data_9F1F # _entry.id 9F1F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9F1F pdb_00009f1f 10.2210/pdb9f1f/pdb WWPDB D_1292138008 ? ? BMRB 52390 ? 10.13018/BMR52390 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-09-11 2 'Structure model' 1 1 2024-12-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_entry_details # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9F1F _pdbx_database_status.recvd_initial_deposition_date 2024-04-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 52390 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email birgit.habenstein@iecb.u-bordeaux.fr _pdbx_contact_author.name_first Habenstein _pdbx_contact_author.name_last Birgit _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3723-9552 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Xu, Z.' 1 0009-0005-5034-1297 'Habenstein, B.' 2 0000-0003-3723-9552 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Commun Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2399-3642 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 1620 _citation.page_last 1620 _citation.title 'Dynamic pre-structuration of lipid nanodomain-segregating remorin proteins.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s42003-024-07330-y _citation.pdbx_database_id_PubMed 39639105 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, Z.' 1 0009-0005-5034-1297 primary 'Schahl, A.' 2 0000-0001-5839-7715 primary 'Jolivet, M.D.' 3 ? primary 'Legrand, A.' 4 ? primary 'Grelard, A.' 5 0000-0002-6708-2253 primary 'Berbon, M.' 6 ? primary 'Morvan, E.' 7 ? primary 'Lagardere, L.' 8 ? primary 'Piquemal, J.P.' 9 0000-0001-6615-9426 primary 'Loquet, A.' 10 0000-0001-7176-7813 primary 'Germain, V.' 11 ? primary 'Chavent, M.' 12 0000-0003-4524-4773 primary 'Mongrand, S.' 13 0000-0002-9198-015X primary 'Habenstein, B.' 14 0000-0003-3723-9552 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description Remorin _entity.formula_weight 4356.115 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name pp34 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code EEKRAMIEAKRGEDLLKAEELAAKYRATGTAPKKILGIF _entity_poly.pdbx_seq_one_letter_code_can EEKRAMIEAKRGEDLLKAEELAAKYRATGTAPKKILGIF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLU n 1 3 LYS n 1 4 ARG n 1 5 ALA n 1 6 MET n 1 7 ILE n 1 8 GLU n 1 9 ALA n 1 10 LYS n 1 11 ARG n 1 12 GLY n 1 13 GLU n 1 14 ASP n 1 15 LEU n 1 16 LEU n 1 17 LYS n 1 18 ALA n 1 19 GLU n 1 20 GLU n 1 21 LEU n 1 22 ALA n 1 23 ALA n 1 24 LYS n 1 25 TYR n 1 26 ARG n 1 27 ALA n 1 28 THR n 1 29 GLY n 1 30 THR n 1 31 ALA n 1 32 PRO n 1 33 LYS n 1 34 LYS n 1 35 ILE n 1 36 LEU n 1 37 GLY n 1 38 ILE n 1 39 PHE n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 39 _pdbx_entity_src_syn.organism_scientific 'Nicotiana benthamiana' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 4100 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 160 160 GLU GLU A . n A 1 2 GLU 2 161 161 GLU GLU A . n A 1 3 LYS 3 162 162 LYS LYS A . n A 1 4 ARG 4 163 163 ARG ARG A . n A 1 5 ALA 5 164 164 ALA ALA A . n A 1 6 MET 6 165 165 MET MET A . n A 1 7 ILE 7 166 166 ILE ILE A . n A 1 8 GLU 8 167 167 GLU GLU A . n A 1 9 ALA 9 168 168 ALA ALA A . n A 1 10 LYS 10 169 169 LYS LYS A . n A 1 11 ARG 11 170 170 ARG ARG A . n A 1 12 GLY 12 171 171 GLY GLY A . n A 1 13 GLU 13 172 172 GLU GLU A . n A 1 14 ASP 14 173 173 ASP ASP A . n A 1 15 LEU 15 174 174 LEU LEU A . n A 1 16 LEU 16 175 175 LEU LEU A . n A 1 17 LYS 17 176 176 LYS LYS A . n A 1 18 ALA 18 177 177 ALA ALA A . n A 1 19 GLU 19 178 178 GLU GLU A . n A 1 20 GLU 20 179 179 GLU GLU A . n A 1 21 LEU 21 180 180 LEU LEU A . n A 1 22 ALA 22 181 181 ALA ALA A . n A 1 23 ALA 23 182 182 ALA ALA A . n A 1 24 LYS 24 183 183 LYS LYS A . n A 1 25 TYR 25 184 184 TYR TYR A . n A 1 26 ARG 26 185 185 ARG ARG A . n A 1 27 ALA 27 186 186 ALA ALA A . n A 1 28 THR 28 187 187 THR THR A . n A 1 29 GLY 29 188 188 GLY GLY A . n A 1 30 THR 30 189 189 THR THR A . n A 1 31 ALA 31 190 190 ALA ALA A . n A 1 32 PRO 32 191 191 PRO PRO A . n A 1 33 LYS 33 192 192 LYS LYS A . n A 1 34 LYS 34 193 193 LYS LYS A . n A 1 35 ILE 35 194 194 ILE ILE A . n A 1 36 LEU 36 195 195 LEU LEU A . n A 1 37 GLY 37 196 196 GLY GLY A . n A 1 38 ILE 38 197 197 ILE ILE A . n A 1 39 PHE 39 198 198 PHE PHE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9F1F _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9F1F _struct.title 'Remorin protein StREM13_160-198' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9F1F _struct_keywords.text 'Remorin, Membrane anchor, PEPTIDE BINDING PROTEIN' _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code REMO_SOLTU _struct_ref.pdbx_db_accession P93788 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EEKRAMIEAKRGEDLLKAEELAAKYRATGTAPKKILGIF _struct_ref.pdbx_align_begin 160 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9F1F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 39 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P93788 _struct_ref_seq.db_align_beg 160 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 198 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 160 _struct_ref_seq.pdbx_auth_seq_align_end 198 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 1 ? GLU A 8 ? GLU A 160 GLU A 167 1 ? 8 HELX_P HELX_P2 AA2 LYS A 10 ? ARG A 26 ? LYS A 169 ARG A 185 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9F1F _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OD1 A ASP 173 ? ? HZ2 A LYS 176 ? ? 1.60 2 9 O A ILE 194 ? ? H A GLY 196 ? ? 1.60 3 14 HZ2 A LYS 176 ? ? OXT A PHE 198 ? ? 1.58 4 14 HH12 A ARG 163 ? ? OE1 A GLU 167 ? ? 1.60 5 18 HZ1 A LYS 176 ? ? O A PHE 198 ? ? 1.59 6 32 OD2 A ASP 173 ? ? HZ3 A LYS 176 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 193 ? ? -173.17 -176.99 2 1 ILE A 197 ? ? -176.92 89.92 3 2 THR A 189 ? ? 6.14 72.73 4 3 GLU A 161 ? ? 68.33 -63.12 5 3 THR A 189 ? ? -161.70 53.04 6 3 ILE A 197 ? ? -177.13 78.28 7 4 THR A 189 ? ? 7.43 64.14 8 4 ILE A 194 ? ? -69.81 98.95 9 5 GLU A 161 ? ? 68.99 -58.77 10 5 THR A 189 ? ? -160.24 66.98 11 5 LYS A 192 ? ? 65.73 67.15 12 6 THR A 189 ? ? 4.83 75.01 13 6 ILE A 194 ? ? 56.95 -82.81 14 7 THR A 189 ? ? 5.09 74.45 15 8 ALA A 186 ? ? -83.81 -86.94 16 8 LYS A 193 ? ? -172.90 -166.76 17 8 LEU A 195 ? ? 46.92 -164.77 18 9 THR A 189 ? ? 6.80 64.59 19 9 LEU A 195 ? ? 60.68 -38.30 20 9 ILE A 197 ? ? -179.64 -40.55 21 10 THR A 189 ? ? 6.21 68.00 22 10 ILE A 197 ? ? 173.73 -61.05 23 11 ALA A 186 ? ? -101.48 72.40 24 11 THR A 187 ? ? -43.63 -19.46 25 11 THR A 189 ? ? -91.58 57.75 26 11 ILE A 197 ? ? -169.21 -52.03 27 12 THR A 189 ? ? 7.07 72.59 28 12 LYS A 193 ? ? -112.86 -146.33 29 12 ILE A 197 ? ? -161.31 -51.20 30 13 THR A 189 ? ? 6.33 71.79 31 13 ALA A 190 ? ? -106.98 -60.55 32 13 LYS A 192 ? ? 36.74 67.53 33 13 LYS A 193 ? ? -171.58 49.85 34 13 ILE A 194 ? ? 66.24 -64.49 35 13 LEU A 195 ? ? 44.84 -160.58 36 14 THR A 189 ? ? 5.66 68.58 37 15 THR A 189 ? ? 6.23 70.62 38 16 THR A 189 ? ? -62.99 84.09 39 16 PRO A 191 ? ? -66.37 3.49 40 16 ILE A 197 ? ? -170.13 -40.38 41 17 LYS A 192 ? ? 36.51 71.08 42 18 THR A 189 ? ? 5.78 67.91 43 18 LYS A 192 ? ? 43.51 73.36 44 18 ILE A 197 ? ? -101.22 79.71 45 19 ILE A 194 ? ? 59.69 -75.25 46 19 ILE A 197 ? ? -90.35 -85.29 47 20 ALA A 186 ? ? -109.14 79.23 48 20 LYS A 192 ? ? 57.99 75.98 49 20 LYS A 193 ? ? 39.92 -77.50 50 20 LEU A 195 ? ? -131.87 -153.46 51 20 ILE A 197 ? ? -135.63 -148.04 52 21 THR A 189 ? ? -100.94 63.32 53 21 LYS A 192 ? ? 57.53 105.76 54 22 THR A 189 ? ? 6.57 72.63 55 22 ILE A 197 ? ? -106.60 69.60 56 23 GLU A 161 ? ? 69.95 -61.67 57 23 THR A 187 ? ? -54.47 -7.75 58 23 LYS A 193 ? ? 44.45 26.09 59 23 ILE A 194 ? ? 53.29 76.02 60 23 ILE A 197 ? ? -100.82 73.32 61 24 THR A 189 ? ? 6.76 68.99 62 24 ILE A 197 ? ? 178.04 -63.92 63 25 THR A 189 ? ? 3.24 87.05 64 25 LEU A 195 ? ? 53.60 -13.45 65 26 THR A 189 ? ? 8.33 69.11 66 26 LYS A 193 ? ? -127.52 -167.94 67 27 GLU A 161 ? ? 69.80 -61.71 68 27 THR A 187 ? ? -57.19 -6.00 69 27 ILE A 194 ? ? -77.70 48.76 70 27 LEU A 195 ? ? -85.72 -159.65 71 27 ILE A 197 ? ? 172.86 -51.11 72 28 GLU A 161 ? ? 68.50 -64.03 73 28 THR A 189 ? ? 7.13 75.99 74 28 LYS A 193 ? ? -93.10 -68.90 75 28 ILE A 197 ? ? -158.28 66.35 76 29 THR A 189 ? ? 6.82 69.32 77 29 ILE A 197 ? ? -175.78 75.93 78 30 THR A 189 ? ? 6.50 72.48 79 30 LEU A 195 ? ? -127.03 -168.94 80 31 THR A 189 ? ? 5.58 73.85 81 31 LYS A 193 ? ? -115.93 -168.38 82 31 ILE A 194 ? ? -49.13 -72.97 83 31 LEU A 195 ? ? 33.10 -105.52 84 32 THR A 189 ? ? 6.75 68.46 85 32 ILE A 197 ? ? -168.83 119.71 86 34 GLU A 161 ? ? 69.46 -61.87 87 34 THR A 189 ? ? -157.97 84.83 88 34 PRO A 191 ? ? -26.21 -41.68 89 34 ILE A 194 ? ? -68.17 91.41 90 34 ILE A 197 ? ? -161.11 88.13 91 35 ALA A 186 ? ? -95.12 -73.94 92 35 LYS A 192 ? ? 52.55 74.42 93 37 THR A 189 ? ? 3.08 77.20 94 37 ALA A 190 ? ? -91.46 -64.49 95 37 ILE A 197 ? ? -164.40 64.01 96 38 THR A 189 ? ? -87.20 40.14 97 38 LYS A 193 ? ? -74.90 -156.99 98 39 ALA A 186 ? ? -100.20 -80.39 99 39 LYS A 192 ? ? 45.54 73.36 100 40 THR A 189 ? ? 4.90 70.90 101 40 ILE A 197 ? ? -104.31 78.00 # _pdbx_nmr_ensemble.entry_id 9F1F _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 40 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9F1F _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 nM 0 StREM13_160-198, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 0 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component StREM13_160-198 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units nM _pdbx_nmr_exptl_sample.isotopic_labeling 0 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units Pa _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 anisotropic 2 1 1 '2D 1H-1H NOESY' 1 anisotropic 3 1 1 '2D 1H-1H TOCSY' 1 anisotropic # _pdbx_nmr_refine.entry_id 9F1F _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 2 'structure calculation' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 refinement ARIA ? ;Linge, O'Donoghue and Nilges ; 4 'peak picking' 'CcpNmr Analysis' ? CCPN # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLU N N N N 57 GLU CA C N S 58 GLU C C N N 59 GLU O O N N 60 GLU CB C N N 61 GLU CG C N N 62 GLU CD C N N 63 GLU OE1 O N N 64 GLU OE2 O N N 65 GLU OXT O N N 66 GLU H H N N 67 GLU H2 H N N 68 GLU HA H N N 69 GLU HB2 H N N 70 GLU HB3 H N N 71 GLU HG2 H N N 72 GLU HG3 H N N 73 GLU HE2 H N N 74 GLU HXT H N N 75 GLY N N N N 76 GLY CA C N N 77 GLY C C N N 78 GLY O O N N 79 GLY OXT O N N 80 GLY H H N N 81 GLY H2 H N N 82 GLY HA2 H N N 83 GLY HA3 H N N 84 GLY HXT H N N 85 ILE N N N N 86 ILE CA C N S 87 ILE C C N N 88 ILE O O N N 89 ILE CB C N S 90 ILE CG1 C N N 91 ILE CG2 C N N 92 ILE CD1 C N N 93 ILE OXT O N N 94 ILE H H N N 95 ILE H2 H N N 96 ILE HA H N N 97 ILE HB H N N 98 ILE HG12 H N N 99 ILE HG13 H N N 100 ILE HG21 H N N 101 ILE HG22 H N N 102 ILE HG23 H N N 103 ILE HD11 H N N 104 ILE HD12 H N N 105 ILE HD13 H N N 106 ILE HXT H N N 107 LEU N N N N 108 LEU CA C N S 109 LEU C C N N 110 LEU O O N N 111 LEU CB C N N 112 LEU CG C N N 113 LEU CD1 C N N 114 LEU CD2 C N N 115 LEU OXT O N N 116 LEU H H N N 117 LEU H2 H N N 118 LEU HA H N N 119 LEU HB2 H N N 120 LEU HB3 H N N 121 LEU HG H N N 122 LEU HD11 H N N 123 LEU HD12 H N N 124 LEU HD13 H N N 125 LEU HD21 H N N 126 LEU HD22 H N N 127 LEU HD23 H N N 128 LEU HXT H N N 129 LYS N N N N 130 LYS CA C N S 131 LYS C C N N 132 LYS O O N N 133 LYS CB C N N 134 LYS CG C N N 135 LYS CD C N N 136 LYS CE C N N 137 LYS NZ N N N 138 LYS OXT O N N 139 LYS H H N N 140 LYS H2 H N N 141 LYS HA H N N 142 LYS HB2 H N N 143 LYS HB3 H N N 144 LYS HG2 H N N 145 LYS HG3 H N N 146 LYS HD2 H N N 147 LYS HD3 H N N 148 LYS HE2 H N N 149 LYS HE3 H N N 150 LYS HZ1 H N N 151 LYS HZ2 H N N 152 LYS HZ3 H N N 153 LYS HXT H N N 154 MET N N N N 155 MET CA C N S 156 MET C C N N 157 MET O O N N 158 MET CB C N N 159 MET CG C N N 160 MET SD S N N 161 MET CE C N N 162 MET OXT O N N 163 MET H H N N 164 MET H2 H N N 165 MET HA H N N 166 MET HB2 H N N 167 MET HB3 H N N 168 MET HG2 H N N 169 MET HG3 H N N 170 MET HE1 H N N 171 MET HE2 H N N 172 MET HE3 H N N 173 MET HXT H N N 174 PHE N N N N 175 PHE CA C N S 176 PHE C C N N 177 PHE O O N N 178 PHE CB C N N 179 PHE CG C Y N 180 PHE CD1 C Y N 181 PHE CD2 C Y N 182 PHE CE1 C Y N 183 PHE CE2 C Y N 184 PHE CZ C Y N 185 PHE OXT O N N 186 PHE H H N N 187 PHE H2 H N N 188 PHE HA H N N 189 PHE HB2 H N N 190 PHE HB3 H N N 191 PHE HD1 H N N 192 PHE HD2 H N N 193 PHE HE1 H N N 194 PHE HE2 H N N 195 PHE HZ H N N 196 PHE HXT H N N 197 PRO N N N N 198 PRO CA C N S 199 PRO C C N N 200 PRO O O N N 201 PRO CB C N N 202 PRO CG C N N 203 PRO CD C N N 204 PRO OXT O N N 205 PRO H H N N 206 PRO HA H N N 207 PRO HB2 H N N 208 PRO HB3 H N N 209 PRO HG2 H N N 210 PRO HG3 H N N 211 PRO HD2 H N N 212 PRO HD3 H N N 213 PRO HXT H N N 214 THR N N N N 215 THR CA C N S 216 THR C C N N 217 THR O O N N 218 THR CB C N R 219 THR OG1 O N N 220 THR CG2 C N N 221 THR OXT O N N 222 THR H H N N 223 THR H2 H N N 224 THR HA H N N 225 THR HB H N N 226 THR HG1 H N N 227 THR HG21 H N N 228 THR HG22 H N N 229 THR HG23 H N N 230 THR HXT H N N 231 TYR N N N N 232 TYR CA C N S 233 TYR C C N N 234 TYR O O N N 235 TYR CB C N N 236 TYR CG C Y N 237 TYR CD1 C Y N 238 TYR CD2 C Y N 239 TYR CE1 C Y N 240 TYR CE2 C Y N 241 TYR CZ C Y N 242 TYR OH O N N 243 TYR OXT O N N 244 TYR H H N N 245 TYR H2 H N N 246 TYR HA H N N 247 TYR HB2 H N N 248 TYR HB3 H N N 249 TYR HD1 H N N 250 TYR HD2 H N N 251 TYR HE1 H N N 252 TYR HE2 H N N 253 TYR HH H N N 254 TYR HXT H N N 255 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLU N CA sing N N 54 GLU N H sing N N 55 GLU N H2 sing N N 56 GLU CA C sing N N 57 GLU CA CB sing N N 58 GLU CA HA sing N N 59 GLU C O doub N N 60 GLU C OXT sing N N 61 GLU CB CG sing N N 62 GLU CB HB2 sing N N 63 GLU CB HB3 sing N N 64 GLU CG CD sing N N 65 GLU CG HG2 sing N N 66 GLU CG HG3 sing N N 67 GLU CD OE1 doub N N 68 GLU CD OE2 sing N N 69 GLU OE2 HE2 sing N N 70 GLU OXT HXT sing N N 71 GLY N CA sing N N 72 GLY N H sing N N 73 GLY N H2 sing N N 74 GLY CA C sing N N 75 GLY CA HA2 sing N N 76 GLY CA HA3 sing N N 77 GLY C O doub N N 78 GLY C OXT sing N N 79 GLY OXT HXT sing N N 80 ILE N CA sing N N 81 ILE N H sing N N 82 ILE N H2 sing N N 83 ILE CA C sing N N 84 ILE CA CB sing N N 85 ILE CA HA sing N N 86 ILE C O doub N N 87 ILE C OXT sing N N 88 ILE CB CG1 sing N N 89 ILE CB CG2 sing N N 90 ILE CB HB sing N N 91 ILE CG1 CD1 sing N N 92 ILE CG1 HG12 sing N N 93 ILE CG1 HG13 sing N N 94 ILE CG2 HG21 sing N N 95 ILE CG2 HG22 sing N N 96 ILE CG2 HG23 sing N N 97 ILE CD1 HD11 sing N N 98 ILE CD1 HD12 sing N N 99 ILE CD1 HD13 sing N N 100 ILE OXT HXT sing N N 101 LEU N CA sing N N 102 LEU N H sing N N 103 LEU N H2 sing N N 104 LEU CA C sing N N 105 LEU CA CB sing N N 106 LEU CA HA sing N N 107 LEU C O doub N N 108 LEU C OXT sing N N 109 LEU CB CG sing N N 110 LEU CB HB2 sing N N 111 LEU CB HB3 sing N N 112 LEU CG CD1 sing N N 113 LEU CG CD2 sing N N 114 LEU CG HG sing N N 115 LEU CD1 HD11 sing N N 116 LEU CD1 HD12 sing N N 117 LEU CD1 HD13 sing N N 118 LEU CD2 HD21 sing N N 119 LEU CD2 HD22 sing N N 120 LEU CD2 HD23 sing N N 121 LEU OXT HXT sing N N 122 LYS N CA sing N N 123 LYS N H sing N N 124 LYS N H2 sing N N 125 LYS CA C sing N N 126 LYS CA CB sing N N 127 LYS CA HA sing N N 128 LYS C O doub N N 129 LYS C OXT sing N N 130 LYS CB CG sing N N 131 LYS CB HB2 sing N N 132 LYS CB HB3 sing N N 133 LYS CG CD sing N N 134 LYS CG HG2 sing N N 135 LYS CG HG3 sing N N 136 LYS CD CE sing N N 137 LYS CD HD2 sing N N 138 LYS CD HD3 sing N N 139 LYS CE NZ sing N N 140 LYS CE HE2 sing N N 141 LYS CE HE3 sing N N 142 LYS NZ HZ1 sing N N 143 LYS NZ HZ2 sing N N 144 LYS NZ HZ3 sing N N 145 LYS OXT HXT sing N N 146 MET N CA sing N N 147 MET N H sing N N 148 MET N H2 sing N N 149 MET CA C sing N N 150 MET CA CB sing N N 151 MET CA HA sing N N 152 MET C O doub N N 153 MET C OXT sing N N 154 MET CB CG sing N N 155 MET CB HB2 sing N N 156 MET CB HB3 sing N N 157 MET CG SD sing N N 158 MET CG HG2 sing N N 159 MET CG HG3 sing N N 160 MET SD CE sing N N 161 MET CE HE1 sing N N 162 MET CE HE2 sing N N 163 MET CE HE3 sing N N 164 MET OXT HXT sing N N 165 PHE N CA sing N N 166 PHE N H sing N N 167 PHE N H2 sing N N 168 PHE CA C sing N N 169 PHE CA CB sing N N 170 PHE CA HA sing N N 171 PHE C O doub N N 172 PHE C OXT sing N N 173 PHE CB CG sing N N 174 PHE CB HB2 sing N N 175 PHE CB HB3 sing N N 176 PHE CG CD1 doub Y N 177 PHE CG CD2 sing Y N 178 PHE CD1 CE1 sing Y N 179 PHE CD1 HD1 sing N N 180 PHE CD2 CE2 doub Y N 181 PHE CD2 HD2 sing N N 182 PHE CE1 CZ doub Y N 183 PHE CE1 HE1 sing N N 184 PHE CE2 CZ sing Y N 185 PHE CE2 HE2 sing N N 186 PHE CZ HZ sing N N 187 PHE OXT HXT sing N N 188 PRO N CA sing N N 189 PRO N CD sing N N 190 PRO N H sing N N 191 PRO CA C sing N N 192 PRO CA CB sing N N 193 PRO CA HA sing N N 194 PRO C O doub N N 195 PRO C OXT sing N N 196 PRO CB CG sing N N 197 PRO CB HB2 sing N N 198 PRO CB HB3 sing N N 199 PRO CG CD sing N N 200 PRO CG HG2 sing N N 201 PRO CG HG3 sing N N 202 PRO CD HD2 sing N N 203 PRO CD HD3 sing N N 204 PRO OXT HXT sing N N 205 THR N CA sing N N 206 THR N H sing N N 207 THR N H2 sing N N 208 THR CA C sing N N 209 THR CA CB sing N N 210 THR CA HA sing N N 211 THR C O doub N N 212 THR C OXT sing N N 213 THR CB OG1 sing N N 214 THR CB CG2 sing N N 215 THR CB HB sing N N 216 THR OG1 HG1 sing N N 217 THR CG2 HG21 sing N N 218 THR CG2 HG22 sing N N 219 THR CG2 HG23 sing N N 220 THR OXT HXT sing N N 221 TYR N CA sing N N 222 TYR N H sing N N 223 TYR N H2 sing N N 224 TYR CA C sing N N 225 TYR CA CB sing N N 226 TYR CA HA sing N N 227 TYR C O doub N N 228 TYR C OXT sing N N 229 TYR CB CG sing N N 230 TYR CB HB2 sing N N 231 TYR CB HB3 sing N N 232 TYR CG CD1 doub Y N 233 TYR CG CD2 sing Y N 234 TYR CD1 CE1 sing Y N 235 TYR CD1 HD1 sing N N 236 TYR CD2 CE2 doub Y N 237 TYR CD2 HD2 sing N N 238 TYR CE1 CZ doub Y N 239 TYR CE1 HE1 sing N N 240 TYR CE2 CZ sing Y N 241 TYR CE2 HE2 sing N N 242 TYR CZ OH sing N N 243 TYR OH HH sing N N 244 TYR OXT HXT sing N N 245 # _pdbx_audit_support.funding_organization 'Agence Nationale de la Recherche (ANR)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE NEO' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9F1F _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #