data_9EW8 # _entry.id 9EW8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9EW8 pdb_00009ew8 10.2210/pdb9ew8/pdb WWPDB D_1292137679 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-04-16 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9EW8 _pdbx_database_status.recvd_initial_deposition_date 2024-04-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email david.hargreaves@astrazeneca.com _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Hargreaves _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4441-0039 # _audit_author.name 'Hargreaves, D.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Discovery of a Series of Covalent, Cell Active Bfl-1 Inhibitors' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Hargreaves, D.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bcl-2-related protein A1' 17442.889 1 ? ? ? ? 2 non-polymer syn '1-[(2R)-2-phenylpyrrolidin-1-yl]propan-1-one' 203.280 1 ? ? ? ? 3 water nat water 18.015 75 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bcl-2-like protein 5,Bcl2-L-5,Hemopoietic-specific early response protein,Protein BFL-1,Protein GRS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEF EDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK ; _entity_poly.pdbx_seq_one_letter_code_can ;GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEF EDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-[(2R)-2-phenylpyrrolidin-1-yl]propan-1-one' A1H7Q 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 THR n 1 4 ASP n 1 5 CYS n 1 6 GLU n 1 7 PHE n 1 8 GLY n 1 9 TYR n 1 10 ILE n 1 11 TYR n 1 12 ARG n 1 13 LEU n 1 14 ALA n 1 15 GLN n 1 16 ASP n 1 17 TYR n 1 18 LEU n 1 19 GLN n 1 20 CYS n 1 21 VAL n 1 22 LEU n 1 23 GLN n 1 24 ILE n 1 25 PRO n 1 26 GLN n 1 27 PRO n 1 28 GLY n 1 29 SER n 1 30 GLY n 1 31 PRO n 1 32 SER n 1 33 LYS n 1 34 THR n 1 35 SER n 1 36 ARG n 1 37 VAL n 1 38 LEU n 1 39 GLN n 1 40 ASN n 1 41 VAL n 1 42 ALA n 1 43 PHE n 1 44 SER n 1 45 VAL n 1 46 GLN n 1 47 LYS n 1 48 GLU n 1 49 VAL n 1 50 GLU n 1 51 LYS n 1 52 ASN n 1 53 LEU n 1 54 LYS n 1 55 SER n 1 56 CYS n 1 57 LEU n 1 58 ASP n 1 59 ASN n 1 60 VAL n 1 61 ASN n 1 62 VAL n 1 63 VAL n 1 64 SER n 1 65 VAL n 1 66 ASP n 1 67 THR n 1 68 ALA n 1 69 ARG n 1 70 THR n 1 71 LEU n 1 72 PHE n 1 73 ASN n 1 74 GLN n 1 75 VAL n 1 76 MET n 1 77 GLU n 1 78 LYS n 1 79 GLU n 1 80 PHE n 1 81 GLU n 1 82 ASP n 1 83 GLY n 1 84 ILE n 1 85 ILE n 1 86 ASN n 1 87 TRP n 1 88 GLY n 1 89 ARG n 1 90 ILE n 1 91 VAL n 1 92 THR n 1 93 ILE n 1 94 PHE n 1 95 ALA n 1 96 PHE n 1 97 GLU n 1 98 GLY n 1 99 ILE n 1 100 LEU n 1 101 ILE n 1 102 LYS n 1 103 LYS n 1 104 LEU n 1 105 LEU n 1 106 ARG n 1 107 GLN n 1 108 GLN n 1 109 ILE n 1 110 ALA n 1 111 PRO n 1 112 ASP n 1 113 VAL n 1 114 ASP n 1 115 THR n 1 116 TYR n 1 117 LYS n 1 118 GLU n 1 119 ILE n 1 120 SER n 1 121 TYR n 1 122 PHE n 1 123 VAL n 1 124 ALA n 1 125 GLU n 1 126 PHE n 1 127 ILE n 1 128 MET n 1 129 ASN n 1 130 ASN n 1 131 THR n 1 132 GLY n 1 133 GLU n 1 134 TRP n 1 135 ILE n 1 136 ARG n 1 137 GLN n 1 138 ASN n 1 139 GLY n 1 140 GLY n 1 141 TRP n 1 142 GLU n 1 143 ASN n 1 144 GLY n 1 145 PHE n 1 146 VAL n 1 147 LYS n 1 148 LYS n 1 149 PHE n 1 150 GLU n 1 151 PRO n 1 152 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 152 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BCL2A1, BCL2L5, BFL1, GRS, HBPA1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1H7Q non-polymer . '1-[(2R)-2-phenylpyrrolidin-1-yl]propan-1-one' ? 'C13 H17 N O' 203.280 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MET 2 1 ? ? ? A . n A 1 3 THR 3 2 ? ? ? A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 CYS 5 4 4 CYS CYS A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 PHE 7 6 6 PHE PHE A . n A 1 8 GLY 8 7 7 GLY GLY A . n A 1 9 TYR 9 8 8 TYR TYR A . n A 1 10 ILE 10 9 9 ILE ILE A . n A 1 11 TYR 11 10 10 TYR TYR A . n A 1 12 ARG 12 11 11 ARG ARG A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 ALA 14 13 13 ALA ALA A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 ASP 16 15 15 ASP ASP A . n A 1 17 TYR 17 16 16 TYR TYR A . n A 1 18 LEU 18 17 17 LEU LEU A . n A 1 19 GLN 19 18 18 GLN GLN A . n A 1 20 CYS 20 19 19 CYS CYS A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 GLN 23 22 22 GLN GLN A . n A 1 24 ILE 24 23 23 ILE ILE A . n A 1 25 PRO 25 24 24 PRO PRO A . n A 1 26 GLN 26 25 25 GLN GLN A . n A 1 27 PRO 27 26 26 PRO PRO A . n A 1 28 GLY 28 27 27 GLY GLY A . n A 1 29 SER 29 28 28 SER SER A . n A 1 30 GLY 30 29 29 GLY GLY A . n A 1 31 PRO 31 30 30 PRO PRO A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 LYS 33 32 32 LYS LYS A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 SER 35 34 34 SER SER A . n A 1 36 ARG 36 35 35 ARG ARG A . n A 1 37 VAL 37 36 36 VAL VAL A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 GLN 39 38 38 GLN GLN A . n A 1 40 ASN 40 39 39 ASN ASN A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 ALA 42 41 41 ALA ALA A . n A 1 43 PHE 43 42 42 PHE PHE A . n A 1 44 SER 44 43 43 SER SER A . n A 1 45 VAL 45 44 44 VAL VAL A . n A 1 46 GLN 46 45 45 GLN GLN A . n A 1 47 LYS 47 46 46 LYS LYS A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 ASN 52 51 51 ASN ASN A . n A 1 53 LEU 53 52 52 LEU LEU A . n A 1 54 LYS 54 53 53 LYS LYS A . n A 1 55 SER 55 54 54 SER SER A . n A 1 56 CYS 56 55 55 CYS CYS A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 ASN 59 58 58 ASN ASN A . n A 1 60 VAL 60 59 59 VAL VAL A . n A 1 61 ASN 61 60 60 ASN ASN A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 VAL 63 62 62 VAL VAL A . n A 1 64 SER 64 63 63 SER SER A . n A 1 65 VAL 65 64 64 VAL VAL A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 THR 67 66 66 THR THR A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 ARG 69 68 68 ARG ARG A . n A 1 70 THR 70 69 69 THR THR A . n A 1 71 LEU 71 70 70 LEU LEU A . n A 1 72 PHE 72 71 71 PHE PHE A . n A 1 73 ASN 73 72 72 ASN ASN A . n A 1 74 GLN 74 73 73 GLN GLN A . n A 1 75 VAL 75 74 74 VAL VAL A . n A 1 76 MET 76 75 75 MET MET A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 GLU 79 78 78 GLU GLU A . n A 1 80 PHE 80 79 79 PHE PHE A . n A 1 81 GLU 81 80 80 GLU GLU A . n A 1 82 ASP 82 81 81 ASP ASP A . n A 1 83 GLY 83 82 82 GLY GLY A . n A 1 84 ILE 84 83 83 ILE ILE A . n A 1 85 ILE 85 84 84 ILE ILE A . n A 1 86 ASN 86 85 85 ASN ASN A . n A 1 87 TRP 87 86 86 TRP TRP A . n A 1 88 GLY 88 87 87 GLY GLY A . n A 1 89 ARG 89 88 88 ARG ARG A . n A 1 90 ILE 90 89 89 ILE ILE A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 THR 92 91 91 THR THR A . n A 1 93 ILE 93 92 92 ILE ILE A . n A 1 94 PHE 94 93 93 PHE PHE A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 PHE 96 95 95 PHE PHE A . n A 1 97 GLU 97 96 96 GLU GLU A . n A 1 98 GLY 98 97 97 GLY GLY A . n A 1 99 ILE 99 98 98 ILE ILE A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 ILE 101 100 100 ILE ILE A . n A 1 102 LYS 102 101 101 LYS LYS A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 LEU 104 103 103 LEU LEU A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 GLN 107 106 106 GLN GLN A . n A 1 108 GLN 108 107 107 GLN GLN A . n A 1 109 ILE 109 108 108 ILE ILE A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 PRO 111 110 110 PRO PRO A . n A 1 112 ASP 112 111 111 ASP ASP A . n A 1 113 VAL 113 112 112 VAL VAL A . n A 1 114 ASP 114 113 113 ASP ASP A . n A 1 115 THR 115 114 114 THR THR A . n A 1 116 TYR 116 115 115 TYR TYR A . n A 1 117 LYS 117 116 116 LYS LYS A . n A 1 118 GLU 118 117 117 GLU GLU A . n A 1 119 ILE 119 118 118 ILE ILE A . n A 1 120 SER 120 119 119 SER SER A . n A 1 121 TYR 121 120 120 TYR TYR A . n A 1 122 PHE 122 121 121 PHE PHE A . n A 1 123 VAL 123 122 122 VAL VAL A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 PHE 126 125 125 PHE PHE A . n A 1 127 ILE 127 126 126 ILE ILE A . n A 1 128 MET 128 127 127 MET MET A . n A 1 129 ASN 129 128 128 ASN ASN A . n A 1 130 ASN 130 129 129 ASN ASN A . n A 1 131 THR 131 130 130 THR THR A . n A 1 132 GLY 132 131 131 GLY GLY A . n A 1 133 GLU 133 132 132 GLU GLU A . n A 1 134 TRP 134 133 133 TRP TRP A . n A 1 135 ILE 135 134 134 ILE ILE A . n A 1 136 ARG 136 135 135 ARG ARG A . n A 1 137 GLN 137 136 136 GLN GLN A . n A 1 138 ASN 138 137 137 ASN ASN A . n A 1 139 GLY 139 138 138 GLY GLY A . n A 1 140 GLY 140 139 139 GLY GLY A . n A 1 141 TRP 141 140 140 TRP TRP A . n A 1 142 GLU 142 141 141 GLU GLU A . n A 1 143 ASN 143 142 142 ASN ASN A . n A 1 144 GLY 144 143 143 GLY GLY A . n A 1 145 PHE 145 144 144 PHE PHE A . n A 1 146 VAL 146 145 145 VAL VAL A . n A 1 147 LYS 147 146 146 LYS LYS A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 GLU 150 149 149 GLU GLU A . n A 1 151 PRO 151 150 150 PRO PRO A . n A 1 152 LYS 152 151 151 LYS LYS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1H7Q _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1H7Q _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1H7Q 1 201 201 A1H7Q INH A . C 3 HOH 1 301 31 HOH HOH A . C 3 HOH 2 302 22 HOH HOH A . C 3 HOH 3 303 74 HOH HOH A . C 3 HOH 4 304 2 HOH HOH A . C 3 HOH 5 305 12 HOH HOH A . C 3 HOH 6 306 49 HOH HOH A . C 3 HOH 7 307 47 HOH HOH A . C 3 HOH 8 308 3 HOH HOH A . C 3 HOH 9 309 29 HOH HOH A . C 3 HOH 10 310 15 HOH HOH A . C 3 HOH 11 311 39 HOH HOH A . C 3 HOH 12 312 53 HOH HOH A . C 3 HOH 13 313 40 HOH HOH A . C 3 HOH 14 314 36 HOH HOH A . C 3 HOH 15 315 55 HOH HOH A . C 3 HOH 16 316 19 HOH HOH A . C 3 HOH 17 317 33 HOH HOH A . C 3 HOH 18 318 41 HOH HOH A . C 3 HOH 19 319 9 HOH HOH A . C 3 HOH 20 320 42 HOH HOH A . C 3 HOH 21 321 37 HOH HOH A . C 3 HOH 22 322 4 HOH HOH A . C 3 HOH 23 323 58 HOH HOH A . C 3 HOH 24 324 63 HOH HOH A . C 3 HOH 25 325 21 HOH HOH A . C 3 HOH 26 326 64 HOH HOH A . C 3 HOH 27 327 16 HOH HOH A . C 3 HOH 28 328 8 HOH HOH A . C 3 HOH 29 329 27 HOH HOH A . C 3 HOH 30 330 45 HOH HOH A . C 3 HOH 31 331 25 HOH HOH A . C 3 HOH 32 332 10 HOH HOH A . C 3 HOH 33 333 54 HOH HOH A . C 3 HOH 34 334 26 HOH HOH A . C 3 HOH 35 335 11 HOH HOH A . C 3 HOH 36 336 34 HOH HOH A . C 3 HOH 37 337 18 HOH HOH A . C 3 HOH 38 338 68 HOH HOH A . C 3 HOH 39 339 17 HOH HOH A . C 3 HOH 40 340 56 HOH HOH A . C 3 HOH 41 341 14 HOH HOH A . C 3 HOH 42 342 30 HOH HOH A . C 3 HOH 43 343 1 HOH HOH A . C 3 HOH 44 344 66 HOH HOH A . C 3 HOH 45 345 20 HOH HOH A . C 3 HOH 46 346 23 HOH HOH A . C 3 HOH 47 347 65 HOH HOH A . C 3 HOH 48 348 44 HOH HOH A . C 3 HOH 49 349 70 HOH HOH A . C 3 HOH 50 350 73 HOH HOH A . C 3 HOH 51 351 43 HOH HOH A . C 3 HOH 52 352 28 HOH HOH A . C 3 HOH 53 353 61 HOH HOH A . C 3 HOH 54 354 7 HOH HOH A . C 3 HOH 55 355 46 HOH HOH A . C 3 HOH 56 356 60 HOH HOH A . C 3 HOH 57 357 24 HOH HOH A . C 3 HOH 58 358 59 HOH HOH A . C 3 HOH 59 359 72 HOH HOH A . C 3 HOH 60 360 62 HOH HOH A . C 3 HOH 61 361 38 HOH HOH A . C 3 HOH 62 362 32 HOH HOH A . C 3 HOH 63 363 57 HOH HOH A . C 3 HOH 64 364 69 HOH HOH A . C 3 HOH 65 365 5 HOH HOH A . C 3 HOH 66 366 75 HOH HOH A . C 3 HOH 67 367 71 HOH HOH A . C 3 HOH 68 368 48 HOH HOH A . C 3 HOH 69 369 51 HOH HOH A . C 3 HOH 70 370 67 HOH HOH A . C 3 HOH 71 371 52 HOH HOH A . C 3 HOH 72 372 50 HOH HOH A . C 3 HOH 73 373 35 HOH HOH A . C 3 HOH 74 374 13 HOH HOH A . C 3 HOH 75 375 6 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 47 ? CG ? A GLU 48 CG 2 1 Y 1 A GLU 47 ? CD ? A GLU 48 CD 3 1 Y 1 A GLU 47 ? OE1 ? A GLU 48 OE1 4 1 Y 1 A GLU 47 ? OE2 ? A GLU 48 OE2 5 1 Y 1 A LYS 116 ? CE ? A LYS 117 CE 6 1 Y 1 A LYS 116 ? NZ ? A LYS 117 NZ 7 1 Y 1 A ARG 135 ? NE ? A ARG 136 NE 8 1 Y 1 A ARG 135 ? CZ ? A ARG 136 CZ 9 1 Y 1 A ARG 135 ? NH1 ? A ARG 136 NH1 10 1 Y 1 A ARG 135 ? NH2 ? A ARG 136 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.11.8 (26-JUL-2023)' 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 101.86 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9EW8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.910 _cell.length_a_esd ? _cell.length_b 42.960 _cell.length_b_esd ? _cell.length_c 42.980 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9EW8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9EW8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.07 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.50 _exptl_crystal.description 'bundles of plates' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.85M sodium citrate, 0.1M PCTP pH 6' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-01-20 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97950 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97950 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9EW8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.488 _reflns.d_resolution_low 42.062 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15969 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 88.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.488 _reflns_shell.d_res_low 1.618 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 798 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.534 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -1.11140 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] -0.08010 _refine.aniso_B[2][2] 0.39250 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 0.71890 _refine.B_iso_max ? _refine.B_iso_mean 31.54 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.946 _refine.correlation_coeff_Fo_to_Fc_free 0.914 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9EW8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.488 _refine.ls_d_res_low 39.06 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15899 _refine.ls_number_reflns_R_free 800 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 67.6 _refine.ls_percent_reflns_R_free 5.030 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2245 _refine.ls_R_factor_R_free 0.2710 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2221 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.131 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.131 _refine.pdbx_overall_SU_R_Blow_DPI 0.132 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.131 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9EW8 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.25 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.488 _refine_hist.d_res_low 39.06 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 1288 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1198 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 1261 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.04 ? 1709 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 454 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 227 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1261 ? t_it 10.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.75 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 18.05 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 161 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1230 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.49 _refine_ls_shell.d_res_low 1.57 _refine_ls_shell.number_reflns_all 398 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work 378 _refine_ls_shell.percent_reflns_obs 11.28 _refine_ls_shell.percent_reflns_R_free 5.03 _refine_ls_shell.R_factor_all 0.2930 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2934 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 41 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.2833 # _struct.entry_id 9EW8 _struct.title 'Discovery of a Series of Covalent, Cell Active Bfl-1 Inhibitors' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9EW8 _struct_keywords.text 'Bfl-1, Bcl-2-related protein A1, covalent, APOPTOSIS' _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2LA1_HUMAN _struct_ref.pdbx_db_accession Q16548 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9EW8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 152 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16548 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 151 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 151 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9EW8 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q16548 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8240 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 6 ? LEU A 22 ? GLU A 5 LEU A 21 1 ? 17 HELX_P HELX_P2 AA2 SER A 32 ? LEU A 53 ? SER A 31 LEU A 52 1 ? 22 HELX_P HELX_P3 AA3 LEU A 53 ? VAL A 60 ? LEU A 52 VAL A 59 1 ? 8 HELX_P HELX_P4 AA4 SER A 64 ? PHE A 80 ? SER A 63 PHE A 79 1 ? 17 HELX_P HELX_P5 AA5 ASN A 86 ? GLN A 108 ? ASN A 85 GLN A 107 1 ? 23 HELX_P HELX_P6 AA6 ASP A 114 ? ASN A 138 ? ASP A 113 ASN A 137 1 ? 25 HELX_P HELX_P7 AA7 GLY A 139 ? GLY A 144 ? GLY A 138 GLY A 143 1 ? 6 HELX_P HELX_P8 AA8 GLY A 144 ? GLU A 150 ? GLY A 143 GLU A 149 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 56 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id A1H7Q _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 55 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id A1H7Q _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.770 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1H7Q _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 56 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1H7Q _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 55 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1H7Q _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _pdbx_entry_details.entry_id 9EW8 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 26 ? ? -76.01 27.46 2 1 SER A 28 ? ? 72.54 -35.45 3 1 ASP A 81 ? ? -65.94 0.65 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 375 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 7.50 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A MET 1 ? A MET 2 3 1 Y 1 A THR 2 ? A THR 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1H7Q C1 C N N 1 A1H7Q C2 C N N 2 A1H7Q C3 C N N 3 A1H7Q C7 C Y N 4 A1H7Q C8 C Y N 5 A1H7Q C9 C Y N 6 A1H7Q C10 C Y N 7 A1H7Q C11 C Y N 8 A1H7Q C12 C Y N 9 A1H7Q O O N N 10 A1H7Q C C N N 11 A1H7Q N N N N 12 A1H7Q C6 C N R 13 A1H7Q C5 C N N 14 A1H7Q C4 C N N 15 A1H7Q H1 H N N 16 A1H7Q H2 H N N 17 A1H7Q H3 H N N 18 A1H7Q H4 H N N 19 A1H7Q H5 H N N 20 A1H7Q H6 H N N 21 A1H7Q H7 H N N 22 A1H7Q H8 H N N 23 A1H7Q H9 H N N 24 A1H7Q H10 H N N 25 A1H7Q H11 H N N 26 A1H7Q H12 H N N 27 A1H7Q H13 H N N 28 A1H7Q H14 H N N 29 A1H7Q H15 H N N 30 A1H7Q H16 H N N 31 A1H7Q H17 H N N 32 ALA N N N N 33 ALA CA C N S 34 ALA C C N N 35 ALA O O N N 36 ALA CB C N N 37 ALA OXT O N N 38 ALA H H N N 39 ALA H2 H N N 40 ALA HA H N N 41 ALA HB1 H N N 42 ALA HB2 H N N 43 ALA HB3 H N N 44 ALA HXT H N N 45 ARG N N N N 46 ARG CA C N S 47 ARG C C N N 48 ARG O O N N 49 ARG CB C N N 50 ARG CG C N N 51 ARG CD C N N 52 ARG NE N N N 53 ARG CZ C N N 54 ARG NH1 N N N 55 ARG NH2 N N N 56 ARG OXT O N N 57 ARG H H N N 58 ARG H2 H N N 59 ARG HA H N N 60 ARG HB2 H N N 61 ARG HB3 H N N 62 ARG HG2 H N N 63 ARG HG3 H N N 64 ARG HD2 H N N 65 ARG HD3 H N N 66 ARG HE H N N 67 ARG HH11 H N N 68 ARG HH12 H N N 69 ARG HH21 H N N 70 ARG HH22 H N N 71 ARG HXT H N N 72 ASN N N N N 73 ASN CA C N S 74 ASN C C N N 75 ASN O O N N 76 ASN CB C N N 77 ASN CG C N N 78 ASN OD1 O N N 79 ASN ND2 N N N 80 ASN OXT O N N 81 ASN H H N N 82 ASN H2 H N N 83 ASN HA H N N 84 ASN HB2 H N N 85 ASN HB3 H N N 86 ASN HD21 H N N 87 ASN HD22 H N N 88 ASN HXT H N N 89 ASP N N N N 90 ASP CA C N S 91 ASP C C N N 92 ASP O O N N 93 ASP CB C N N 94 ASP CG C N N 95 ASP OD1 O N N 96 ASP OD2 O N N 97 ASP OXT O N N 98 ASP H H N N 99 ASP H2 H N N 100 ASP HA H N N 101 ASP HB2 H N N 102 ASP HB3 H N N 103 ASP HD2 H N N 104 ASP HXT H N N 105 CYS N N N N 106 CYS CA C N R 107 CYS C C N N 108 CYS O O N N 109 CYS CB C N N 110 CYS SG S N N 111 CYS OXT O N N 112 CYS H H N N 113 CYS H2 H N N 114 CYS HA H N N 115 CYS HB2 H N N 116 CYS HB3 H N N 117 CYS HG H N N 118 CYS HXT H N N 119 GLN N N N N 120 GLN CA C N S 121 GLN C C N N 122 GLN O O N N 123 GLN CB C N N 124 GLN CG C N N 125 GLN CD C N N 126 GLN OE1 O N N 127 GLN NE2 N N N 128 GLN OXT O N N 129 GLN H H N N 130 GLN H2 H N N 131 GLN HA H N N 132 GLN HB2 H N N 133 GLN HB3 H N N 134 GLN HG2 H N N 135 GLN HG3 H N N 136 GLN HE21 H N N 137 GLN HE22 H N N 138 GLN HXT H N N 139 GLU N N N N 140 GLU CA C N S 141 GLU C C N N 142 GLU O O N N 143 GLU CB C N N 144 GLU CG C N N 145 GLU CD C N N 146 GLU OE1 O N N 147 GLU OE2 O N N 148 GLU OXT O N N 149 GLU H H N N 150 GLU H2 H N N 151 GLU HA H N N 152 GLU HB2 H N N 153 GLU HB3 H N N 154 GLU HG2 H N N 155 GLU HG3 H N N 156 GLU HE2 H N N 157 GLU HXT H N N 158 GLY N N N N 159 GLY CA C N N 160 GLY C C N N 161 GLY O O N N 162 GLY OXT O N N 163 GLY H H N N 164 GLY H2 H N N 165 GLY HA2 H N N 166 GLY HA3 H N N 167 GLY HXT H N N 168 HOH O O N N 169 HOH H1 H N N 170 HOH H2 H N N 171 ILE N N N N 172 ILE CA C N S 173 ILE C C N N 174 ILE O O N N 175 ILE CB C N S 176 ILE CG1 C N N 177 ILE CG2 C N N 178 ILE CD1 C N N 179 ILE OXT O N N 180 ILE H H N N 181 ILE H2 H N N 182 ILE HA H N N 183 ILE HB H N N 184 ILE HG12 H N N 185 ILE HG13 H N N 186 ILE HG21 H N N 187 ILE HG22 H N N 188 ILE HG23 H N N 189 ILE HD11 H N N 190 ILE HD12 H N N 191 ILE HD13 H N N 192 ILE HXT H N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 PHE N N N N 261 PHE CA C N S 262 PHE C C N N 263 PHE O O N N 264 PHE CB C N N 265 PHE CG C Y N 266 PHE CD1 C Y N 267 PHE CD2 C Y N 268 PHE CE1 C Y N 269 PHE CE2 C Y N 270 PHE CZ C Y N 271 PHE OXT O N N 272 PHE H H N N 273 PHE H2 H N N 274 PHE HA H N N 275 PHE HB2 H N N 276 PHE HB3 H N N 277 PHE HD1 H N N 278 PHE HD2 H N N 279 PHE HE1 H N N 280 PHE HE2 H N N 281 PHE HZ H N N 282 PHE HXT H N N 283 PRO N N N N 284 PRO CA C N S 285 PRO C C N N 286 PRO O O N N 287 PRO CB C N N 288 PRO CG C N N 289 PRO CD C N N 290 PRO OXT O N N 291 PRO H H N N 292 PRO HA H N N 293 PRO HB2 H N N 294 PRO HB3 H N N 295 PRO HG2 H N N 296 PRO HG3 H N N 297 PRO HD2 H N N 298 PRO HD3 H N N 299 PRO HXT H N N 300 SER N N N N 301 SER CA C N S 302 SER C C N N 303 SER O O N N 304 SER CB C N N 305 SER OG O N N 306 SER OXT O N N 307 SER H H N N 308 SER H2 H N N 309 SER HA H N N 310 SER HB2 H N N 311 SER HB3 H N N 312 SER HG H N N 313 SER HXT H N N 314 THR N N N N 315 THR CA C N S 316 THR C C N N 317 THR O O N N 318 THR CB C N R 319 THR OG1 O N N 320 THR CG2 C N N 321 THR OXT O N N 322 THR H H N N 323 THR H2 H N N 324 THR HA H N N 325 THR HB H N N 326 THR HG1 H N N 327 THR HG21 H N N 328 THR HG22 H N N 329 THR HG23 H N N 330 THR HXT H N N 331 TRP N N N N 332 TRP CA C N S 333 TRP C C N N 334 TRP O O N N 335 TRP CB C N N 336 TRP CG C Y N 337 TRP CD1 C Y N 338 TRP CD2 C Y N 339 TRP NE1 N Y N 340 TRP CE2 C Y N 341 TRP CE3 C Y N 342 TRP CZ2 C Y N 343 TRP CZ3 C Y N 344 TRP CH2 C Y N 345 TRP OXT O N N 346 TRP H H N N 347 TRP H2 H N N 348 TRP HA H N N 349 TRP HB2 H N N 350 TRP HB3 H N N 351 TRP HD1 H N N 352 TRP HE1 H N N 353 TRP HE3 H N N 354 TRP HZ2 H N N 355 TRP HZ3 H N N 356 TRP HH2 H N N 357 TRP HXT H N N 358 TYR N N N N 359 TYR CA C N S 360 TYR C C N N 361 TYR O O N N 362 TYR CB C N N 363 TYR CG C Y N 364 TYR CD1 C Y N 365 TYR CD2 C Y N 366 TYR CE1 C Y N 367 TYR CE2 C Y N 368 TYR CZ C Y N 369 TYR OH O N N 370 TYR OXT O N N 371 TYR H H N N 372 TYR H2 H N N 373 TYR HA H N N 374 TYR HB2 H N N 375 TYR HB3 H N N 376 TYR HD1 H N N 377 TYR HD2 H N N 378 TYR HE1 H N N 379 TYR HE2 H N N 380 TYR HH H N N 381 TYR HXT H N N 382 VAL N N N N 383 VAL CA C N S 384 VAL C C N N 385 VAL O O N N 386 VAL CB C N N 387 VAL CG1 C N N 388 VAL CG2 C N N 389 VAL OXT O N N 390 VAL H H N N 391 VAL H2 H N N 392 VAL HA H N N 393 VAL HB H N N 394 VAL HG11 H N N 395 VAL HG12 H N N 396 VAL HG13 H N N 397 VAL HG21 H N N 398 VAL HG22 H N N 399 VAL HG23 H N N 400 VAL HXT H N N 401 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1H7Q O C2 doub N N 1 A1H7Q C3 N sing N N 2 A1H7Q C3 C4 sing N N 3 A1H7Q C2 N sing N N 4 A1H7Q C2 C1 sing N N 5 A1H7Q C C1 sing N N 6 A1H7Q N C6 sing N N 7 A1H7Q C11 C12 doub Y N 8 A1H7Q C11 C10 sing Y N 9 A1H7Q C12 C7 sing Y N 10 A1H7Q C4 C5 sing N N 11 A1H7Q C10 C9 doub Y N 12 A1H7Q C7 C6 sing N N 13 A1H7Q C7 C8 doub Y N 14 A1H7Q C6 C5 sing N N 15 A1H7Q C9 C8 sing Y N 16 A1H7Q C1 H1 sing N N 17 A1H7Q C1 H2 sing N N 18 A1H7Q C3 H3 sing N N 19 A1H7Q C3 H4 sing N N 20 A1H7Q C8 H5 sing N N 21 A1H7Q C9 H6 sing N N 22 A1H7Q C10 H7 sing N N 23 A1H7Q C11 H8 sing N N 24 A1H7Q C12 H9 sing N N 25 A1H7Q C H10 sing N N 26 A1H7Q C H11 sing N N 27 A1H7Q C H12 sing N N 28 A1H7Q C6 H13 sing N N 29 A1H7Q C5 H14 sing N N 30 A1H7Q C5 H15 sing N N 31 A1H7Q C4 H16 sing N N 32 A1H7Q C4 H17 sing N N 33 ALA N CA sing N N 34 ALA N H sing N N 35 ALA N H2 sing N N 36 ALA CA C sing N N 37 ALA CA CB sing N N 38 ALA CA HA sing N N 39 ALA C O doub N N 40 ALA C OXT sing N N 41 ALA CB HB1 sing N N 42 ALA CB HB2 sing N N 43 ALA CB HB3 sing N N 44 ALA OXT HXT sing N N 45 ARG N CA sing N N 46 ARG N H sing N N 47 ARG N H2 sing N N 48 ARG CA C sing N N 49 ARG CA CB sing N N 50 ARG CA HA sing N N 51 ARG C O doub N N 52 ARG C OXT sing N N 53 ARG CB CG sing N N 54 ARG CB HB2 sing N N 55 ARG CB HB3 sing N N 56 ARG CG CD sing N N 57 ARG CG HG2 sing N N 58 ARG CG HG3 sing N N 59 ARG CD NE sing N N 60 ARG CD HD2 sing N N 61 ARG CD HD3 sing N N 62 ARG NE CZ sing N N 63 ARG NE HE sing N N 64 ARG CZ NH1 sing N N 65 ARG CZ NH2 doub N N 66 ARG NH1 HH11 sing N N 67 ARG NH1 HH12 sing N N 68 ARG NH2 HH21 sing N N 69 ARG NH2 HH22 sing N N 70 ARG OXT HXT sing N N 71 ASN N CA sing N N 72 ASN N H sing N N 73 ASN N H2 sing N N 74 ASN CA C sing N N 75 ASN CA CB sing N N 76 ASN CA HA sing N N 77 ASN C O doub N N 78 ASN C OXT sing N N 79 ASN CB CG sing N N 80 ASN CB HB2 sing N N 81 ASN CB HB3 sing N N 82 ASN CG OD1 doub N N 83 ASN CG ND2 sing N N 84 ASN ND2 HD21 sing N N 85 ASN ND2 HD22 sing N N 86 ASN OXT HXT sing N N 87 ASP N CA sing N N 88 ASP N H sing N N 89 ASP N H2 sing N N 90 ASP CA C sing N N 91 ASP CA CB sing N N 92 ASP CA HA sing N N 93 ASP C O doub N N 94 ASP C OXT sing N N 95 ASP CB CG sing N N 96 ASP CB HB2 sing N N 97 ASP CB HB3 sing N N 98 ASP CG OD1 doub N N 99 ASP CG OD2 sing N N 100 ASP OD2 HD2 sing N N 101 ASP OXT HXT sing N N 102 CYS N CA sing N N 103 CYS N H sing N N 104 CYS N H2 sing N N 105 CYS CA C sing N N 106 CYS CA CB sing N N 107 CYS CA HA sing N N 108 CYS C O doub N N 109 CYS C OXT sing N N 110 CYS CB SG sing N N 111 CYS CB HB2 sing N N 112 CYS CB HB3 sing N N 113 CYS SG HG sing N N 114 CYS OXT HXT sing N N 115 GLN N CA sing N N 116 GLN N H sing N N 117 GLN N H2 sing N N 118 GLN CA C sing N N 119 GLN CA CB sing N N 120 GLN CA HA sing N N 121 GLN C O doub N N 122 GLN C OXT sing N N 123 GLN CB CG sing N N 124 GLN CB HB2 sing N N 125 GLN CB HB3 sing N N 126 GLN CG CD sing N N 127 GLN CG HG2 sing N N 128 GLN CG HG3 sing N N 129 GLN CD OE1 doub N N 130 GLN CD NE2 sing N N 131 GLN NE2 HE21 sing N N 132 GLN NE2 HE22 sing N N 133 GLN OXT HXT sing N N 134 GLU N CA sing N N 135 GLU N H sing N N 136 GLU N H2 sing N N 137 GLU CA C sing N N 138 GLU CA CB sing N N 139 GLU CA HA sing N N 140 GLU C O doub N N 141 GLU C OXT sing N N 142 GLU CB CG sing N N 143 GLU CB HB2 sing N N 144 GLU CB HB3 sing N N 145 GLU CG CD sing N N 146 GLU CG HG2 sing N N 147 GLU CG HG3 sing N N 148 GLU CD OE1 doub N N 149 GLU CD OE2 sing N N 150 GLU OE2 HE2 sing N N 151 GLU OXT HXT sing N N 152 GLY N CA sing N N 153 GLY N H sing N N 154 GLY N H2 sing N N 155 GLY CA C sing N N 156 GLY CA HA2 sing N N 157 GLY CA HA3 sing N N 158 GLY C O doub N N 159 GLY C OXT sing N N 160 GLY OXT HXT sing N N 161 HOH O H1 sing N N 162 HOH O H2 sing N N 163 ILE N CA sing N N 164 ILE N H sing N N 165 ILE N H2 sing N N 166 ILE CA C sing N N 167 ILE CA CB sing N N 168 ILE CA HA sing N N 169 ILE C O doub N N 170 ILE C OXT sing N N 171 ILE CB CG1 sing N N 172 ILE CB CG2 sing N N 173 ILE CB HB sing N N 174 ILE CG1 CD1 sing N N 175 ILE CG1 HG12 sing N N 176 ILE CG1 HG13 sing N N 177 ILE CG2 HG21 sing N N 178 ILE CG2 HG22 sing N N 179 ILE CG2 HG23 sing N N 180 ILE CD1 HD11 sing N N 181 ILE CD1 HD12 sing N N 182 ILE CD1 HD13 sing N N 183 ILE OXT HXT sing N N 184 LEU N CA sing N N 185 LEU N H sing N N 186 LEU N H2 sing N N 187 LEU CA C sing N N 188 LEU CA CB sing N N 189 LEU CA HA sing N N 190 LEU C O doub N N 191 LEU C OXT sing N N 192 LEU CB CG sing N N 193 LEU CB HB2 sing N N 194 LEU CB HB3 sing N N 195 LEU CG CD1 sing N N 196 LEU CG CD2 sing N N 197 LEU CG HG sing N N 198 LEU CD1 HD11 sing N N 199 LEU CD1 HD12 sing N N 200 LEU CD1 HD13 sing N N 201 LEU CD2 HD21 sing N N 202 LEU CD2 HD22 sing N N 203 LEU CD2 HD23 sing N N 204 LEU OXT HXT sing N N 205 LYS N CA sing N N 206 LYS N H sing N N 207 LYS N H2 sing N N 208 LYS CA C sing N N 209 LYS CA CB sing N N 210 LYS CA HA sing N N 211 LYS C O doub N N 212 LYS C OXT sing N N 213 LYS CB CG sing N N 214 LYS CB HB2 sing N N 215 LYS CB HB3 sing N N 216 LYS CG CD sing N N 217 LYS CG HG2 sing N N 218 LYS CG HG3 sing N N 219 LYS CD CE sing N N 220 LYS CD HD2 sing N N 221 LYS CD HD3 sing N N 222 LYS CE NZ sing N N 223 LYS CE HE2 sing N N 224 LYS CE HE3 sing N N 225 LYS NZ HZ1 sing N N 226 LYS NZ HZ2 sing N N 227 LYS NZ HZ3 sing N N 228 LYS OXT HXT sing N N 229 MET N CA sing N N 230 MET N H sing N N 231 MET N H2 sing N N 232 MET CA C sing N N 233 MET CA CB sing N N 234 MET CA HA sing N N 235 MET C O doub N N 236 MET C OXT sing N N 237 MET CB CG sing N N 238 MET CB HB2 sing N N 239 MET CB HB3 sing N N 240 MET CG SD sing N N 241 MET CG HG2 sing N N 242 MET CG HG3 sing N N 243 MET SD CE sing N N 244 MET CE HE1 sing N N 245 MET CE HE2 sing N N 246 MET CE HE3 sing N N 247 MET OXT HXT sing N N 248 PHE N CA sing N N 249 PHE N H sing N N 250 PHE N H2 sing N N 251 PHE CA C sing N N 252 PHE CA CB sing N N 253 PHE CA HA sing N N 254 PHE C O doub N N 255 PHE C OXT sing N N 256 PHE CB CG sing N N 257 PHE CB HB2 sing N N 258 PHE CB HB3 sing N N 259 PHE CG CD1 doub Y N 260 PHE CG CD2 sing Y N 261 PHE CD1 CE1 sing Y N 262 PHE CD1 HD1 sing N N 263 PHE CD2 CE2 doub Y N 264 PHE CD2 HD2 sing N N 265 PHE CE1 CZ doub Y N 266 PHE CE1 HE1 sing N N 267 PHE CE2 CZ sing Y N 268 PHE CE2 HE2 sing N N 269 PHE CZ HZ sing N N 270 PHE OXT HXT sing N N 271 PRO N CA sing N N 272 PRO N CD sing N N 273 PRO N H sing N N 274 PRO CA C sing N N 275 PRO CA CB sing N N 276 PRO CA HA sing N N 277 PRO C O doub N N 278 PRO C OXT sing N N 279 PRO CB CG sing N N 280 PRO CB HB2 sing N N 281 PRO CB HB3 sing N N 282 PRO CG CD sing N N 283 PRO CG HG2 sing N N 284 PRO CG HG3 sing N N 285 PRO CD HD2 sing N N 286 PRO CD HD3 sing N N 287 PRO OXT HXT sing N N 288 SER N CA sing N N 289 SER N H sing N N 290 SER N H2 sing N N 291 SER CA C sing N N 292 SER CA CB sing N N 293 SER CA HA sing N N 294 SER C O doub N N 295 SER C OXT sing N N 296 SER CB OG sing N N 297 SER CB HB2 sing N N 298 SER CB HB3 sing N N 299 SER OG HG sing N N 300 SER OXT HXT sing N N 301 THR N CA sing N N 302 THR N H sing N N 303 THR N H2 sing N N 304 THR CA C sing N N 305 THR CA CB sing N N 306 THR CA HA sing N N 307 THR C O doub N N 308 THR C OXT sing N N 309 THR CB OG1 sing N N 310 THR CB CG2 sing N N 311 THR CB HB sing N N 312 THR OG1 HG1 sing N N 313 THR CG2 HG21 sing N N 314 THR CG2 HG22 sing N N 315 THR CG2 HG23 sing N N 316 THR OXT HXT sing N N 317 TRP N CA sing N N 318 TRP N H sing N N 319 TRP N H2 sing N N 320 TRP CA C sing N N 321 TRP CA CB sing N N 322 TRP CA HA sing N N 323 TRP C O doub N N 324 TRP C OXT sing N N 325 TRP CB CG sing N N 326 TRP CB HB2 sing N N 327 TRP CB HB3 sing N N 328 TRP CG CD1 doub Y N 329 TRP CG CD2 sing Y N 330 TRP CD1 NE1 sing Y N 331 TRP CD1 HD1 sing N N 332 TRP CD2 CE2 doub Y N 333 TRP CD2 CE3 sing Y N 334 TRP NE1 CE2 sing Y N 335 TRP NE1 HE1 sing N N 336 TRP CE2 CZ2 sing Y N 337 TRP CE3 CZ3 doub Y N 338 TRP CE3 HE3 sing N N 339 TRP CZ2 CH2 doub Y N 340 TRP CZ2 HZ2 sing N N 341 TRP CZ3 CH2 sing Y N 342 TRP CZ3 HZ3 sing N N 343 TRP CH2 HH2 sing N N 344 TRP OXT HXT sing N N 345 TYR N CA sing N N 346 TYR N H sing N N 347 TYR N H2 sing N N 348 TYR CA C sing N N 349 TYR CA CB sing N N 350 TYR CA HA sing N N 351 TYR C O doub N N 352 TYR C OXT sing N N 353 TYR CB CG sing N N 354 TYR CB HB2 sing N N 355 TYR CB HB3 sing N N 356 TYR CG CD1 doub Y N 357 TYR CG CD2 sing Y N 358 TYR CD1 CE1 sing Y N 359 TYR CD1 HD1 sing N N 360 TYR CD2 CE2 doub Y N 361 TYR CD2 HD2 sing N N 362 TYR CE1 CZ doub Y N 363 TYR CE1 HE1 sing N N 364 TYR CE2 CZ sing Y N 365 TYR CE2 HE2 sing N N 366 TYR CZ OH sing N N 367 TYR OH HH sing N N 368 TYR OXT HXT sing N N 369 VAL N CA sing N N 370 VAL N H sing N N 371 VAL N H2 sing N N 372 VAL CA C sing N N 373 VAL CA CB sing N N 374 VAL CA HA sing N N 375 VAL C O doub N N 376 VAL C OXT sing N N 377 VAL CB CG1 sing N N 378 VAL CB CG2 sing N N 379 VAL CB HB sing N N 380 VAL CG1 HG11 sing N N 381 VAL CG1 HG12 sing N N 382 VAL CG1 HG13 sing N N 383 VAL CG2 HG21 sing N N 384 VAL CG2 HG22 sing N N 385 VAL CG2 HG23 sing N N 386 VAL OXT HXT sing N N 387 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5UUK _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9EW8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.025056 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005262 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023277 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023774 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #