data_9EMS # _entry.id 9EMS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9EMS pdb_00009ems 10.2210/pdb9ems/pdb WWPDB D_1292137189 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9EMS _pdbx_database_status.recvd_initial_deposition_date 2024-03-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email timm.maier@unbas.ch _pdbx_contact_author.name_first Timm _pdbx_contact_author.name_last Maier _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7459-1363 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jakob, R.P.' 1 0000-0002-6451-8656 'Cramer, J.' 2 0000-0001-9869-5645 'Maier, T.' 3 0000-0002-7459-1363 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 67 _citation.language ? _citation.page_first 13813 _citation.page_last 13828 _citation.title 'Thermodynamics-Guided Design Reveals a Cooperative Hydrogen Bond in DC-SIGN-targeted Glycomimetics.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.4c00623 _citation.pdbx_database_id_PubMed 38771131 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nemli, D.D.' 1 ? primary 'Jiang, X.' 2 ? primary 'Jakob, R.P.' 3 ? primary 'Gloder, L.M.' 4 ? primary 'Schwardt, O.' 5 ? primary 'Rabbani, S.' 6 ? primary 'Maier, T.' 7 0000-0002-7459-1363 primary 'Ernst, B.' 8 0000-0001-5787-2297 primary 'Cramer, J.' 9 0000-0001-9869-5645 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DC-SIGN, CRD domain' 18160.051 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 non-polymer syn ;(2~{R},3~{S},4~{R},5~{S},6~{S})-6-[(2~{S})-3-azanyl-2-oxidanyl-propoxy]-2-(hydroxymethyl)-5-(4-phenyl-1,2,3-triazol-1-yl)oxane-3,4-diol ; 380.396 1 ? ? ? ? 4 water nat water 18.015 12 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'C-type lectin domain family 4 member L,Dendritic cell-specific ICAM-3-grabbing non-integrin 1,DC-SIGN,DC-SIGN1,CD209 antigen' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEG TWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEG TWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 ;(2~{R},3~{S},4~{R},5~{S},6~{S})-6-[(2~{S})-3-azanyl-2-oxidanyl-propoxy]-2-(hydroxymethyl)-5-(4-phenyl-1,2,3-triazol-1-yl)oxane-3,4-diol ; A1H5X 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLU n 1 6 ARG n 1 7 LEU n 1 8 CYS n 1 9 HIS n 1 10 PRO n 1 11 CYS n 1 12 PRO n 1 13 TRP n 1 14 GLU n 1 15 TRP n 1 16 THR n 1 17 PHE n 1 18 PHE n 1 19 GLN n 1 20 GLY n 1 21 ASN n 1 22 CYS n 1 23 TYR n 1 24 PHE n 1 25 MET n 1 26 SER n 1 27 ASN n 1 28 SER n 1 29 GLN n 1 30 ARG n 1 31 ASN n 1 32 TRP n 1 33 HIS n 1 34 ASP n 1 35 SER n 1 36 ILE n 1 37 THR n 1 38 ALA n 1 39 CYS n 1 40 LYS n 1 41 GLU n 1 42 VAL n 1 43 GLY n 1 44 ALA n 1 45 GLN n 1 46 LEU n 1 47 VAL n 1 48 VAL n 1 49 ILE n 1 50 LYS n 1 51 SER n 1 52 ALA n 1 53 GLU n 1 54 GLU n 1 55 GLN n 1 56 ASN n 1 57 PHE n 1 58 LEU n 1 59 GLN n 1 60 LEU n 1 61 GLN n 1 62 SER n 1 63 SER n 1 64 ARG n 1 65 SER n 1 66 ASN n 1 67 ARG n 1 68 PHE n 1 69 THR n 1 70 TRP n 1 71 MET n 1 72 GLY n 1 73 LEU n 1 74 SER n 1 75 ASP n 1 76 LEU n 1 77 ASN n 1 78 GLN n 1 79 GLU n 1 80 GLY n 1 81 THR n 1 82 TRP n 1 83 GLN n 1 84 TRP n 1 85 VAL n 1 86 ASP n 1 87 GLY n 1 88 SER n 1 89 PRO n 1 90 LEU n 1 91 LEU n 1 92 PRO n 1 93 SER n 1 94 PHE n 1 95 LYS n 1 96 GLN n 1 97 TYR n 1 98 TRP n 1 99 ASN n 1 100 ARG n 1 101 GLY n 1 102 GLU n 1 103 PRO n 1 104 ASN n 1 105 ASN n 1 106 VAL n 1 107 GLY n 1 108 GLU n 1 109 GLU n 1 110 ASP n 1 111 CYS n 1 112 ALA n 1 113 GLU n 1 114 PHE n 1 115 SER n 1 116 GLY n 1 117 ASN n 1 118 GLY n 1 119 TRP n 1 120 ASN n 1 121 ASP n 1 122 ASP n 1 123 LYS n 1 124 CYS n 1 125 ASN n 1 126 LEU n 1 127 ALA n 1 128 LYS n 1 129 PHE n 1 130 TRP n 1 131 ILE n 1 132 CYS n 1 133 LYS n 1 134 LYS n 1 135 SER n 1 136 ALA n 1 137 ALA n 1 138 SER n 1 139 CYS n 1 140 SER n 1 141 ARG n 1 142 ASP n 1 143 GLU n 1 144 GLU n 1 145 GLN n 1 146 PHE n 1 147 LEU n 1 148 SER n 1 149 PRO n 1 150 ALA n 1 151 PRO n 1 152 ALA n 1 153 THR n 1 154 PRO n 1 155 ASN n 1 156 PRO n 1 157 PRO n 1 158 PRO n 1 159 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 159 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CD209, CLEC4L' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1H5X non-polymer . ;(2~{R},3~{S},4~{R},5~{S},6~{S})-6-[(2~{S})-3-azanyl-2-oxidanyl-propoxy]-2-(hydroxymethyl)-5-(4-phenyl-1,2,3-triazol-1-yl)oxane-3,4-diol ; ? 'C17 H24 N4 O6' 380.396 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 246 ? ? ? A . n A 1 2 SER 2 247 ? ? ? A . n A 1 3 HIS 3 248 ? ? ? A . n A 1 4 MET 4 249 ? ? ? A . n A 1 5 GLU 5 250 ? ? ? A . n A 1 6 ARG 6 251 ? ? ? A . n A 1 7 LEU 7 252 ? ? ? A . n A 1 8 CYS 8 253 253 CYS CYS A . n A 1 9 HIS 9 254 254 HIS HIS A . n A 1 10 PRO 10 255 255 PRO PRO A . n A 1 11 CYS 11 256 256 CYS CYS A . n A 1 12 PRO 12 257 257 PRO PRO A . n A 1 13 TRP 13 258 258 TRP TRP A . n A 1 14 GLU 14 259 259 GLU GLU A . n A 1 15 TRP 15 260 260 TRP TRP A . n A 1 16 THR 16 261 261 THR THR A . n A 1 17 PHE 17 262 262 PHE PHE A . n A 1 18 PHE 18 263 263 PHE PHE A . n A 1 19 GLN 19 264 264 GLN GLN A . n A 1 20 GLY 20 265 265 GLY GLY A . n A 1 21 ASN 21 266 266 ASN ASN A . n A 1 22 CYS 22 267 267 CYS CYS A . n A 1 23 TYR 23 268 268 TYR TYR A . n A 1 24 PHE 24 269 269 PHE PHE A . n A 1 25 MET 25 270 270 MET MET A . n A 1 26 SER 26 271 271 SER SER A . n A 1 27 ASN 27 272 272 ASN ASN A . n A 1 28 SER 28 273 273 SER SER A . n A 1 29 GLN 29 274 274 GLN GLN A . n A 1 30 ARG 30 275 275 ARG ARG A . n A 1 31 ASN 31 276 276 ASN ASN A . n A 1 32 TRP 32 277 277 TRP TRP A . n A 1 33 HIS 33 278 278 HIS HIS A . n A 1 34 ASP 34 279 279 ASP ASP A . n A 1 35 SER 35 280 280 SER SER A . n A 1 36 ILE 36 281 281 ILE ILE A . n A 1 37 THR 37 282 282 THR THR A . n A 1 38 ALA 38 283 283 ALA ALA A . n A 1 39 CYS 39 284 284 CYS CYS A . n A 1 40 LYS 40 285 285 LYS LYS A . n A 1 41 GLU 41 286 286 GLU GLU A . n A 1 42 VAL 42 287 287 VAL VAL A . n A 1 43 GLY 43 288 288 GLY GLY A . n A 1 44 ALA 44 289 289 ALA ALA A . n A 1 45 GLN 45 290 290 GLN GLN A . n A 1 46 LEU 46 291 291 LEU LEU A . n A 1 47 VAL 47 292 292 VAL VAL A . n A 1 48 VAL 48 293 293 VAL VAL A . n A 1 49 ILE 49 294 294 ILE ILE A . n A 1 50 LYS 50 295 295 LYS LYS A . n A 1 51 SER 51 296 296 SER SER A . n A 1 52 ALA 52 297 297 ALA ALA A . n A 1 53 GLU 53 298 298 GLU GLU A . n A 1 54 GLU 54 299 299 GLU GLU A . n A 1 55 GLN 55 300 300 GLN GLN A . n A 1 56 ASN 56 301 301 ASN ASN A . n A 1 57 PHE 57 302 302 PHE PHE A . n A 1 58 LEU 58 303 303 LEU LEU A . n A 1 59 GLN 59 304 304 GLN GLN A . n A 1 60 LEU 60 305 305 LEU LEU A . n A 1 61 GLN 61 306 306 GLN GLN A . n A 1 62 SER 62 307 307 SER SER A . n A 1 63 SER 63 308 308 SER SER A . n A 1 64 ARG 64 309 309 ARG ARG A . n A 1 65 SER 65 310 310 SER SER A . n A 1 66 ASN 66 311 311 ASN ASN A . n A 1 67 ARG 67 312 312 ARG ARG A . n A 1 68 PHE 68 313 313 PHE PHE A . n A 1 69 THR 69 314 314 THR THR A . n A 1 70 TRP 70 315 315 TRP TRP A . n A 1 71 MET 71 316 316 MET MET A . n A 1 72 GLY 72 317 317 GLY GLY A . n A 1 73 LEU 73 318 318 LEU LEU A . n A 1 74 SER 74 319 319 SER SER A . n A 1 75 ASP 75 320 320 ASP ASP A . n A 1 76 LEU 76 321 321 LEU LEU A . n A 1 77 ASN 77 322 322 ASN ASN A . n A 1 78 GLN 78 323 323 GLN GLN A . n A 1 79 GLU 79 324 324 GLU GLU A . n A 1 80 GLY 80 325 325 GLY GLY A . n A 1 81 THR 81 326 326 THR THR A . n A 1 82 TRP 82 327 327 TRP TRP A . n A 1 83 GLN 83 328 328 GLN GLN A . n A 1 84 TRP 84 329 329 TRP TRP A . n A 1 85 VAL 85 330 330 VAL VAL A . n A 1 86 ASP 86 331 331 ASP ASP A . n A 1 87 GLY 87 332 332 GLY GLY A . n A 1 88 SER 88 333 333 SER SER A . n A 1 89 PRO 89 334 334 PRO PRO A . n A 1 90 LEU 90 335 335 LEU LEU A . n A 1 91 LEU 91 336 336 LEU LEU A . n A 1 92 PRO 92 337 337 PRO PRO A . n A 1 93 SER 93 338 338 SER SER A . n A 1 94 PHE 94 339 339 PHE PHE A . n A 1 95 LYS 95 340 340 LYS LYS A . n A 1 96 GLN 96 341 341 GLN GLN A . n A 1 97 TYR 97 342 342 TYR TYR A . n A 1 98 TRP 98 343 343 TRP TRP A . n A 1 99 ASN 99 344 344 ASN ASN A . n A 1 100 ARG 100 345 345 ARG ARG A . n A 1 101 GLY 101 346 346 GLY GLY A . n A 1 102 GLU 102 347 347 GLU GLU A . n A 1 103 PRO 103 348 348 PRO PRO A . n A 1 104 ASN 104 349 349 ASN ASN A . n A 1 105 ASN 105 350 350 ASN ASN A . n A 1 106 VAL 106 351 351 VAL VAL A . n A 1 107 GLY 107 352 352 GLY GLY A . n A 1 108 GLU 108 353 353 GLU GLU A . n A 1 109 GLU 109 354 354 GLU GLU A . n A 1 110 ASP 110 355 355 ASP ASP A . n A 1 111 CYS 111 356 356 CYS CYS A . n A 1 112 ALA 112 357 357 ALA ALA A . n A 1 113 GLU 113 358 358 GLU GLU A . n A 1 114 PHE 114 359 359 PHE PHE A . n A 1 115 SER 115 360 360 SER SER A . n A 1 116 GLY 116 361 361 GLY GLY A . n A 1 117 ASN 117 362 362 ASN ASN A . n A 1 118 GLY 118 363 363 GLY GLY A . n A 1 119 TRP 119 364 364 TRP TRP A . n A 1 120 ASN 120 365 365 ASN ASN A . n A 1 121 ASP 121 366 366 ASP ASP A . n A 1 122 ASP 122 367 367 ASP ASP A . n A 1 123 LYS 123 368 368 LYS LYS A . n A 1 124 CYS 124 369 369 CYS CYS A . n A 1 125 ASN 125 370 370 ASN ASN A . n A 1 126 LEU 126 371 371 LEU LEU A . n A 1 127 ALA 127 372 372 ALA ALA A . n A 1 128 LYS 128 373 373 LYS LYS A . n A 1 129 PHE 129 374 374 PHE PHE A . n A 1 130 TRP 130 375 375 TRP TRP A . n A 1 131 ILE 131 376 376 ILE ILE A . n A 1 132 CYS 132 377 377 CYS CYS A . n A 1 133 LYS 133 378 378 LYS LYS A . n A 1 134 LYS 134 379 379 LYS LYS A . n A 1 135 SER 135 380 380 SER SER A . n A 1 136 ALA 136 381 381 ALA ALA A . n A 1 137 ALA 137 382 382 ALA ALA A . n A 1 138 SER 138 383 383 SER SER A . n A 1 139 CYS 139 384 384 CYS CYS A . n A 1 140 SER 140 385 ? ? ? A . n A 1 141 ARG 141 386 ? ? ? A . n A 1 142 ASP 142 387 ? ? ? A . n A 1 143 GLU 143 388 ? ? ? A . n A 1 144 GLU 144 389 ? ? ? A . n A 1 145 GLN 145 390 ? ? ? A . n A 1 146 PHE 146 391 ? ? ? A . n A 1 147 LEU 147 392 ? ? ? A . n A 1 148 SER 148 393 ? ? ? A . n A 1 149 PRO 149 394 ? ? ? A . n A 1 150 ALA 150 395 ? ? ? A . n A 1 151 PRO 151 396 ? ? ? A . n A 1 152 ALA 152 397 ? ? ? A . n A 1 153 THR 153 398 ? ? ? A . n A 1 154 PRO 154 399 ? ? ? A . n A 1 155 ASN 155 400 ? ? ? A . n A 1 156 PRO 156 401 ? ? ? A . n A 1 157 PRO 157 402 ? ? ? A . n A 1 158 PRO 158 403 ? ? ? A . n A 1 159 ALA 159 404 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1H5X _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1H5X _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 501 402 CA CA A . C 2 CA 1 502 403 CA CA A . D 3 A1H5X 1 503 405 A1H5X JXH A . E 4 HOH 1 601 3 HOH HOH A . E 4 HOH 2 602 7 HOH HOH A . E 4 HOH 3 603 10 HOH HOH A . E 4 HOH 4 604 12 HOH HOH A . E 4 HOH 5 605 11 HOH HOH A . E 4 HOH 6 606 6 HOH HOH A . E 4 HOH 7 607 2 HOH HOH A . E 4 HOH 8 608 13 HOH HOH A . E 4 HOH 9 609 4 HOH HOH A . E 4 HOH 10 610 9 HOH HOH A . E 4 HOH 11 611 14 HOH HOH A . E 4 HOH 12 612 15 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.12rc1_2801: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9EMS _cell.details ? _cell.formula_units_Z ? _cell.length_a 74.901 _cell.length_a_esd ? _cell.length_b 74.901 _cell.length_b_esd ? _cell.length_c 61.146 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9EMS _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9EMS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M MgCl2, 0.1m Hepes 7.5, 30% Isopropanol' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-07-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.99986 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.99986 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9EMS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.9 _reflns.d_resolution_low 47.37 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4177 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.134 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.994 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.9 _reflns_shell.d_res_low 3.0 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 416 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 26.7 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 1.05 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.44 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.0 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9EMS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.900 _refine.ls_d_res_low 47.367 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4164 _refine.ls_number_reflns_R_free 221 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.66 _refine.ls_percent_reflns_R_free 5.31 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2240 _refine.ls_R_factor_R_free 0.2541 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2222 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.87 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.30 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1070 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1112 _refine_hist.d_res_high 2.900 _refine_hist.d_res_low 47.367 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1141 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.562 ? 1553 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 17.394 ? 651 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.036 ? 150 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 200 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.9001 3.0000 . . 83 416 99.1 . . . . 0.3298 . . . . . . . . . . . 0.3468 'X-RAY DIFFRACTION' 3.6537 47.367 . . 119 2023 100.00 . . . . 0.2106 . . . . . . . . . . . 0.2205 # _struct.entry_id 9EMS _struct.title 'Crystal Structure of DC-SIGN in complex with JXH1902' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9EMS _struct_keywords.text 'DC-SIGN, glycomimetic, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CD209_HUMAN _struct_ref.pdbx_db_accession Q9NNX6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQW VDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA ; _struct_ref.pdbx_align_begin 250 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9EMS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 159 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NNX6 _struct_ref_seq.db_align_beg 250 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 404 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 250 _struct_ref_seq.pdbx_auth_seq_align_end 404 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9EMS GLY A 1 ? UNP Q9NNX6 ? ? 'expression tag' 246 1 1 9EMS SER A 2 ? UNP Q9NNX6 ? ? 'expression tag' 247 2 1 9EMS HIS A 3 ? UNP Q9NNX6 ? ? 'expression tag' 248 3 1 9EMS MET A 4 ? UNP Q9NNX6 ? ? 'expression tag' 249 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 90 ? 1 MORE -12 ? 1 'SSA (A^2)' 7320 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 31 ? VAL A 42 ? ASN A 276 VAL A 287 1 ? 12 HELX_P HELX_P2 AA2 SER A 51 ? SER A 65 ? SER A 296 SER A 310 1 ? 15 HELX_P HELX_P3 AA3 LEU A 91 ? TRP A 98 ? LEU A 336 TRP A 343 5 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 139 SG ? ? A CYS 253 A CYS 384 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 256 A CYS 267 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf3 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 132 SG ? ? A CYS 284 A CYS 377 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf4 disulf ? ? A CYS 111 SG ? ? ? 1_555 A CYS 124 SG ? ? A CYS 356 A CYS 369 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc1 metalc ? ? A ASP 75 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 320 A CA 501 1_555 ? ? ? ? ? ? ? 2.719 ? ? metalc2 metalc ? ? A GLU 79 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 324 A CA 501 1_555 ? ? ? ? ? ? ? 2.557 ? ? metalc3 metalc ? ? A GLU 102 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 347 A CA 502 1_555 ? ? ? ? ? ? ? 2.581 ? ? metalc4 metalc ? ? A ASN 104 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 349 A CA 502 1_555 ? ? ? ? ? ? ? 2.510 ? ? metalc5 metalc ? ? A ASN 105 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 350 A CA 501 1_555 ? ? ? ? ? ? ? 2.365 ? ? metalc6 metalc ? ? A GLU 109 O ? ? ? 1_555 B CA . CA ? ? A GLU 354 A CA 501 1_555 ? ? ? ? ? ? ? 2.443 ? ? metalc7 metalc ? ? A GLU 109 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 354 A CA 502 1_555 ? ? ? ? ? ? ? 2.502 ? ? metalc8 metalc ? ? A ASN 120 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 365 A CA 502 1_555 ? ? ? ? ? ? ? 2.262 ? ? metalc9 metalc ? ? A ASP 121 O ? ? ? 1_555 C CA . CA ? ? A ASP 366 A CA 502 1_555 ? ? ? ? ? ? ? 2.491 ? ? metalc10 metalc ? ? A ASP 121 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 366 A CA 502 1_555 ? ? ? ? ? ? ? 2.216 ? ? metalc11 metalc ? ? C CA . CA ? ? ? 1_555 D A1H5X . O5 ? ? A CA 502 A A1H5X 503 1_555 ? ? ? ? ? ? ? 2.711 ? ? metalc12 metalc ? ? C CA . CA ? ? ? 1_555 D A1H5X . O7 ? ? A CA 502 A A1H5X 503 1_555 ? ? ? ? ? ? ? 2.308 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 75 ? A ASP 320 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OE2 ? A GLU 79 ? A GLU 324 ? 1_555 72.5 ? 2 OD2 ? A ASP 75 ? A ASP 320 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD1 ? A ASN 105 ? A ASN 350 ? 1_555 141.4 ? 3 OE2 ? A GLU 79 ? A GLU 324 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 OD1 ? A ASN 105 ? A ASN 350 ? 1_555 78.0 ? 4 OD2 ? A ASP 75 ? A ASP 320 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 O ? A GLU 109 ? A GLU 354 ? 1_555 116.2 ? 5 OE2 ? A GLU 79 ? A GLU 324 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 O ? A GLU 109 ? A GLU 354 ? 1_555 157.5 ? 6 OD1 ? A ASN 105 ? A ASN 350 ? 1_555 CA ? B CA . ? A CA 501 ? 1_555 O ? A GLU 109 ? A GLU 354 ? 1_555 84.2 ? 7 OE1 ? A GLU 102 ? A GLU 347 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD1 ? A ASN 104 ? A ASN 349 ? 1_555 81.1 ? 8 OE1 ? A GLU 102 ? A GLU 347 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OE1 ? A GLU 109 ? A GLU 354 ? 1_555 155.3 ? 9 OD1 ? A ASN 104 ? A ASN 349 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OE1 ? A GLU 109 ? A GLU 354 ? 1_555 78.9 ? 10 OE1 ? A GLU 102 ? A GLU 347 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD1 ? A ASN 120 ? A ASN 365 ? 1_555 68.9 ? 11 OD1 ? A ASN 104 ? A ASN 349 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD1 ? A ASN 120 ? A ASN 365 ? 1_555 149.0 ? 12 OE1 ? A GLU 109 ? A GLU 354 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD1 ? A ASN 120 ? A ASN 365 ? 1_555 132.0 ? 13 OE1 ? A GLU 102 ? A GLU 347 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O ? A ASP 121 ? A ASP 366 ? 1_555 126.3 ? 14 OD1 ? A ASN 104 ? A ASN 349 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O ? A ASP 121 ? A ASP 366 ? 1_555 139.2 ? 15 OE1 ? A GLU 109 ? A GLU 354 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O ? A ASP 121 ? A ASP 366 ? 1_555 65.1 ? 16 OD1 ? A ASN 120 ? A ASN 365 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O ? A ASP 121 ? A ASP 366 ? 1_555 69.3 ? 17 OE1 ? A GLU 102 ? A GLU 347 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD1 ? A ASP 121 ? A ASP 366 ? 1_555 75.6 ? 18 OD1 ? A ASN 104 ? A ASN 349 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD1 ? A ASP 121 ? A ASP 366 ? 1_555 92.4 ? 19 OE1 ? A GLU 109 ? A GLU 354 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD1 ? A ASP 121 ? A ASP 366 ? 1_555 90.8 ? 20 OD1 ? A ASN 120 ? A ASN 365 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD1 ? A ASP 121 ? A ASP 366 ? 1_555 87.5 ? 21 O ? A ASP 121 ? A ASP 366 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 OD1 ? A ASP 121 ? A ASP 366 ? 1_555 70.4 ? 22 OE1 ? A GLU 102 ? A GLU 347 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O5 ? D A1H5X . ? A A1H5X 503 ? 1_555 133.7 ? 23 OD1 ? A ASN 104 ? A ASN 349 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O5 ? D A1H5X . ? A A1H5X 503 ? 1_555 114.8 ? 24 OE1 ? A GLU 109 ? A GLU 354 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O5 ? D A1H5X . ? A A1H5X 503 ? 1_555 68.8 ? 25 OD1 ? A ASN 120 ? A ASN 365 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O5 ? D A1H5X . ? A A1H5X 503 ? 1_555 82.8 ? 26 O ? A ASP 121 ? A ASP 366 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O5 ? D A1H5X . ? A A1H5X 503 ? 1_555 70.4 ? 27 OD1 ? A ASP 121 ? A ASP 366 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O5 ? D A1H5X . ? A A1H5X 503 ? 1_555 140.6 ? 28 OE1 ? A GLU 102 ? A GLU 347 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O7 ? D A1H5X . ? A A1H5X 503 ? 1_555 69.0 ? 29 OD1 ? A ASN 104 ? A ASN 349 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O7 ? D A1H5X . ? A A1H5X 503 ? 1_555 84.9 ? 30 OE1 ? A GLU 109 ? A GLU 354 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O7 ? D A1H5X . ? A A1H5X 503 ? 1_555 123.0 ? 31 OD1 ? A ASN 120 ? A ASN 365 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O7 ? D A1H5X . ? A A1H5X 503 ? 1_555 77.6 ? 32 O ? A ASP 121 ? A ASP 366 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O7 ? D A1H5X . ? A A1H5X 503 ? 1_555 130.3 ? 33 OD1 ? A ASP 121 ? A ASP 366 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O7 ? D A1H5X . ? A A1H5X 503 ? 1_555 144.6 ? 34 O5 ? D A1H5X . ? A A1H5X 503 ? 1_555 CA ? C CA . ? A CA 502 ? 1_555 O7 ? D A1H5X . ? A A1H5X 503 ? 1_555 69.6 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 8 ? CYS A 139 ? CYS A 253 ? 1_555 CYS A 384 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 11 ? CYS A 22 ? CYS A 256 ? 1_555 CYS A 267 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 39 ? CYS A 132 ? CYS A 284 ? 1_555 CYS A 377 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 111 ? CYS A 124 ? CYS A 356 ? 1_555 CYS A 369 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 102 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 347 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 103 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 348 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.90 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 16 ? PHE A 18 ? THR A 261 PHE A 263 AA1 2 ASN A 21 ? MET A 25 ? ASN A 266 MET A 270 AA1 3 PHE A 129 ? SER A 135 ? PHE A 374 SER A 380 AA1 4 THR A 69 ? SER A 74 ? THR A 314 SER A 319 AA1 5 GLN A 83 ? TRP A 84 ? GLN A 328 TRP A 329 AA2 1 GLN A 45 ? LEU A 46 ? GLN A 290 LEU A 291 AA2 2 PHE A 129 ? SER A 135 ? PHE A 374 SER A 380 AA2 3 THR A 69 ? SER A 74 ? THR A 314 SER A 319 AA2 4 CYS A 111 ? SER A 115 ? CYS A 356 SER A 360 AA2 5 GLY A 118 ? ASP A 122 ? GLY A 363 ASP A 367 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 16 ? N THR A 261 O TYR A 23 ? O TYR A 268 AA1 2 3 N CYS A 22 ? N CYS A 267 O LYS A 134 ? O LYS A 379 AA1 3 4 O PHE A 129 ? O PHE A 374 N TRP A 70 ? N TRP A 315 AA1 4 5 N SER A 74 ? N SER A 319 O GLN A 83 ? O GLN A 328 AA2 1 2 N GLN A 45 ? N GLN A 290 O LYS A 133 ? O LYS A 378 AA2 2 3 O PHE A 129 ? O PHE A 374 N TRP A 70 ? N TRP A 315 AA2 3 4 N THR A 69 ? N THR A 314 O PHE A 114 ? O PHE A 359 AA2 4 5 N CYS A 111 ? N CYS A 356 O ASP A 122 ? O ASP A 367 # _pdbx_entry_details.entry_id 9EMS _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 323 ? ? -179.69 136.41 2 1 GLU A 353 ? ? 72.36 110.40 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 246 ? A GLY 1 2 1 Y 1 A SER 247 ? A SER 2 3 1 Y 1 A HIS 248 ? A HIS 3 4 1 Y 1 A MET 249 ? A MET 4 5 1 Y 1 A GLU 250 ? A GLU 5 6 1 Y 1 A ARG 251 ? A ARG 6 7 1 Y 1 A LEU 252 ? A LEU 7 8 1 Y 1 A SER 385 ? A SER 140 9 1 Y 1 A ARG 386 ? A ARG 141 10 1 Y 1 A ASP 387 ? A ASP 142 11 1 Y 1 A GLU 388 ? A GLU 143 12 1 Y 1 A GLU 389 ? A GLU 144 13 1 Y 1 A GLN 390 ? A GLN 145 14 1 Y 1 A PHE 391 ? A PHE 146 15 1 Y 1 A LEU 392 ? A LEU 147 16 1 Y 1 A SER 393 ? A SER 148 17 1 Y 1 A PRO 394 ? A PRO 149 18 1 Y 1 A ALA 395 ? A ALA 150 19 1 Y 1 A PRO 396 ? A PRO 151 20 1 Y 1 A ALA 397 ? A ALA 152 21 1 Y 1 A THR 398 ? A THR 153 22 1 Y 1 A PRO 399 ? A PRO 154 23 1 Y 1 A ASN 400 ? A ASN 155 24 1 Y 1 A PRO 401 ? A PRO 156 25 1 Y 1 A PRO 402 ? A PRO 157 26 1 Y 1 A PRO 403 ? A PRO 158 27 1 Y 1 A ALA 404 ? A ALA 159 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1H5X C2 C N N 1 A1H5X C3 C N R 2 A1H5X C4 C N S 3 A1H5X C6 C N R 4 A1H5X C8 C N S 5 A1H5X O1 O N N 6 A1H5X C12 C Y N 7 A1H5X C13 C Y N 8 A1H5X C14 C Y N 9 A1H5X C15 C Y N 10 A1H5X C16 C Y N 11 A1H5X C17 C Y N 12 A1H5X C18 C Y N 13 A1H5X C19 C Y N 14 A1H5X C20 C N S 15 A1H5X C22 C N N 16 A1H5X C23 C N S 17 A1H5X C25 C N N 18 A1H5X N10 N Y N 19 A1H5X N11 N Y N 20 A1H5X N26 N N N 21 A1H5X N9 N Y N 22 A1H5X O21 O N N 23 A1H5X O24 O N N 24 A1H5X O27 O N N 25 A1H5X O5 O N N 26 A1H5X O7 O N N 27 A1H5X H2B H N N 28 A1H5X H2A H N N 29 A1H5X H3 H N N 30 A1H5X H4 H N N 31 A1H5X H6 H N N 32 A1H5X H8 H N N 33 A1H5X H1 H N N 34 A1H5X H14 H N N 35 A1H5X H15 H N N 36 A1H5X H16 H N N 37 A1H5X H17 H N N 38 A1H5X H18 H N N 39 A1H5X H19 H N N 40 A1H5X H20 H N N 41 A1H5X H22B H N N 42 A1H5X H22A H N N 43 A1H5X H23 H N N 44 A1H5X H25A H N N 45 A1H5X H25B H N N 46 A1H5X H26A H N N 47 A1H5X H26B H N N 48 A1H5X H24 H N N 49 A1H5X H5 H N N 50 A1H5X H7 H N N 51 ALA N N N N 52 ALA CA C N S 53 ALA C C N N 54 ALA O O N N 55 ALA CB C N N 56 ALA OXT O N N 57 ALA H H N N 58 ALA H2 H N N 59 ALA HA H N N 60 ALA HB1 H N N 61 ALA HB2 H N N 62 ALA HB3 H N N 63 ALA HXT H N N 64 ARG N N N N 65 ARG CA C N S 66 ARG C C N N 67 ARG O O N N 68 ARG CB C N N 69 ARG CG C N N 70 ARG CD C N N 71 ARG NE N N N 72 ARG CZ C N N 73 ARG NH1 N N N 74 ARG NH2 N N N 75 ARG OXT O N N 76 ARG H H N N 77 ARG H2 H N N 78 ARG HA H N N 79 ARG HB2 H N N 80 ARG HB3 H N N 81 ARG HG2 H N N 82 ARG HG3 H N N 83 ARG HD2 H N N 84 ARG HD3 H N N 85 ARG HE H N N 86 ARG HH11 H N N 87 ARG HH12 H N N 88 ARG HH21 H N N 89 ARG HH22 H N N 90 ARG HXT H N N 91 ASN N N N N 92 ASN CA C N S 93 ASN C C N N 94 ASN O O N N 95 ASN CB C N N 96 ASN CG C N N 97 ASN OD1 O N N 98 ASN ND2 N N N 99 ASN OXT O N N 100 ASN H H N N 101 ASN H2 H N N 102 ASN HA H N N 103 ASN HB2 H N N 104 ASN HB3 H N N 105 ASN HD21 H N N 106 ASN HD22 H N N 107 ASN HXT H N N 108 ASP N N N N 109 ASP CA C N S 110 ASP C C N N 111 ASP O O N N 112 ASP CB C N N 113 ASP CG C N N 114 ASP OD1 O N N 115 ASP OD2 O N N 116 ASP OXT O N N 117 ASP H H N N 118 ASP H2 H N N 119 ASP HA H N N 120 ASP HB2 H N N 121 ASP HB3 H N N 122 ASP HD2 H N N 123 ASP HXT H N N 124 CA CA CA N N 125 CYS N N N N 126 CYS CA C N R 127 CYS C C N N 128 CYS O O N N 129 CYS CB C N N 130 CYS SG S N N 131 CYS OXT O N N 132 CYS H H N N 133 CYS H2 H N N 134 CYS HA H N N 135 CYS HB2 H N N 136 CYS HB3 H N N 137 CYS HG H N N 138 CYS HXT H N N 139 GLN N N N N 140 GLN CA C N S 141 GLN C C N N 142 GLN O O N N 143 GLN CB C N N 144 GLN CG C N N 145 GLN CD C N N 146 GLN OE1 O N N 147 GLN NE2 N N N 148 GLN OXT O N N 149 GLN H H N N 150 GLN H2 H N N 151 GLN HA H N N 152 GLN HB2 H N N 153 GLN HB3 H N N 154 GLN HG2 H N N 155 GLN HG3 H N N 156 GLN HE21 H N N 157 GLN HE22 H N N 158 GLN HXT H N N 159 GLU N N N N 160 GLU CA C N S 161 GLU C C N N 162 GLU O O N N 163 GLU CB C N N 164 GLU CG C N N 165 GLU CD C N N 166 GLU OE1 O N N 167 GLU OE2 O N N 168 GLU OXT O N N 169 GLU H H N N 170 GLU H2 H N N 171 GLU HA H N N 172 GLU HB2 H N N 173 GLU HB3 H N N 174 GLU HG2 H N N 175 GLU HG3 H N N 176 GLU HE2 H N N 177 GLU HXT H N N 178 GLY N N N N 179 GLY CA C N N 180 GLY C C N N 181 GLY O O N N 182 GLY OXT O N N 183 GLY H H N N 184 GLY H2 H N N 185 GLY HA2 H N N 186 GLY HA3 H N N 187 GLY HXT H N N 188 HIS N N N N 189 HIS CA C N S 190 HIS C C N N 191 HIS O O N N 192 HIS CB C N N 193 HIS CG C Y N 194 HIS ND1 N Y N 195 HIS CD2 C Y N 196 HIS CE1 C Y N 197 HIS NE2 N Y N 198 HIS OXT O N N 199 HIS H H N N 200 HIS H2 H N N 201 HIS HA H N N 202 HIS HB2 H N N 203 HIS HB3 H N N 204 HIS HD1 H N N 205 HIS HD2 H N N 206 HIS HE1 H N N 207 HIS HE2 H N N 208 HIS HXT H N N 209 HOH O O N N 210 HOH H1 H N N 211 HOH H2 H N N 212 ILE N N N N 213 ILE CA C N S 214 ILE C C N N 215 ILE O O N N 216 ILE CB C N S 217 ILE CG1 C N N 218 ILE CG2 C N N 219 ILE CD1 C N N 220 ILE OXT O N N 221 ILE H H N N 222 ILE H2 H N N 223 ILE HA H N N 224 ILE HB H N N 225 ILE HG12 H N N 226 ILE HG13 H N N 227 ILE HG21 H N N 228 ILE HG22 H N N 229 ILE HG23 H N N 230 ILE HD11 H N N 231 ILE HD12 H N N 232 ILE HD13 H N N 233 ILE HXT H N N 234 LEU N N N N 235 LEU CA C N S 236 LEU C C N N 237 LEU O O N N 238 LEU CB C N N 239 LEU CG C N N 240 LEU CD1 C N N 241 LEU CD2 C N N 242 LEU OXT O N N 243 LEU H H N N 244 LEU H2 H N N 245 LEU HA H N N 246 LEU HB2 H N N 247 LEU HB3 H N N 248 LEU HG H N N 249 LEU HD11 H N N 250 LEU HD12 H N N 251 LEU HD13 H N N 252 LEU HD21 H N N 253 LEU HD22 H N N 254 LEU HD23 H N N 255 LEU HXT H N N 256 LYS N N N N 257 LYS CA C N S 258 LYS C C N N 259 LYS O O N N 260 LYS CB C N N 261 LYS CG C N N 262 LYS CD C N N 263 LYS CE C N N 264 LYS NZ N N N 265 LYS OXT O N N 266 LYS H H N N 267 LYS H2 H N N 268 LYS HA H N N 269 LYS HB2 H N N 270 LYS HB3 H N N 271 LYS HG2 H N N 272 LYS HG3 H N N 273 LYS HD2 H N N 274 LYS HD3 H N N 275 LYS HE2 H N N 276 LYS HE3 H N N 277 LYS HZ1 H N N 278 LYS HZ2 H N N 279 LYS HZ3 H N N 280 LYS HXT H N N 281 MET N N N N 282 MET CA C N S 283 MET C C N N 284 MET O O N N 285 MET CB C N N 286 MET CG C N N 287 MET SD S N N 288 MET CE C N N 289 MET OXT O N N 290 MET H H N N 291 MET H2 H N N 292 MET HA H N N 293 MET HB2 H N N 294 MET HB3 H N N 295 MET HG2 H N N 296 MET HG3 H N N 297 MET HE1 H N N 298 MET HE2 H N N 299 MET HE3 H N N 300 MET HXT H N N 301 PHE N N N N 302 PHE CA C N S 303 PHE C C N N 304 PHE O O N N 305 PHE CB C N N 306 PHE CG C Y N 307 PHE CD1 C Y N 308 PHE CD2 C Y N 309 PHE CE1 C Y N 310 PHE CE2 C Y N 311 PHE CZ C Y N 312 PHE OXT O N N 313 PHE H H N N 314 PHE H2 H N N 315 PHE HA H N N 316 PHE HB2 H N N 317 PHE HB3 H N N 318 PHE HD1 H N N 319 PHE HD2 H N N 320 PHE HE1 H N N 321 PHE HE2 H N N 322 PHE HZ H N N 323 PHE HXT H N N 324 PRO N N N N 325 PRO CA C N S 326 PRO C C N N 327 PRO O O N N 328 PRO CB C N N 329 PRO CG C N N 330 PRO CD C N N 331 PRO OXT O N N 332 PRO H H N N 333 PRO HA H N N 334 PRO HB2 H N N 335 PRO HB3 H N N 336 PRO HG2 H N N 337 PRO HG3 H N N 338 PRO HD2 H N N 339 PRO HD3 H N N 340 PRO HXT H N N 341 SER N N N N 342 SER CA C N S 343 SER C C N N 344 SER O O N N 345 SER CB C N N 346 SER OG O N N 347 SER OXT O N N 348 SER H H N N 349 SER H2 H N N 350 SER HA H N N 351 SER HB2 H N N 352 SER HB3 H N N 353 SER HG H N N 354 SER HXT H N N 355 THR N N N N 356 THR CA C N S 357 THR C C N N 358 THR O O N N 359 THR CB C N R 360 THR OG1 O N N 361 THR CG2 C N N 362 THR OXT O N N 363 THR H H N N 364 THR H2 H N N 365 THR HA H N N 366 THR HB H N N 367 THR HG1 H N N 368 THR HG21 H N N 369 THR HG22 H N N 370 THR HG23 H N N 371 THR HXT H N N 372 TRP N N N N 373 TRP CA C N S 374 TRP C C N N 375 TRP O O N N 376 TRP CB C N N 377 TRP CG C Y N 378 TRP CD1 C Y N 379 TRP CD2 C Y N 380 TRP NE1 N Y N 381 TRP CE2 C Y N 382 TRP CE3 C Y N 383 TRP CZ2 C Y N 384 TRP CZ3 C Y N 385 TRP CH2 C Y N 386 TRP OXT O N N 387 TRP H H N N 388 TRP H2 H N N 389 TRP HA H N N 390 TRP HB2 H N N 391 TRP HB3 H N N 392 TRP HD1 H N N 393 TRP HE1 H N N 394 TRP HE3 H N N 395 TRP HZ2 H N N 396 TRP HZ3 H N N 397 TRP HH2 H N N 398 TRP HXT H N N 399 TYR N N N N 400 TYR CA C N S 401 TYR C C N N 402 TYR O O N N 403 TYR CB C N N 404 TYR CG C Y N 405 TYR CD1 C Y N 406 TYR CD2 C Y N 407 TYR CE1 C Y N 408 TYR CE2 C Y N 409 TYR CZ C Y N 410 TYR OH O N N 411 TYR OXT O N N 412 TYR H H N N 413 TYR H2 H N N 414 TYR HA H N N 415 TYR HB2 H N N 416 TYR HB3 H N N 417 TYR HD1 H N N 418 TYR HD2 H N N 419 TYR HE1 H N N 420 TYR HE2 H N N 421 TYR HH H N N 422 TYR HXT H N N 423 VAL N N N N 424 VAL CA C N S 425 VAL C C N N 426 VAL O O N N 427 VAL CB C N N 428 VAL CG1 C N N 429 VAL CG2 C N N 430 VAL OXT O N N 431 VAL H H N N 432 VAL H2 H N N 433 VAL HA H N N 434 VAL HB H N N 435 VAL HG11 H N N 436 VAL HG12 H N N 437 VAL HG13 H N N 438 VAL HG21 H N N 439 VAL HG22 H N N 440 VAL HG23 H N N 441 VAL HXT H N N 442 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1H5X N26 C25 sing N N 1 A1H5X C25 C23 sing N N 2 A1H5X O24 C23 sing N N 3 A1H5X C23 C22 sing N N 4 A1H5X C22 O21 sing N N 5 A1H5X O5 C4 sing N N 6 A1H5X O21 C20 sing N N 7 A1H5X O1 C2 sing N N 8 A1H5X C6 O7 sing N N 9 A1H5X C6 C4 sing N N 10 A1H5X C6 C8 sing N N 11 A1H5X C3 C4 sing N N 12 A1H5X C3 C2 sing N N 13 A1H5X C3 O27 sing N N 14 A1H5X C20 C8 sing N N 15 A1H5X C20 O27 sing N N 16 A1H5X C8 N9 sing N N 17 A1H5X N9 N10 sing Y N 18 A1H5X N9 C19 sing Y N 19 A1H5X N10 N11 doub Y N 20 A1H5X C19 C12 doub Y N 21 A1H5X N11 C12 sing Y N 22 A1H5X C12 C13 sing N N 23 A1H5X C13 C14 doub Y N 24 A1H5X C13 C18 sing Y N 25 A1H5X C14 C15 sing Y N 26 A1H5X C18 C17 doub Y N 27 A1H5X C15 C16 doub Y N 28 A1H5X C17 C16 sing Y N 29 A1H5X C2 H2B sing N N 30 A1H5X C2 H2A sing N N 31 A1H5X C3 H3 sing N N 32 A1H5X C4 H4 sing N N 33 A1H5X C6 H6 sing N N 34 A1H5X C8 H8 sing N N 35 A1H5X O1 H1 sing N N 36 A1H5X C14 H14 sing N N 37 A1H5X C15 H15 sing N N 38 A1H5X C16 H16 sing N N 39 A1H5X C17 H17 sing N N 40 A1H5X C18 H18 sing N N 41 A1H5X C19 H19 sing N N 42 A1H5X C20 H20 sing N N 43 A1H5X C22 H22B sing N N 44 A1H5X C22 H22A sing N N 45 A1H5X C23 H23 sing N N 46 A1H5X C25 H25A sing N N 47 A1H5X C25 H25B sing N N 48 A1H5X N26 H26A sing N N 49 A1H5X N26 H26B sing N N 50 A1H5X O24 H24 sing N N 51 A1H5X O5 H5 sing N N 52 A1H5X O7 H7 sing N N 53 ALA N CA sing N N 54 ALA N H sing N N 55 ALA N H2 sing N N 56 ALA CA C sing N N 57 ALA CA CB sing N N 58 ALA CA HA sing N N 59 ALA C O doub N N 60 ALA C OXT sing N N 61 ALA CB HB1 sing N N 62 ALA CB HB2 sing N N 63 ALA CB HB3 sing N N 64 ALA OXT HXT sing N N 65 ARG N CA sing N N 66 ARG N H sing N N 67 ARG N H2 sing N N 68 ARG CA C sing N N 69 ARG CA CB sing N N 70 ARG CA HA sing N N 71 ARG C O doub N N 72 ARG C OXT sing N N 73 ARG CB CG sing N N 74 ARG CB HB2 sing N N 75 ARG CB HB3 sing N N 76 ARG CG CD sing N N 77 ARG CG HG2 sing N N 78 ARG CG HG3 sing N N 79 ARG CD NE sing N N 80 ARG CD HD2 sing N N 81 ARG CD HD3 sing N N 82 ARG NE CZ sing N N 83 ARG NE HE sing N N 84 ARG CZ NH1 sing N N 85 ARG CZ NH2 doub N N 86 ARG NH1 HH11 sing N N 87 ARG NH1 HH12 sing N N 88 ARG NH2 HH21 sing N N 89 ARG NH2 HH22 sing N N 90 ARG OXT HXT sing N N 91 ASN N CA sing N N 92 ASN N H sing N N 93 ASN N H2 sing N N 94 ASN CA C sing N N 95 ASN CA CB sing N N 96 ASN CA HA sing N N 97 ASN C O doub N N 98 ASN C OXT sing N N 99 ASN CB CG sing N N 100 ASN CB HB2 sing N N 101 ASN CB HB3 sing N N 102 ASN CG OD1 doub N N 103 ASN CG ND2 sing N N 104 ASN ND2 HD21 sing N N 105 ASN ND2 HD22 sing N N 106 ASN OXT HXT sing N N 107 ASP N CA sing N N 108 ASP N H sing N N 109 ASP N H2 sing N N 110 ASP CA C sing N N 111 ASP CA CB sing N N 112 ASP CA HA sing N N 113 ASP C O doub N N 114 ASP C OXT sing N N 115 ASP CB CG sing N N 116 ASP CB HB2 sing N N 117 ASP CB HB3 sing N N 118 ASP CG OD1 doub N N 119 ASP CG OD2 sing N N 120 ASP OD2 HD2 sing N N 121 ASP OXT HXT sing N N 122 CYS N CA sing N N 123 CYS N H sing N N 124 CYS N H2 sing N N 125 CYS CA C sing N N 126 CYS CA CB sing N N 127 CYS CA HA sing N N 128 CYS C O doub N N 129 CYS C OXT sing N N 130 CYS CB SG sing N N 131 CYS CB HB2 sing N N 132 CYS CB HB3 sing N N 133 CYS SG HG sing N N 134 CYS OXT HXT sing N N 135 GLN N CA sing N N 136 GLN N H sing N N 137 GLN N H2 sing N N 138 GLN CA C sing N N 139 GLN CA CB sing N N 140 GLN CA HA sing N N 141 GLN C O doub N N 142 GLN C OXT sing N N 143 GLN CB CG sing N N 144 GLN CB HB2 sing N N 145 GLN CB HB3 sing N N 146 GLN CG CD sing N N 147 GLN CG HG2 sing N N 148 GLN CG HG3 sing N N 149 GLN CD OE1 doub N N 150 GLN CD NE2 sing N N 151 GLN NE2 HE21 sing N N 152 GLN NE2 HE22 sing N N 153 GLN OXT HXT sing N N 154 GLU N CA sing N N 155 GLU N H sing N N 156 GLU N H2 sing N N 157 GLU CA C sing N N 158 GLU CA CB sing N N 159 GLU CA HA sing N N 160 GLU C O doub N N 161 GLU C OXT sing N N 162 GLU CB CG sing N N 163 GLU CB HB2 sing N N 164 GLU CB HB3 sing N N 165 GLU CG CD sing N N 166 GLU CG HG2 sing N N 167 GLU CG HG3 sing N N 168 GLU CD OE1 doub N N 169 GLU CD OE2 sing N N 170 GLU OE2 HE2 sing N N 171 GLU OXT HXT sing N N 172 GLY N CA sing N N 173 GLY N H sing N N 174 GLY N H2 sing N N 175 GLY CA C sing N N 176 GLY CA HA2 sing N N 177 GLY CA HA3 sing N N 178 GLY C O doub N N 179 GLY C OXT sing N N 180 GLY OXT HXT sing N N 181 HIS N CA sing N N 182 HIS N H sing N N 183 HIS N H2 sing N N 184 HIS CA C sing N N 185 HIS CA CB sing N N 186 HIS CA HA sing N N 187 HIS C O doub N N 188 HIS C OXT sing N N 189 HIS CB CG sing N N 190 HIS CB HB2 sing N N 191 HIS CB HB3 sing N N 192 HIS CG ND1 sing Y N 193 HIS CG CD2 doub Y N 194 HIS ND1 CE1 doub Y N 195 HIS ND1 HD1 sing N N 196 HIS CD2 NE2 sing Y N 197 HIS CD2 HD2 sing N N 198 HIS CE1 NE2 sing Y N 199 HIS CE1 HE1 sing N N 200 HIS NE2 HE2 sing N N 201 HIS OXT HXT sing N N 202 HOH O H1 sing N N 203 HOH O H2 sing N N 204 ILE N CA sing N N 205 ILE N H sing N N 206 ILE N H2 sing N N 207 ILE CA C sing N N 208 ILE CA CB sing N N 209 ILE CA HA sing N N 210 ILE C O doub N N 211 ILE C OXT sing N N 212 ILE CB CG1 sing N N 213 ILE CB CG2 sing N N 214 ILE CB HB sing N N 215 ILE CG1 CD1 sing N N 216 ILE CG1 HG12 sing N N 217 ILE CG1 HG13 sing N N 218 ILE CG2 HG21 sing N N 219 ILE CG2 HG22 sing N N 220 ILE CG2 HG23 sing N N 221 ILE CD1 HD11 sing N N 222 ILE CD1 HD12 sing N N 223 ILE CD1 HD13 sing N N 224 ILE OXT HXT sing N N 225 LEU N CA sing N N 226 LEU N H sing N N 227 LEU N H2 sing N N 228 LEU CA C sing N N 229 LEU CA CB sing N N 230 LEU CA HA sing N N 231 LEU C O doub N N 232 LEU C OXT sing N N 233 LEU CB CG sing N N 234 LEU CB HB2 sing N N 235 LEU CB HB3 sing N N 236 LEU CG CD1 sing N N 237 LEU CG CD2 sing N N 238 LEU CG HG sing N N 239 LEU CD1 HD11 sing N N 240 LEU CD1 HD12 sing N N 241 LEU CD1 HD13 sing N N 242 LEU CD2 HD21 sing N N 243 LEU CD2 HD22 sing N N 244 LEU CD2 HD23 sing N N 245 LEU OXT HXT sing N N 246 LYS N CA sing N N 247 LYS N H sing N N 248 LYS N H2 sing N N 249 LYS CA C sing N N 250 LYS CA CB sing N N 251 LYS CA HA sing N N 252 LYS C O doub N N 253 LYS C OXT sing N N 254 LYS CB CG sing N N 255 LYS CB HB2 sing N N 256 LYS CB HB3 sing N N 257 LYS CG CD sing N N 258 LYS CG HG2 sing N N 259 LYS CG HG3 sing N N 260 LYS CD CE sing N N 261 LYS CD HD2 sing N N 262 LYS CD HD3 sing N N 263 LYS CE NZ sing N N 264 LYS CE HE2 sing N N 265 LYS CE HE3 sing N N 266 LYS NZ HZ1 sing N N 267 LYS NZ HZ2 sing N N 268 LYS NZ HZ3 sing N N 269 LYS OXT HXT sing N N 270 MET N CA sing N N 271 MET N H sing N N 272 MET N H2 sing N N 273 MET CA C sing N N 274 MET CA CB sing N N 275 MET CA HA sing N N 276 MET C O doub N N 277 MET C OXT sing N N 278 MET CB CG sing N N 279 MET CB HB2 sing N N 280 MET CB HB3 sing N N 281 MET CG SD sing N N 282 MET CG HG2 sing N N 283 MET CG HG3 sing N N 284 MET SD CE sing N N 285 MET CE HE1 sing N N 286 MET CE HE2 sing N N 287 MET CE HE3 sing N N 288 MET OXT HXT sing N N 289 PHE N CA sing N N 290 PHE N H sing N N 291 PHE N H2 sing N N 292 PHE CA C sing N N 293 PHE CA CB sing N N 294 PHE CA HA sing N N 295 PHE C O doub N N 296 PHE C OXT sing N N 297 PHE CB CG sing N N 298 PHE CB HB2 sing N N 299 PHE CB HB3 sing N N 300 PHE CG CD1 doub Y N 301 PHE CG CD2 sing Y N 302 PHE CD1 CE1 sing Y N 303 PHE CD1 HD1 sing N N 304 PHE CD2 CE2 doub Y N 305 PHE CD2 HD2 sing N N 306 PHE CE1 CZ doub Y N 307 PHE CE1 HE1 sing N N 308 PHE CE2 CZ sing Y N 309 PHE CE2 HE2 sing N N 310 PHE CZ HZ sing N N 311 PHE OXT HXT sing N N 312 PRO N CA sing N N 313 PRO N CD sing N N 314 PRO N H sing N N 315 PRO CA C sing N N 316 PRO CA CB sing N N 317 PRO CA HA sing N N 318 PRO C O doub N N 319 PRO C OXT sing N N 320 PRO CB CG sing N N 321 PRO CB HB2 sing N N 322 PRO CB HB3 sing N N 323 PRO CG CD sing N N 324 PRO CG HG2 sing N N 325 PRO CG HG3 sing N N 326 PRO CD HD2 sing N N 327 PRO CD HD3 sing N N 328 PRO OXT HXT sing N N 329 SER N CA sing N N 330 SER N H sing N N 331 SER N H2 sing N N 332 SER CA C sing N N 333 SER CA CB sing N N 334 SER CA HA sing N N 335 SER C O doub N N 336 SER C OXT sing N N 337 SER CB OG sing N N 338 SER CB HB2 sing N N 339 SER CB HB3 sing N N 340 SER OG HG sing N N 341 SER OXT HXT sing N N 342 THR N CA sing N N 343 THR N H sing N N 344 THR N H2 sing N N 345 THR CA C sing N N 346 THR CA CB sing N N 347 THR CA HA sing N N 348 THR C O doub N N 349 THR C OXT sing N N 350 THR CB OG1 sing N N 351 THR CB CG2 sing N N 352 THR CB HB sing N N 353 THR OG1 HG1 sing N N 354 THR CG2 HG21 sing N N 355 THR CG2 HG22 sing N N 356 THR CG2 HG23 sing N N 357 THR OXT HXT sing N N 358 TRP N CA sing N N 359 TRP N H sing N N 360 TRP N H2 sing N N 361 TRP CA C sing N N 362 TRP CA CB sing N N 363 TRP CA HA sing N N 364 TRP C O doub N N 365 TRP C OXT sing N N 366 TRP CB CG sing N N 367 TRP CB HB2 sing N N 368 TRP CB HB3 sing N N 369 TRP CG CD1 doub Y N 370 TRP CG CD2 sing Y N 371 TRP CD1 NE1 sing Y N 372 TRP CD1 HD1 sing N N 373 TRP CD2 CE2 doub Y N 374 TRP CD2 CE3 sing Y N 375 TRP NE1 CE2 sing Y N 376 TRP NE1 HE1 sing N N 377 TRP CE2 CZ2 sing Y N 378 TRP CE3 CZ3 doub Y N 379 TRP CE3 HE3 sing N N 380 TRP CZ2 CH2 doub Y N 381 TRP CZ2 HZ2 sing N N 382 TRP CZ3 CH2 sing Y N 383 TRP CZ3 HZ3 sing N N 384 TRP CH2 HH2 sing N N 385 TRP OXT HXT sing N N 386 TYR N CA sing N N 387 TYR N H sing N N 388 TYR N H2 sing N N 389 TYR CA C sing N N 390 TYR CA CB sing N N 391 TYR CA HA sing N N 392 TYR C O doub N N 393 TYR C OXT sing N N 394 TYR CB CG sing N N 395 TYR CB HB2 sing N N 396 TYR CB HB3 sing N N 397 TYR CG CD1 doub Y N 398 TYR CG CD2 sing Y N 399 TYR CD1 CE1 sing Y N 400 TYR CD1 HD1 sing N N 401 TYR CD2 CE2 doub Y N 402 TYR CD2 HD2 sing N N 403 TYR CE1 CZ doub Y N 404 TYR CE1 HE1 sing N N 405 TYR CE2 CZ sing Y N 406 TYR CE2 HE2 sing N N 407 TYR CZ OH sing N N 408 TYR OH HH sing N N 409 TYR OXT HXT sing N N 410 VAL N CA sing N N 411 VAL N H sing N N 412 VAL N H2 sing N N 413 VAL CA C sing N N 414 VAL CA CB sing N N 415 VAL CA HA sing N N 416 VAL C O doub N N 417 VAL C OXT sing N N 418 VAL CB CG1 sing N N 419 VAL CB CG2 sing N N 420 VAL CB HB sing N N 421 VAL CG1 HG11 sing N N 422 VAL CG1 HG12 sing N N 423 VAL CG1 HG13 sing N N 424 VAL CG2 HG21 sing N N 425 VAL CG2 HG22 sing N N 426 VAL CG2 HG23 sing N N 427 VAL OXT HXT sing N N 428 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 532758733 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7NL7 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9EMS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.013351 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013351 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016354 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA H N O S # loop_ #