N N 385 VAL CB HB sing N N 386 VAL CG1 HG11 sing N N 387 VAL CG1 HG12 sing N N 388 VAL CG1 HG13 sing N N 389 VAL CG2 HG21 sing N N 390 VAL CG2 HG22 sing N N 391 VAL CG2 HG23 sing N N 392 VAL OXT HXT sing N N 393 VO4 V O1 doub N N 394 VO4 V O2 sing N N 395 VO4 V O3 sing N N 396 VO4 V O4 sing N N 397 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5z5a _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 61' _space_group.name_Hall 'P 61' _space_group.IT_number 169 _space_group.crystal_system hexagonal _space_group.id 1 # _atom_sites.entry_id 9E9L _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011666 _atom_sites.fract_transf_matrix[1][2] 0.006735 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013471 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.030889 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? V ? ? 18.66134 4.26681 ? ? 3.12589 55.31642 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #