data_9EC5 # _entry.id 9EC5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.407 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9EC5 pdb_00009ec5 10.2210/pdb9ec5/pdb WWPDB D_1000290170 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-11-19 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9EC5 _pdbx_database_status.recvd_initial_deposition_date 2024-11-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 4 _pdbx_contact_author.email aborovik@uci.edu _pdbx_contact_author.name_first Andrew _pdbx_contact_author.name_last Borovik _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5049-9952 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Minnetian, N.M.' 1 0000-0002-1817-184X 'Follmer, A.H.' 2 0000-0002-6244-6804 'Borovik, A.S.' 3 0000-0001-5049-9952 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'S-nitrosylation by artificial copper metalloproteins' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Minnetian, N.M.' 1 0000-0002-1817-184X primary 'Borovik, A.S.' 2 0000-0001-5049-9952 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Streptavidin 16648.111 1 ? 'E14Q, S112C, L124F' ? ? 2 non-polymer syn 'N-(3-{bis[2-(pyridin-2-yl)ethyl]amino}propyl)-5-[(3aR,4R,6aS)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide' 510.695 1 ? ? ? ? 3 non-polymer syn 'COPPER (II) ION' 63.546 2 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 water nat water 18.015 139 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MASMTGGQQMGRDQAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWK NNYRNAHSATTWSGQYVGGAEARINTQWLLT(SNC)GTTEANAWKSTFVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDA VQQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MASMTGGQQMGRDQAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWK NNYRNAHSATTWSGQYVGGAEARINTQWLLTCGTTEANAWKSTFVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-(3-{bis[2-(pyridin-2-yl)ethyl]amino}propyl)-5-[(3aR,4R,6aS)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide' A1BIA 3 'COPPER (II) ION' CU 4 'SULFATE ION' SO4 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 MET n 1 5 THR n 1 6 GLY n 1 7 GLY n 1 8 GLN n 1 9 GLN n 1 10 MET n 1 11 GLY n 1 12 ARG n 1 13 ASP n 1 14 GLN n 1 15 ALA n 1 16 GLY n 1 17 ILE n 1 18 THR n 1 19 GLY n 1 20 THR n 1 21 TRP n 1 22 TYR n 1 23 ASN n 1 24 GLN n 1 25 LEU n 1 26 GLY n 1 27 SER n 1 28 THR n 1 29 PHE n 1 30 ILE n 1 31 VAL n 1 32 THR n 1 33 ALA n 1 34 GLY n 1 35 ALA n 1 36 ASP n 1 37 GLY n 1 38 ALA n 1 39 LEU n 1 40 THR n 1 41 GLY n 1 42 THR n 1 43 TYR n 1 44 GLU n 1 45 SER n 1 46 ALA n 1 47 VAL n 1 48 GLY n 1 49 ASN n 1 50 ALA n 1 51 GLU n 1 52 SER n 1 53 ARG n 1 54 TYR n 1 55 VAL n 1 56 LEU n 1 57 THR n 1 58 GLY n 1 59 ARG n 1 60 TYR n 1 61 ASP n 1 62 SER n 1 63 ALA n 1 64 PRO n 1 65 ALA n 1 66 THR n 1 67 ASP n 1 68 GLY n 1 69 SER n 1 70 GLY n 1 71 THR n 1 72 ALA n 1 73 LEU n 1 74 GLY n 1 75 TRP n 1 76 THR n 1 77 VAL n 1 78 ALA n 1 79 TRP n 1 80 LYS n 1 81 ASN n 1 82 ASN n 1 83 TYR n 1 84 ARG n 1 85 ASN n 1 86 ALA n 1 87 HIS n 1 88 SER n 1 89 ALA n 1 90 THR n 1 91 THR n 1 92 TRP n 1 93 SER n 1 94 GLY n 1 95 GLN n 1 96 TYR n 1 97 VAL n 1 98 GLY n 1 99 GLY n 1 100 ALA n 1 101 GLU n 1 102 ALA n 1 103 ARG n 1 104 ILE n 1 105 ASN n 1 106 THR n 1 107 GLN n 1 108 TRP n 1 109 LEU n 1 110 LEU n 1 111 THR n 1 112 SNC n 1 113 GLY n 1 114 THR n 1 115 THR n 1 116 GLU n 1 117 ALA n 1 118 ASN n 1 119 ALA n 1 120 TRP n 1 121 LYS n 1 122 SER n 1 123 THR n 1 124 PHE n 1 125 VAL n 1 126 GLY n 1 127 HIS n 1 128 ASP n 1 129 THR n 1 130 PHE n 1 131 THR n 1 132 LYS n 1 133 VAL n 1 134 LYS n 1 135 PRO n 1 136 SER n 1 137 ALA n 1 138 ALA n 1 139 SER n 1 140 ILE n 1 141 ASP n 1 142 ALA n 1 143 ALA n 1 144 LYS n 1 145 LYS n 1 146 ALA n 1 147 GLY n 1 148 VAL n 1 149 ASN n 1 150 ASN n 1 151 GLY n 1 152 ASN n 1 153 PRO n 1 154 LEU n 1 155 ASP n 1 156 ALA n 1 157 VAL n 1 158 GLN n 1 159 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 159 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces avidinii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1895 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1BIA non-polymer . 'N-(3-{bis[2-(pyridin-2-yl)ethyl]amino}propyl)-5-[(3aR,4R,6aS)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide' ? 'C27 H38 N6 O2 S' 510.695 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SNC 'L-peptide linking' n S-NITROSO-CYSTEINE ? 'C3 H6 N2 O3 S' 150.156 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 MET 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 GLN 8 8 ? ? ? A . n A 1 9 GLN 9 9 ? ? ? A . n A 1 10 MET 10 10 ? ? ? A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 TRP 108 108 108 TRP TRP A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 SNC 112 112 112 SNC SNC A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 TRP 120 120 120 TRP TRP A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 PRO 135 135 ? ? ? A . n A 1 136 SER 136 136 ? ? ? A . n A 1 137 ALA 137 137 ? ? ? A . n A 1 138 ALA 138 138 ? ? ? A . n A 1 139 SER 139 139 ? ? ? A . n A 1 140 ILE 140 140 ? ? ? A . n A 1 141 ASP 141 141 ? ? ? A . n A 1 142 ALA 142 142 ? ? ? A . n A 1 143 ALA 143 143 ? ? ? A . n A 1 144 LYS 144 144 ? ? ? A . n A 1 145 LYS 145 145 ? ? ? A . n A 1 146 ALA 146 146 ? ? ? A . n A 1 147 GLY 147 147 ? ? ? A . n A 1 148 VAL 148 148 ? ? ? A . n A 1 149 ASN 149 149 ? ? ? A . n A 1 150 ASN 150 150 ? ? ? A . n A 1 151 GLY 151 151 ? ? ? A . n A 1 152 ASN 152 152 ? ? ? A . n A 1 153 PRO 153 153 ? ? ? A . n A 1 154 LEU 154 154 ? ? ? A . n A 1 155 ASP 155 155 ? ? ? A . n A 1 156 ALA 156 156 ? ? ? A . n A 1 157 VAL 157 157 ? ? ? A . n A 1 158 GLN 158 158 ? ? ? A . n A 1 159 GLN 159 159 ? ? ? A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 CU ? ? CU ? ? 'SUBJECT OF INVESTIGATION' ? 2 A1BIA ? ? A1BIA ? ? 'SUBJECT OF INVESTIGATION' ? 3 SNC ? ? SNC ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1BIA 1 201 201 A1BIA SI6 A . C 3 CU 1 202 1 CU CU A . D 3 CU 1 203 2 CU CU A . E 4 SO4 1 204 1 SO4 SO4 A . F 5 HOH 1 301 128 HOH HOH A . F 5 HOH 2 302 104 HOH HOH A . F 5 HOH 3 303 7 HOH HOH A . F 5 HOH 4 304 114 HOH HOH A . F 5 HOH 5 305 120 HOH HOH A . F 5 HOH 6 306 2 HOH HOH A . F 5 HOH 7 307 94 HOH HOH A . F 5 HOH 8 308 40 HOH HOH A . F 5 HOH 9 309 75 HOH HOH A . F 5 HOH 10 310 119 HOH HOH A . F 5 HOH 11 311 107 HOH HOH A . F 5 HOH 12 312 45 HOH HOH A . F 5 HOH 13 313 82 HOH HOH A . F 5 HOH 14 314 23 HOH HOH A . F 5 HOH 15 315 54 HOH HOH A . F 5 HOH 16 316 35 HOH HOH A . F 5 HOH 17 317 58 HOH HOH A . F 5 HOH 18 318 4 HOH HOH A . F 5 HOH 19 319 26 HOH HOH A . F 5 HOH 20 320 99 HOH HOH A . F 5 HOH 21 321 30 HOH HOH A . F 5 HOH 22 322 133 HOH HOH A . F 5 HOH 23 323 140 HOH HOH A . F 5 HOH 24 324 25 HOH HOH A . F 5 HOH 25 325 20 HOH HOH A . F 5 HOH 26 326 9 HOH HOH A . F 5 HOH 27 327 46 HOH HOH A . F 5 HOH 28 328 85 HOH HOH A . F 5 HOH 29 329 118 HOH HOH A . F 5 HOH 30 330 80 HOH HOH A . F 5 HOH 31 331 32 HOH HOH A . F 5 HOH 32 332 5 HOH HOH A . F 5 HOH 33 333 110 HOH HOH A . F 5 HOH 34 334 19 HOH HOH A . F 5 HOH 35 335 123 HOH HOH A . F 5 HOH 36 336 12 HOH HOH A . F 5 HOH 37 337 16 HOH HOH A . F 5 HOH 38 338 74 HOH HOH A . F 5 HOH 39 339 48 HOH HOH A . F 5 HOH 40 340 47 HOH HOH A . F 5 HOH 41 341 33 HOH HOH A . F 5 HOH 42 342 63 HOH HOH A . F 5 HOH 43 343 56 HOH HOH A . F 5 HOH 44 344 31 HOH HOH A . F 5 HOH 45 345 10 HOH HOH A . F 5 HOH 46 346 57 HOH HOH A . F 5 HOH 47 347 122 HOH HOH A . F 5 HOH 48 348 17 HOH HOH A . F 5 HOH 49 349 84 HOH HOH A . F 5 HOH 50 350 1 HOH HOH A . F 5 HOH 51 351 3 HOH HOH A . F 5 HOH 52 352 44 HOH HOH A . F 5 HOH 53 353 116 HOH HOH A . F 5 HOH 54 354 41 HOH HOH A . F 5 HOH 55 355 101 HOH HOH A . F 5 HOH 56 356 28 HOH HOH A . F 5 HOH 57 357 18 HOH HOH A . F 5 HOH 58 358 50 HOH HOH A . F 5 HOH 59 359 6 HOH HOH A . F 5 HOH 60 360 69 HOH HOH A . F 5 HOH 61 361 49 HOH HOH A . F 5 HOH 62 362 61 HOH HOH A . F 5 HOH 63 363 34 HOH HOH A . F 5 HOH 64 364 13 HOH HOH A . F 5 HOH 65 365 37 HOH HOH A . F 5 HOH 66 366 68 HOH HOH A . F 5 HOH 67 367 42 HOH HOH A . F 5 HOH 68 368 83 HOH HOH A . F 5 HOH 69 369 52 HOH HOH A . F 5 HOH 70 370 8 HOH HOH A . F 5 HOH 71 371 22 HOH HOH A . F 5 HOH 72 372 91 HOH HOH A . F 5 HOH 73 373 70 HOH HOH A . F 5 HOH 74 374 27 HOH HOH A . F 5 HOH 75 375 14 HOH HOH A . F 5 HOH 76 376 38 HOH HOH A . F 5 HOH 77 377 139 HOH HOH A . F 5 HOH 78 378 11 HOH HOH A . F 5 HOH 79 379 60 HOH HOH A . F 5 HOH 80 380 24 HOH HOH A . F 5 HOH 81 381 21 HOH HOH A . F 5 HOH 82 382 89 HOH HOH A . F 5 HOH 83 383 55 HOH HOH A . F 5 HOH 84 384 141 HOH HOH A . F 5 HOH 85 385 43 HOH HOH A . F 5 HOH 86 386 93 HOH HOH A . F 5 HOH 87 387 97 HOH HOH A . F 5 HOH 88 388 59 HOH HOH A . F 5 HOH 89 389 136 HOH HOH A . F 5 HOH 90 390 78 HOH HOH A . F 5 HOH 91 391 15 HOH HOH A . F 5 HOH 92 392 105 HOH HOH A . F 5 HOH 93 393 102 HOH HOH A . F 5 HOH 94 394 95 HOH HOH A . F 5 HOH 95 395 39 HOH HOH A . F 5 HOH 96 396 115 HOH HOH A . F 5 HOH 97 397 29 HOH HOH A . F 5 HOH 98 398 103 HOH HOH A . F 5 HOH 99 399 96 HOH HOH A . F 5 HOH 100 400 64 HOH HOH A . F 5 HOH 101 401 81 HOH HOH A . F 5 HOH 102 402 88 HOH HOH A . F 5 HOH 103 403 109 HOH HOH A . F 5 HOH 104 404 90 HOH HOH A . F 5 HOH 105 405 71 HOH HOH A . F 5 HOH 106 406 62 HOH HOH A . F 5 HOH 107 407 134 HOH HOH A . F 5 HOH 108 408 127 HOH HOH A . F 5 HOH 109 409 125 HOH HOH A . F 5 HOH 110 410 66 HOH HOH A . F 5 HOH 111 411 126 HOH HOH A . F 5 HOH 112 412 131 HOH HOH A . F 5 HOH 113 413 106 HOH HOH A . F 5 HOH 114 414 111 HOH HOH A . F 5 HOH 115 415 142 HOH HOH A . F 5 HOH 116 416 138 HOH HOH A . F 5 HOH 117 417 98 HOH HOH A . F 5 HOH 118 418 143 HOH HOH A . F 5 HOH 119 419 130 HOH HOH A . F 5 HOH 120 420 135 HOH HOH A . F 5 HOH 121 421 53 HOH HOH A . F 5 HOH 122 422 76 HOH HOH A . F 5 HOH 123 423 145 HOH HOH A . F 5 HOH 124 424 112 HOH HOH A . F 5 HOH 125 425 132 HOH HOH A . F 5 HOH 126 426 129 HOH HOH A . F 5 HOH 127 427 73 HOH HOH A . F 5 HOH 128 428 87 HOH HOH A . F 5 HOH 129 429 117 HOH HOH A . F 5 HOH 130 430 100 HOH HOH A . F 5 HOH 131 431 108 HOH HOH A . F 5 HOH 132 432 67 HOH HOH A . F 5 HOH 133 433 79 HOH HOH A . F 5 HOH 134 434 144 HOH HOH A . F 5 HOH 135 435 137 HOH HOH A . F 5 HOH 136 436 72 HOH HOH A . F 5 HOH 137 437 124 HOH HOH A . F 5 HOH 138 438 92 HOH HOH A . F 5 HOH 139 439 86 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9EC5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.675 _cell.length_a_esd ? _cell.length_b 57.675 _cell.length_b_esd ? _cell.length_c 183.928 _cell.length_c_esd ? _cell.volume 611819.134 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9EC5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall 'I 4bw 2bw' _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9EC5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.93 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'ammonium sulfate, sodium acetate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-10-28 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97741 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97741 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 9.08 _reflns.entry_id 9EC5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.40 _reflns.d_resolution_low 45.98 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 31164 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.84 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.25 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.02387 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1057 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.4 _reflns_shell.d_res_low 1.45 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.82 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3045 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.9528 _reflns_shell.pdbx_Rpim_I_all 0.2238 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.917 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.9254 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 15.48 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9EC5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.40 _refine.ls_d_res_low 45.98 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 30495 _refine.ls_number_reflns_R_free 1504 _refine.ls_number_reflns_R_work 28991 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.84 _refine.ls_percent_reflns_R_free 4.93 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1977 _refine.ls_R_factor_R_free 0.2282 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1962 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.4470 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1628 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.40 _refine_hist.d_res_low 45.98 _refine_hist.number_atoms_solvent 139 _refine_hist.number_atoms_total 1115 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 933 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0064 ? 1045 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0851 ? 1431 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0865 ? 153 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0065 ? 181 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.0388 ? 343 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.40 1.45 . . 150 2630 99.93 . . . . 0.2880 . . . . . . . . . . . 0.3190 'X-RAY DIFFRACTION' 1.45 1.50 . . 128 2635 100.00 . . . . 0.2612 . . . . . . . . . . . 0.2793 'X-RAY DIFFRACTION' 1.50 1.56 . . 142 2650 99.86 . . . . 0.2423 . . . . . . . . . . . 0.2684 'X-RAY DIFFRACTION' 1.56 1.63 . . 145 2619 99.42 . . . . 0.2369 . . . . . . . . . . . 0.2709 'X-RAY DIFFRACTION' 1.63 1.71 . . 120 2611 98.13 . . . . 0.2339 . . . . . . . . . . . 0.2678 'X-RAY DIFFRACTION' 1.71 1.82 . . 140 2611 97.48 . . . . 0.2216 . . . . . . . . . . . 0.2423 'X-RAY DIFFRACTION' 1.82 1.96 . . 158 2470 93.26 . . . . 0.2118 . . . . . . . . . . . 0.2466 'X-RAY DIFFRACTION' 1.96 2.16 . . 130 2574 95.65 . . . . 0.1937 . . . . . . . . . . . 0.2012 'X-RAY DIFFRACTION' 2.16 2.47 . . 117 2644 96.81 . . . . 0.1801 . . . . . . . . . . . 0.1801 'X-RAY DIFFRACTION' 2.47 3.11 . . 131 2696 97.96 . . . . 0.1735 . . . . . . . . . . . 0.2276 'X-RAY DIFFRACTION' 3.12 45.98 . . 143 2851 97.94 . . . . 0.1592 . . . . . . . . . . . 0.1983 # _struct.entry_id 9EC5 _struct.title 'Streptavidin-S112C-L124F bound to Cu(II)dpea cofactor, containing S-nitrosocysteine modification' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9EC5 _struct_keywords.text 'biotin-streptavidin complex, artificial metalloprotein, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SAV_STRAV _struct_ref.pdbx_db_accession P22629 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWS GQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ ; _struct_ref.pdbx_align_begin 38 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9EC5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 14 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 159 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22629 _struct_ref_seq.db_align_beg 38 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 14 _struct_ref_seq.pdbx_auth_seq_align_end 159 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9EC5 MET A 1 ? UNP P22629 ? ? 'expression tag' 1 1 1 9EC5 ALA A 2 ? UNP P22629 ? ? 'expression tag' 2 2 1 9EC5 SER A 3 ? UNP P22629 ? ? 'expression tag' 3 3 1 9EC5 MET A 4 ? UNP P22629 ? ? 'expression tag' 4 4 1 9EC5 THR A 5 ? UNP P22629 ? ? 'expression tag' 5 5 1 9EC5 GLY A 6 ? UNP P22629 ? ? 'expression tag' 6 6 1 9EC5 GLY A 7 ? UNP P22629 ? ? 'expression tag' 7 7 1 9EC5 GLN A 8 ? UNP P22629 ? ? 'expression tag' 8 8 1 9EC5 GLN A 9 ? UNP P22629 ? ? 'expression tag' 9 9 1 9EC5 MET A 10 ? UNP P22629 ? ? 'expression tag' 10 10 1 9EC5 GLY A 11 ? UNP P22629 ? ? 'expression tag' 11 11 1 9EC5 ARG A 12 ? UNP P22629 ? ? 'expression tag' 12 12 1 9EC5 ASP A 13 ? UNP P22629 ? ? 'expression tag' 13 13 1 9EC5 GLN A 14 ? UNP P22629 GLU 38 'engineered mutation' 14 14 1 9EC5 SNC A 112 ? UNP P22629 SER 136 'engineered mutation' 112 15 1 9EC5 PHE A 124 ? UNP P22629 LEU 148 'engineered mutation' 124 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 14570 ? 1 MORE -131 ? 1 'SSA (A^2)' 18290 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z 0.0000000000 -1.0000000000 0.0000000000 57.6750000000 -1.0000000000 0.0000000000 0.0000000000 57.6750000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 10_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 57.6750000000 0.0000000000 -1.0000000000 0.0000000000 57.6750000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 15_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 13 ? THR A 18 ? ASP A 13 THR A 18 1 ? 6 HELX_P HELX_P2 AA2 THR A 115 ? LYS A 121 ? THR A 115 LYS A 121 5 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A THR 111 C ? ? ? 1_555 A SNC 112 N ? ? A THR 111 A SNC 112 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale2 covale both ? A SNC 112 C ? ? ? 1_555 A GLY 113 N ? ? A SNC 112 A GLY 113 1_555 ? ? ? ? ? ? ? 1.330 ? ? metalc1 metalc ? ? A HIS 87 NE2 ? ? ? 1_555 C CU . CU ? ? A HIS 87 A CU 202 1_555 ? ? ? ? ? ? ? 2.700 ? ? metalc2 metalc ? ? B A1BIA . N4 ? ? ? 1_555 D CU . CU ? ? A A1BIA 201 A CU 203 1_555 ? ? ? ? ? ? ? 2.420 ? ? metalc3 metalc ? ? B A1BIA . N5 ? ? ? 1_555 D CU . CU ? ? A A1BIA 201 A CU 203 1_555 ? ? ? ? ? ? ? 2.190 ? ? metalc4 metalc ? ? B A1BIA . N6 ? ? ? 1_555 D CU . CU ? ? A A1BIA 201 A CU 203 1_555 ? ? ? ? ? ? ? 2.115 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N4 ? B A1BIA . ? A A1BIA 201 ? 1_555 CU ? D CU . ? A CU 203 ? 1_555 N5 ? B A1BIA . ? A A1BIA 201 ? 1_555 77.6 ? 2 N4 ? B A1BIA . ? A A1BIA 201 ? 1_555 CU ? D CU . ? A CU 203 ? 1_555 N6 ? B A1BIA . ? A A1BIA 201 ? 1_555 94.3 ? 3 N5 ? B A1BIA . ? A A1BIA 201 ? 1_555 CU ? D CU . ? A CU 203 ? 1_555 N6 ? B A1BIA . ? A A1BIA 201 ? 1_555 140.3 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id SNC _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 112 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id SNC _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 112 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id SNC _pdbx_modification_feature.type Nitrosylation _pdbx_modification_feature.category 'Named protein modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 19 ? ASN A 23 ? GLY A 19 ASN A 23 AA1 2 THR A 28 ? ALA A 33 ? THR A 28 ALA A 33 AA1 3 ALA A 38 ? GLU A 44 ? ALA A 38 GLU A 44 AA1 4 TYR A 54 ? TYR A 60 ? TYR A 54 TYR A 60 AA1 5 THR A 71 ? LYS A 80 ? THR A 71 LYS A 80 AA1 6 ASN A 85 ? VAL A 97 ? ASN A 85 VAL A 97 AA1 7 ARG A 103 ? SNC A 112 ? ARG A 103 SNC A 112 AA1 8 THR A 123 ? THR A 131 ? THR A 123 THR A 131 AA1 9 GLY A 19 ? ASN A 23 ? GLY A 19 ASN A 23 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TRP A 21 ? N TRP A 21 O PHE A 29 ? O PHE A 29 AA1 2 3 N THR A 32 ? N THR A 32 O THR A 40 ? O THR A 40 AA1 3 4 N LEU A 39 ? N LEU A 39 O GLY A 58 ? O GLY A 58 AA1 4 5 N ARG A 59 ? N ARG A 59 O GLY A 74 ? O GLY A 74 AA1 5 6 N LEU A 73 ? N LEU A 73 O GLY A 94 ? O GLY A 94 AA1 6 7 N VAL A 97 ? N VAL A 97 O ARG A 103 ? O ARG A 103 AA1 7 8 N LEU A 110 ? N LEU A 110 O PHE A 124 ? O PHE A 124 AA1 8 9 O THR A 131 ? O THR A 131 N TYR A 22 ? N TYR A 22 # _pdbx_entry_details.entry_id 9EC5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 52 ? A 64.53 -156.17 2 1 SER A 52 ? B 62.60 -162.29 3 1 GLU A 101 ? ? -112.73 72.22 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 303 ? F HOH . 2 1 A HOH 304 ? F HOH . 3 1 A HOH 408 ? F HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x,z+3/4 3 y+1/2,-x,z+3/4 4 x+1/2,-y,-z+3/4 5 -x+1/2,y,-z+3/4 6 -x,-y,z 7 y,x,-z 8 -y,-x,-z 9 x+1/2,y+1/2,z+1/2 10 -y+1,x+1/2,z+5/4 11 y+1,-x+1/2,z+5/4 12 x+1,-y+1/2,-z+5/4 13 -x+1,y+1/2,-z+5/4 14 -x+1/2,-y+1/2,z+1/2 15 y+1/2,x+1/2,-z+1/2 16 -y+1/2,-x+1/2,-z+1/2 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 439 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.00 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A MET 4 ? A MET 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A GLN 8 ? A GLN 8 9 1 Y 1 A GLN 9 ? A GLN 9 10 1 Y 1 A MET 10 ? A MET 10 11 1 Y 1 A PRO 135 ? A PRO 135 12 1 Y 1 A SER 136 ? A SER 136 13 1 Y 1 A ALA 137 ? A ALA 137 14 1 Y 1 A ALA 138 ? A ALA 138 15 1 Y 1 A SER 139 ? A SER 139 16 1 Y 1 A ILE 140 ? A ILE 140 17 1 Y 1 A ASP 141 ? A ASP 141 18 1 Y 1 A ALA 142 ? A ALA 142 19 1 Y 1 A ALA 143 ? A ALA 143 20 1 Y 1 A LYS 144 ? A LYS 144 21 1 Y 1 A LYS 145 ? A LYS 145 22 1 Y 1 A ALA 146 ? A ALA 146 23 1 Y 1 A GLY 147 ? A GLY 147 24 1 Y 1 A VAL 148 ? A VAL 148 25 1 Y 1 A ASN 149 ? A ASN 149 26 1 Y 1 A ASN 150 ? A ASN 150 27 1 Y 1 A GLY 151 ? A GLY 151 28 1 Y 1 A ASN 152 ? A ASN 152 29 1 Y 1 A PRO 153 ? A PRO 153 30 1 Y 1 A LEU 154 ? A LEU 154 31 1 Y 1 A ASP 155 ? A ASP 155 32 1 Y 1 A ALA 156 ? A ALA 156 33 1 Y 1 A VAL 157 ? A VAL 157 34 1 Y 1 A GLN 158 ? A GLN 158 35 1 Y 1 A GLN 159 ? A GLN 159 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1BIA C1 C N N 1 A1BIA C2 C N R 2 A1BIA C3 C N N 3 A1BIA C4 C N S 4 A1BIA C5 C N S 5 A1BIA C6 C N N 6 A1BIA C7 C N N 7 A1BIA C8 C N N 8 A1BIA O1 O N N 9 A1BIA C9 C N N 10 A1BIA C10 C N N 11 A1BIA C11 C N N 12 A1BIA C12 C N N 13 A1BIA S1 S N N 14 A1BIA C13 C N N 15 A1BIA N1 N N N 16 A1BIA N2 N N N 17 A1BIA C14 C N N 18 A1BIA C15 C Y N 19 A1BIA N3 N N N 20 A1BIA N4 N N N 21 A1BIA C16 C Y N 22 A1BIA C17 C Y N 23 A1BIA C18 C Y N 24 A1BIA C19 C Y N 25 A1BIA C20 C N N 26 A1BIA C21 C N N 27 A1BIA C22 C Y N 28 A1BIA C23 C Y N 29 A1BIA C24 C Y N 30 A1BIA C25 C Y N 31 A1BIA C26 C Y N 32 A1BIA C27 C N N 33 A1BIA N5 N Y N 34 A1BIA N6 N Y N 35 A1BIA O2 O N N 36 A1BIA H02 H N N 37 A1BIA H05 H N N 38 A1BIA H04 H N N 39 A1BIA H07 H N N 40 A1BIA H08 H N N 41 A1BIA H10 H N N 42 A1BIA H09 H N N 43 A1BIA H11 H N N 44 A1BIA H12 H N N 45 A1BIA H14 H N N 46 A1BIA H13 H N N 47 A1BIA H16 H N N 48 A1BIA H15 H N N 49 A1BIA H17 H N N 50 A1BIA H18 H N N 51 A1BIA H20 H N N 52 A1BIA H19 H N N 53 A1BIA H21 H N N 54 A1BIA H22 H N N 55 A1BIA H01 H N N 56 A1BIA H03 H N N 57 A1BIA H23 H N N 58 A1BIA H24 H N N 59 A1BIA H06 H N N 60 A1BIA H25 H N N 61 A1BIA H26 H N N 62 A1BIA H27 H N N 63 A1BIA H28 H N N 64 A1BIA H30 H N N 65 A1BIA H29 H N N 66 A1BIA H32 H N N 67 A1BIA H31 H N N 68 A1BIA H33 H N N 69 A1BIA H34 H N N 70 A1BIA H35 H N N 71 A1BIA H36 H N N 72 A1BIA H38 H N N 73 A1BIA H37 H N N 74 ALA N N N N 75 ALA CA C N S 76 ALA C C N N 77 ALA O O N N 78 ALA CB C N N 79 ALA OXT O N N 80 ALA H H N N 81 ALA H2 H N N 82 ALA HA H N N 83 ALA HB1 H N N 84 ALA HB2 H N N 85 ALA HB3 H N N 86 ALA HXT H N N 87 ARG N N N N 88 ARG CA C N S 89 ARG C C N N 90 ARG O O N N 91 ARG CB C N N 92 ARG CG C N N 93 ARG CD C N N 94 ARG NE N N N 95 ARG CZ C N N 96 ARG NH1 N N N 97 ARG NH2 N N N 98 ARG OXT O N N 99 ARG H H N N 100 ARG H2 H N N 101 ARG HA H N N 102 ARG HB2 H N N 103 ARG HB3 H N N 104 ARG HG2 H N N 105 ARG HG3 H N N 106 ARG HD2 H N N 107 ARG HD3 H N N 108 ARG HE H N N 109 ARG HH11 H N N 110 ARG HH12 H N N 111 ARG HH21 H N N 112 ARG HH22 H N N 113 ARG HXT H N N 114 ASN N N N N 115 ASN CA C N S 116 ASN C C N N 117 ASN O O N N 118 ASN CB C N N 119 ASN CG C N N 120 ASN OD1 O N N 121 ASN ND2 N N N 122 ASN OXT O N N 123 ASN H H N N 124 ASN H2 H N N 125 ASN HA H N N 126 ASN HB2 H N N 127 ASN HB3 H N N 128 ASN HD21 H N N 129 ASN HD22 H N N 130 ASN HXT H N N 131 ASP N N N N 132 ASP CA C N S 133 ASP C C N N 134 ASP O O N N 135 ASP CB C N N 136 ASP CG C N N 137 ASP OD1 O N N 138 ASP OD2 O N N 139 ASP OXT O N N 140 ASP H H N N 141 ASP H2 H N N 142 ASP HA H N N 143 ASP HB2 H N N 144 ASP HB3 H N N 145 ASP HD2 H N N 146 ASP HXT H N N 147 CU CU CU N N 148 GLN N N N N 149 GLN CA C N S 150 GLN C C N N 151 GLN O O N N 152 GLN CB C N N 153 GLN CG C N N 154 GLN CD C N N 155 GLN OE1 O N N 156 GLN NE2 N N N 157 GLN OXT O N N 158 GLN H H N N 159 GLN H2 H N N 160 GLN HA H N N 161 GLN HB2 H N N 162 GLN HB3 H N N 163 GLN HG2 H N N 164 GLN HG3 H N N 165 GLN HE21 H N N 166 GLN HE22 H N N 167 GLN HXT H N N 168 GLU N N N N 169 GLU CA C N S 170 GLU C C N N 171 GLU O O N N 172 GLU CB C N N 173 GLU CG C N N 174 GLU CD C N N 175 GLU OE1 O N N 176 GLU OE2 O N N 177 GLU OXT O N N 178 GLU H H N N 179 GLU H2 H N N 180 GLU HA H N N 181 GLU HB2 H N N 182 GLU HB3 H N N 183 GLU HG2 H N N 184 GLU HG3 H N N 185 GLU HE2 H N N 186 GLU HXT H N N 187 GLY N N N N 188 GLY CA C N N 189 GLY C C N N 190 GLY O O N N 191 GLY OXT O N N 192 GLY H H N N 193 GLY H2 H N N 194 GLY HA2 H N N 195 GLY HA3 H N N 196 GLY HXT H N N 197 HIS N N N N 198 HIS CA C N S 199 HIS C C N N 200 HIS O O N N 201 HIS CB C N N 202 HIS CG C Y N 203 HIS ND1 N Y N 204 HIS CD2 C Y N 205 HIS CE1 C Y N 206 HIS NE2 N Y N 207 HIS OXT O N N 208 HIS H H N N 209 HIS H2 H N N 210 HIS HA H N N 211 HIS HB2 H N N 212 HIS HB3 H N N 213 HIS HD1 H N N 214 HIS HD2 H N N 215 HIS HE1 H N N 216 HIS HE2 H N N 217 HIS HXT H N N 218 HOH O O N N 219 HOH H1 H N N 220 HOH H2 H N N 221 ILE N N N N 222 ILE CA C N S 223 ILE C C N N 224 ILE O O N N 225 ILE CB C N S 226 ILE CG1 C N N 227 ILE CG2 C N N 228 ILE CD1 C N N 229 ILE OXT O N N 230 ILE H H N N 231 ILE H2 H N N 232 ILE HA H N N 233 ILE HB H N N 234 ILE HG12 H N N 235 ILE HG13 H N N 236 ILE HG21 H N N 237 ILE HG22 H N N 238 ILE HG23 H N N 239 ILE HD11 H N N 240 ILE HD12 H N N 241 ILE HD13 H N N 242 ILE HXT H N N 243 LEU N N N N 244 LEU CA C N S 245 LEU C C N N 246 LEU O O N N 247 LEU CB C N N 248 LEU CG C N N 249 LEU CD1 C N N 250 LEU CD2 C N N 251 LEU OXT O N N 252 LEU H H N N 253 LEU H2 H N N 254 LEU HA H N N 255 LEU HB2 H N N 256 LEU HB3 H N N 257 LEU HG H N N 258 LEU HD11 H N N 259 LEU HD12 H N N 260 LEU HD13 H N N 261 LEU HD21 H N N 262 LEU HD22 H N N 263 LEU HD23 H N N 264 LEU HXT H N N 265 LYS N N N N 266 LYS CA C N S 267 LYS C C N N 268 LYS O O N N 269 LYS CB C N N 270 LYS CG C N N 271 LYS CD C N N 272 LYS CE C N N 273 LYS NZ N N N 274 LYS OXT O N N 275 LYS H H N N 276 LYS H2 H N N 277 LYS HA H N N 278 LYS HB2 H N N 279 LYS HB3 H N N 280 LYS HG2 H N N 281 LYS HG3 H N N 282 LYS HD2 H N N 283 LYS HD3 H N N 284 LYS HE2 H N N 285 LYS HE3 H N N 286 LYS HZ1 H N N 287 LYS HZ2 H N N 288 LYS HZ3 H N N 289 LYS HXT H N N 290 MET N N N N 291 MET CA C N S 292 MET C C N N 293 MET O O N N 294 MET CB C N N 295 MET CG C N N 296 MET SD S N N 297 MET CE C N N 298 MET OXT O N N 299 MET H H N N 300 MET H2 H N N 301 MET HA H N N 302 MET HB2 H N N 303 MET HB3 H N N 304 MET HG2 H N N 305 MET HG3 H N N 306 MET HE1 H N N 307 MET HE2 H N N 308 MET HE3 H N N 309 MET HXT H N N 310 PHE N N N N 311 PHE CA C N S 312 PHE C C N N 313 PHE O O N N 314 PHE CB C N N 315 PHE CG C Y N 316 PHE CD1 C Y N 317 PHE CD2 C Y N 318 PHE CE1 C Y N 319 PHE CE2 C Y N 320 PHE CZ C Y N 321 PHE OXT O N N 322 PHE H H N N 323 PHE H2 H N N 324 PHE HA H N N 325 PHE HB2 H N N 326 PHE HB3 H N N 327 PHE HD1 H N N 328 PHE HD2 H N N 329 PHE HE1 H N N 330 PHE HE2 H N N 331 PHE HZ H N N 332 PHE HXT H N N 333 PRO N N N N 334 PRO CA C N S 335 PRO C C N N 336 PRO O O N N 337 PRO CB C N N 338 PRO CG C N N 339 PRO CD C N N 340 PRO OXT O N N 341 PRO H H N N 342 PRO HA H N N 343 PRO HB2 H N N 344 PRO HB3 H N N 345 PRO HG2 H N N 346 PRO HG3 H N N 347 PRO HD2 H N N 348 PRO HD3 H N N 349 PRO HXT H N N 350 SER N N N N 351 SER CA C N S 352 SER C C N N 353 SER O O N N 354 SER CB C N N 355 SER OG O N N 356 SER OXT O N N 357 SER H H N N 358 SER H2 H N N 359 SER HA H N N 360 SER HB2 H N N 361 SER HB3 H N N 362 SER HG H N N 363 SER HXT H N N 364 SNC N N N N 365 SNC CA C N R 366 SNC CB C N N 367 SNC SG S N N 368 SNC ND N N N 369 SNC OE O N N 370 SNC C C N N 371 SNC O O N N 372 SNC OXT O N N 373 SNC H H N N 374 SNC H2 H N N 375 SNC HA H N N 376 SNC HB2 H N N 377 SNC HB3 H N N 378 SNC HXT H N N 379 SO4 S S N N 380 SO4 O1 O N N 381 SO4 O2 O N N 382 SO4 O3 O N N 383 SO4 O4 O N N 384 THR N N N N 385 THR CA C N S 386 THR C C N N 387 THR O O N N 388 THR CB C N R 389 THR OG1 O N N 390 THR CG2 C N N 391 THR OXT O N N 392 THR H H N N 393 THR H2 H N N 394 THR HA H N N 395 THR HB H N N 396 THR HG1 H N N 397 THR HG21 H N N 398 THR HG22 H N N 399 THR HG23 H N N 400 THR HXT H N N 401 TRP N N N N 402 TRP CA C N S 403 TRP C C N N 404 TRP O O N N 405 TRP CB C N N 406 TRP CG C Y N 407 TRP CD1 C Y N 408 TRP CD2 C Y N 409 TRP NE1 N Y N 410 TRP CE2 C Y N 411 TRP CE3 C Y N 412 TRP CZ2 C Y N 413 TRP CZ3 C Y N 414 TRP CH2 C Y N 415 TRP OXT O N N 416 TRP H H N N 417 TRP H2 H N N 418 TRP HA H N N 419 TRP HB2 H N N 420 TRP HB3 H N N 421 TRP HD1 H N N 422 TRP HE1 H N N 423 TRP HE3 H N N 424 TRP HZ2 H N N 425 TRP HZ3 H N N 426 TRP HH2 H N N 427 TRP HXT H N N 428 TYR N N N N 429 TYR CA C N S 430 TYR C C N N 431 TYR O O N N 432 TYR CB C N N 433 TYR CG C Y N 434 TYR CD1 C Y N 435 TYR CD2 C Y N 436 TYR CE1 C Y N 437 TYR CE2 C Y N 438 TYR CZ C Y N 439 TYR OH O N N 440 TYR OXT O N N 441 TYR H H N N 442 TYR H2 H N N 443 TYR HA H N N 444 TYR HB2 H N N 445 TYR HB3 H N N 446 TYR HD1 H N N 447 TYR HD2 H N N 448 TYR HE1 H N N 449 TYR HE2 H N N 450 TYR HH H N N 451 TYR HXT H N N 452 VAL N N N N 453 VAL CA C N S 454 VAL C C N N 455 VAL O O N N 456 VAL CB C N N 457 VAL CG1 C N N 458 VAL CG2 C N N 459 VAL OXT O N N 460 VAL H H N N 461 VAL H2 H N N 462 VAL HA H N N 463 VAL HB H N N 464 VAL HG11 H N N 465 VAL HG12 H N N 466 VAL HG13 H N N 467 VAL HG21 H N N 468 VAL HG22 H N N 469 VAL HG23 H N N 470 VAL HXT H N N 471 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1BIA C1 N1 sing N N 1 A1BIA C1 O1 doub N N 2 A1BIA C1 N2 sing N N 3 A1BIA N1 C2 sing N N 4 A1BIA S1 C3 sing N N 5 A1BIA S1 C5 sing N N 6 A1BIA C2 C3 sing N N 7 A1BIA C2 C4 sing N N 8 A1BIA N2 C4 sing N N 9 A1BIA O2 C10 doub N N 10 A1BIA N3 C10 sing N N 11 A1BIA N3 C11 sing N N 12 A1BIA C4 C5 sing N N 13 A1BIA N4 C12 sing N N 14 A1BIA N4 C13 sing N N 15 A1BIA N4 C20 sing N N 16 A1BIA C5 C6 sing N N 17 A1BIA N5 C15 doub Y N 18 A1BIA N5 C16 sing Y N 19 A1BIA C6 C7 sing N N 20 A1BIA N6 C22 doub Y N 21 A1BIA N6 C23 sing Y N 22 A1BIA C7 C8 sing N N 23 A1BIA C8 C9 sing N N 24 A1BIA C9 C10 sing N N 25 A1BIA C11 C27 sing N N 26 A1BIA C12 C27 sing N N 27 A1BIA C13 C14 sing N N 28 A1BIA C14 C15 sing N N 29 A1BIA C15 C19 sing Y N 30 A1BIA C16 C17 doub Y N 31 A1BIA C17 C18 sing Y N 32 A1BIA C18 C19 doub Y N 33 A1BIA C20 C21 sing N N 34 A1BIA C21 C22 sing N N 35 A1BIA C22 C26 sing Y N 36 A1BIA C23 C24 doub Y N 37 A1BIA C24 C25 sing Y N 38 A1BIA C25 C26 doub Y N 39 A1BIA C2 H02 sing N N 40 A1BIA C3 H05 sing N N 41 A1BIA C3 H04 sing N N 42 A1BIA C4 H07 sing N N 43 A1BIA C5 H08 sing N N 44 A1BIA C6 H10 sing N N 45 A1BIA C6 H09 sing N N 46 A1BIA C7 H11 sing N N 47 A1BIA C7 H12 sing N N 48 A1BIA C8 H14 sing N N 49 A1BIA C8 H13 sing N N 50 A1BIA C9 H16 sing N N 51 A1BIA C9 H15 sing N N 52 A1BIA C11 H17 sing N N 53 A1BIA C11 H18 sing N N 54 A1BIA C12 H20 sing N N 55 A1BIA C12 H19 sing N N 56 A1BIA C13 H21 sing N N 57 A1BIA C13 H22 sing N N 58 A1BIA N1 H01 sing N N 59 A1BIA N2 H03 sing N N 60 A1BIA C14 H23 sing N N 61 A1BIA C14 H24 sing N N 62 A1BIA N3 H06 sing N N 63 A1BIA C16 H25 sing N N 64 A1BIA C17 H26 sing N N 65 A1BIA C18 H27 sing N N 66 A1BIA C19 H28 sing N N 67 A1BIA C20 H30 sing N N 68 A1BIA C20 H29 sing N N 69 A1BIA C21 H32 sing N N 70 A1BIA C21 H31 sing N N 71 A1BIA C23 H33 sing N N 72 A1BIA C24 H34 sing N N 73 A1BIA C25 H35 sing N N 74 A1BIA C26 H36 sing N N 75 A1BIA C27 H38 sing N N 76 A1BIA C27 H37 sing N N 77 ALA N CA sing N N 78 ALA N H sing N N 79 ALA N H2 sing N N 80 ALA CA C sing N N 81 ALA CA CB sing N N 82 ALA CA HA sing N N 83 ALA C O doub N N 84 ALA C OXT sing N N 85 ALA CB HB1 sing N N 86 ALA CB HB2 sing N N 87 ALA CB HB3 sing N N 88 ALA OXT HXT sing N N 89 ARG N CA sing N N 90 ARG N H sing N N 91 ARG N H2 sing N N 92 ARG CA C sing N N 93 ARG CA CB sing N N 94 ARG CA HA sing N N 95 ARG C O doub N N 96 ARG C OXT sing N N 97 ARG CB CG sing N N 98 ARG CB HB2 sing N N 99 ARG CB HB3 sing N N 100 ARG CG CD sing N N 101 ARG CG HG2 sing N N 102 ARG CG HG3 sing N N 103 ARG CD NE sing N N 104 ARG CD HD2 sing N N 105 ARG CD HD3 sing N N 106 ARG NE CZ sing N N 107 ARG NE HE sing N N 108 ARG CZ NH1 sing N N 109 ARG CZ NH2 doub N N 110 ARG NH1 HH11 sing N N 111 ARG NH1 HH12 sing N N 112 ARG NH2 HH21 sing N N 113 ARG NH2 HH22 sing N N 114 ARG OXT HXT sing N N 115 ASN N CA sing N N 116 ASN N H sing N N 117 ASN N H2 sing N N 118 ASN CA C sing N N 119 ASN CA CB sing N N 120 ASN CA HA sing N N 121 ASN C O doub N N 122 ASN C OXT sing N N 123 ASN CB CG sing N N 124 ASN CB HB2 sing N N 125 ASN CB HB3 sing N N 126 ASN CG OD1 doub N N 127 ASN CG ND2 sing N N 128 ASN ND2 HD21 sing N N 129 ASN ND2 HD22 sing N N 130 ASN OXT HXT sing N N 131 ASP N CA sing N N 132 ASP N H sing N N 133 ASP N H2 sing N N 134 ASP CA C sing N N 135 ASP CA CB sing N N 136 ASP CA HA sing N N 137 ASP C O doub N N 138 ASP C OXT sing N N 139 ASP CB CG sing N N 140 ASP CB HB2 sing N N 141 ASP CB HB3 sing N N 142 ASP CG OD1 doub N N 143 ASP CG OD2 sing N N 144 ASP OD2 HD2 sing N N 145 ASP OXT HXT sing N N 146 GLN N CA sing N N 147 GLN N H sing N N 148 GLN N H2 sing N N 149 GLN CA C sing N N 150 GLN CA CB sing N N 151 GLN CA HA sing N N 152 GLN C O doub N N 153 GLN C OXT sing N N 154 GLN CB CG sing N N 155 GLN CB HB2 sing N N 156 GLN CB HB3 sing N N 157 GLN CG CD sing N N 158 GLN CG HG2 sing N N 159 GLN CG HG3 sing N N 160 GLN CD OE1 doub N N 161 GLN CD NE2 sing N N 162 GLN NE2 HE21 sing N N 163 GLN NE2 HE22 sing N N 164 GLN OXT HXT sing N N 165 GLU N CA sing N N 166 GLU N H sing N N 167 GLU N H2 sing N N 168 GLU CA C sing N N 169 GLU CA CB sing N N 170 GLU CA HA sing N N 171 GLU C O doub N N 172 GLU C OXT sing N N 173 GLU CB CG sing N N 174 GLU CB HB2 sing N N 175 GLU CB HB3 sing N N 176 GLU CG CD sing N N 177 GLU CG HG2 sing N N 178 GLU CG HG3 sing N N 179 GLU CD OE1 doub N N 180 GLU CD OE2 sing N N 181 GLU OE2 HE2 sing N N 182 GLU OXT HXT sing N N 183 GLY N CA sing N N 184 GLY N H sing N N 185 GLY N H2 sing N N 186 GLY CA C sing N N 187 GLY CA HA2 sing N N 188 GLY CA HA3 sing N N 189 GLY C O doub N N 190 GLY C OXT sing N N 191 GLY OXT HXT sing N N 192 HIS N CA sing N N 193 HIS N H sing N N 194 HIS N H2 sing N N 195 HIS CA C sing N N 196 HIS CA CB sing N N 197 HIS CA HA sing N N 198 HIS C O doub N N 199 HIS C OXT sing N N 200 HIS CB CG sing N N 201 HIS CB HB2 sing N N 202 HIS CB HB3 sing N N 203 HIS CG ND1 sing Y N 204 HIS CG CD2 doub Y N 205 HIS ND1 CE1 doub Y N 206 HIS ND1 HD1 sing N N 207 HIS CD2 NE2 sing Y N 208 HIS CD2 HD2 sing N N 209 HIS CE1 NE2 sing Y N 210 HIS CE1 HE1 sing N N 211 HIS NE2 HE2 sing N N 212 HIS OXT HXT sing N N 213 HOH O H1 sing N N 214 HOH O H2 sing N N 215 ILE N CA sing N N 216 ILE N H sing N N 217 ILE N H2 sing N N 218 ILE CA C sing N N 219 ILE CA CB sing N N 220 ILE CA HA sing N N 221 ILE C O doub N N 222 ILE C OXT sing N N 223 ILE CB CG1 sing N N 224 ILE CB CG2 sing N N 225 ILE CB HB sing N N 226 ILE CG1 CD1 sing N N 227 ILE CG1 HG12 sing N N 228 ILE CG1 HG13 sing N N 229 ILE CG2 HG21 sing N N 230 ILE CG2 HG22 sing N N 231 ILE CG2 HG23 sing N N 232 ILE CD1 HD11 sing N N 233 ILE CD1 HD12 sing N N 234 ILE CD1 HD13 sing N N 235 ILE OXT HXT sing N N 236 LEU N CA sing N N 237 LEU N H sing N N 238 LEU N H2 sing N N 239 LEU CA C sing N N 240 LEU CA CB sing N N 241 LEU CA HA sing N N 242 LEU C O doub N N 243 LEU C OXT sing N N 244 LEU CB CG sing N N 245 LEU CB HB2 sing N N 246 LEU CB HB3 sing N N 247 LEU CG CD1 sing N N 248 LEU CG CD2 sing N N 249 LEU CG HG sing N N 250 LEU CD1 HD11 sing N N 251 LEU CD1 HD12 sing N N 252 LEU CD1 HD13 sing N N 253 LEU CD2 HD21 sing N N 254 LEU CD2 HD22 sing N N 255 LEU CD2 HD23 sing N N 256 LEU OXT HXT sing N N 257 LYS N CA sing N N 258 LYS N H sing N N 259 LYS N H2 sing N N 260 LYS CA C sing N N 261 LYS CA CB sing N N 262 LYS CA HA sing N N 263 LYS C O doub N N 264 LYS C OXT sing N N 265 LYS CB CG sing N N 266 LYS CB HB2 sing N N 267 LYS CB HB3 sing N N 268 LYS CG CD sing N N 269 LYS CG HG2 sing N N 270 LYS CG HG3 sing N N 271 LYS CD CE sing N N 272 LYS CD HD2 sing N N 273 LYS CD HD3 sing N N 274 LYS CE NZ sing N N 275 LYS CE HE2 sing N N 276 LYS CE HE3 sing N N 277 LYS NZ HZ1 sing N N 278 LYS NZ HZ2 sing N N 279 LYS NZ HZ3 sing N N 280 LYS OXT HXT sing N N 281 MET N CA sing N N 282 MET N H sing N N 283 MET N H2 sing N N 284 MET CA C sing N N 285 MET CA CB sing N N 286 MET CA HA sing N N 287 MET C O doub N N 288 MET C OXT sing N N 289 MET CB CG sing N N 290 MET CB HB2 sing N N 291 MET CB HB3 sing N N 292 MET CG SD sing N N 293 MET CG HG2 sing N N 294 MET CG HG3 sing N N 295 MET SD CE sing N N 296 MET CE HE1 sing N N 297 MET CE HE2 sing N N 298 MET CE HE3 sing N N 299 MET OXT HXT sing N N 300 PHE N CA sing N N 301 PHE N H sing N N 302 PHE N H2 sing N N 303 PHE CA C sing N N 304 PHE CA CB sing N N 305 PHE CA HA sing N N 306 PHE C O doub N N 307 PHE C OXT sing N N 308 PHE CB CG sing N N 309 PHE CB HB2 sing N N 310 PHE CB HB3 sing N N 311 PHE CG CD1 doub Y N 312 PHE CG CD2 sing Y N 313 PHE CD1 CE1 sing Y N 314 PHE CD1 HD1 sing N N 315 PHE CD2 CE2 doub Y N 316 PHE CD2 HD2 sing N N 317 PHE CE1 CZ doub Y N 318 PHE CE1 HE1 sing N N 319 PHE CE2 CZ sing Y N 320 PHE CE2 HE2 sing N N 321 PHE CZ HZ sing N N 322 PHE OXT HXT sing N N 323 PRO N CA sing N N 324 PRO N CD sing N N 325 PRO N H sing N N 326 PRO CA C sing N N 327 PRO CA CB sing N N 328 PRO CA HA sing N N 329 PRO C O doub N N 330 PRO C OXT sing N N 331 PRO CB CG sing N N 332 PRO CB HB2 sing N N 333 PRO CB HB3 sing N N 334 PRO CG CD sing N N 335 PRO CG HG2 sing N N 336 PRO CG HG3 sing N N 337 PRO CD HD2 sing N N 338 PRO CD HD3 sing N N 339 PRO OXT HXT sing N N 340 SER N CA sing N N 341 SER N H sing N N 342 SER N H2 sing N N 343 SER CA C sing N N 344 SER CA CB sing N N 345 SER CA HA sing N N 346 SER C O doub N N 347 SER C OXT sing N N 348 SER CB OG sing N N 349 SER CB HB2 sing N N 350 SER CB HB3 sing N N 351 SER OG HG sing N N 352 SER OXT HXT sing N N 353 SNC N CA sing N N 354 SNC N H sing N N 355 SNC N H2 sing N N 356 SNC CA CB sing N N 357 SNC CA C sing N N 358 SNC CA HA sing N N 359 SNC CB SG sing N N 360 SNC CB HB2 sing N N 361 SNC CB HB3 sing N N 362 SNC SG ND sing N N 363 SNC ND OE doub N N 364 SNC C O doub N N 365 SNC C OXT sing N N 366 SNC OXT HXT sing N N 367 SO4 S O1 doub N N 368 SO4 S O2 doub N N 369 SO4 S O3 sing N N 370 SO4 S O4 sing N N 371 THR N CA sing N N 372 THR N H sing N N 373 THR N H2 sing N N 374 THR CA C sing N N 375 THR CA CB sing N N 376 THR CA HA sing N N 377 THR C O doub N N 378 THR C OXT sing N N 379 THR CB OG1 sing N N 380 THR CB CG2 sing N N 381 THR CB HB sing N N 382 THR OG1 HG1 sing N N 383 THR CG2 HG21 sing N N 384 THR CG2 HG22 sing N N 385 THR CG2 HG23 sing N N 386 THR OXT HXT sing N N 387 TRP N CA sing N N 388 TRP N H sing N N 389 TRP N H2 sing N N 390 TRP CA C sing N N 391 TRP CA CB sing N N 392 TRP CA HA sing N N 393 TRP C O doub N N 394 TRP C OXT sing N N 395 TRP CB CG sing N N 396 TRP CB HB2 sing N N 397 TRP CB HB3 sing N N 398 TRP CG CD1 doub Y N 399 TRP CG CD2 sing Y N 400 TRP CD1 NE1 sing Y N 401 TRP CD1 HD1 sing N N 402 TRP CD2 CE2 doub Y N 403 TRP CD2 CE3 sing Y N 404 TRP NE1 CE2 sing Y N 405 TRP NE1 HE1 sing N N 406 TRP CE2 CZ2 sing Y N 407 TRP CE3 CZ3 doub Y N 408 TRP CE3 HE3 sing N N 409 TRP CZ2 CH2 doub Y N 410 TRP CZ2 HZ2 sing N N 411 TRP CZ3 CH2 sing Y N 412 TRP CZ3 HZ3 sing N N 413 TRP CH2 HH2 sing N N 414 TRP OXT HXT sing N N 415 TYR N CA sing N N 416 TYR N H sing N N 417 TYR N H2 sing N N 418 TYR CA C sing N N 419 TYR CA CB sing N N 420 TYR CA HA sing N N 421 TYR C O doub N N 422 TYR C OXT sing N N 423 TYR CB CG sing N N 424 TYR CB HB2 sing N N 425 TYR CB HB3 sing N N 426 TYR CG CD1 doub Y N 427 TYR CG CD2 sing Y N 428 TYR CD1 CE1 sing Y N 429 TYR CD1 HD1 sing N N 430 TYR CD2 CE2 doub Y N 431 TYR CD2 HD2 sing N N 432 TYR CE1 CZ doub Y N 433 TYR CE1 HE1 sing N N 434 TYR CE2 CZ sing Y N 435 TYR CE2 HE2 sing N N 436 TYR CZ OH sing N N 437 TYR OH HH sing N N 438 TYR OXT HXT sing N N 439 VAL N CA sing N N 440 VAL N H sing N N 441 VAL N H2 sing N N 442 VAL CA C sing N N 443 VAL CA CB sing N N 444 VAL CA HA sing N N 445 VAL C O doub N N 446 VAL C OXT sing N N 447 VAL CB CG1 sing N N 448 VAL CB CG2 sing N N 449 VAL CB HB sing N N 450 VAL CG1 HG11 sing N N 451 VAL CG1 HG12 sing N N 452 VAL CG1 HG13 sing N N 453 VAL CG2 HG21 sing N N 454 VAL CG2 HG22 sing N N 455 VAL CG2 HG23 sing N N 456 VAL OXT HXT sing N N 457 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM120349 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2QCB _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 41 2 2' _space_group.name_Hall 'I 4bw 2bw' _space_group.IT_number 98 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9EC5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017339 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017339 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005437 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CU ? ? 23.42449 5.47274 ? ? 2.18335 24.96234 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #