data_9F27 # _entry.id 9F27 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.401 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9F27 pdb_00009f27 10.2210/pdb9f27/pdb WWPDB D_1292137503 ? ? BMRB 34913 ? 10.13018/BMR34913 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-12-04 2 'Structure model' 1 1 2025-01-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9F27 _pdbx_database_status.recvd_initial_deposition_date 2024-04-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structure of the Pyrococcus abyssi Rpa2 winged-helix domain' _pdbx_database_related.db_id 34913 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email inaki.guijarro@pasteur.fr _pdbx_contact_author.name_first 'J. Inaki' _pdbx_contact_author.name_last Guijarro _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3826-5245 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Le Meur, R.A.' 1 0000-0002-9761-4863 'Madru, C.' 2 0000-0002-5412-8822 'Cordier, F.' 3 0000-0002-5963-7773 'Sauguet, L.' 4 0000-0002-1259-6601 'Guijarro, J.I.' 5 0000-0002-3826-5245 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first 10926 _citation.page_last 10926 _citation.title 'Communication between DNA polymerases and Replication Protein A within the archaeal replisome.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-024-55365-w _citation.pdbx_database_id_PubMed 39738083 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Martinez-Carranza, M.' 1 0000-0003-0192-9762 primary 'Vialle, L.' 2 ? primary 'Madru, C.' 3 0000-0002-5412-8822 primary 'Cordier, F.' 4 0000-0002-5963-7773 primary 'Tekpinar, A.D.' 5 0000-0002-0578-5092 primary 'Haouz, A.' 6 0000-0003-1196-1635 primary 'Legrand, P.' 7 0000-0003-2431-2255 primary 'Le Meur, R.A.' 8 ? primary 'England, P.' 9 0000-0001-6410-5918 primary 'Dulermo, R.' 10 ? primary 'Guijarro, J.I.' 11 0000-0002-3826-5245 primary 'Henneke, G.' 12 ? primary 'Sauguet, L.' 13 0000-0002-1259-6601 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RPA32 subunit of the hetero-oligomeric complex involved in homologous recombination' _entity.formula_weight 11006.380 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'The three N-terminal residues GTG result from cloning and do not belong to RPA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GTGGIMMEERSIEEPMEELLEEEIPEEKEENELLEKAKEDILNILRQKRTAISRKYILKKLGDKYDEETIDDAITELLAQ GEIYEPETGYYKLL ; _entity_poly.pdbx_seq_one_letter_code_can ;GTGGIMMEERSIEEPMEELLEEEIPEEKEENELLEKAKEDILNILRQKRTAISRKYILKKLGDKYDEETIDDAITELLAQ GEIYEPETGYYKLL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 GLY n 1 4 GLY n 1 5 ILE n 1 6 MET n 1 7 MET n 1 8 GLU n 1 9 GLU n 1 10 ARG n 1 11 SER n 1 12 ILE n 1 13 GLU n 1 14 GLU n 1 15 PRO n 1 16 MET n 1 17 GLU n 1 18 GLU n 1 19 LEU n 1 20 LEU n 1 21 GLU n 1 22 GLU n 1 23 GLU n 1 24 ILE n 1 25 PRO n 1 26 GLU n 1 27 GLU n 1 28 LYS n 1 29 GLU n 1 30 GLU n 1 31 ASN n 1 32 GLU n 1 33 LEU n 1 34 LEU n 1 35 GLU n 1 36 LYS n 1 37 ALA n 1 38 LYS n 1 39 GLU n 1 40 ASP n 1 41 ILE n 1 42 LEU n 1 43 ASN n 1 44 ILE n 1 45 LEU n 1 46 ARG n 1 47 GLN n 1 48 LYS n 1 49 ARG n 1 50 THR n 1 51 ALA n 1 52 ILE n 1 53 SER n 1 54 ARG n 1 55 LYS n 1 56 TYR n 1 57 ILE n 1 58 LEU n 1 59 LYS n 1 60 LYS n 1 61 LEU n 1 62 GLY n 1 63 ASP n 1 64 LYS n 1 65 TYR n 1 66 ASP n 1 67 GLU n 1 68 GLU n 1 69 THR n 1 70 ILE n 1 71 ASP n 1 72 ASP n 1 73 ALA n 1 74 ILE n 1 75 THR n 1 76 GLU n 1 77 LEU n 1 78 LEU n 1 79 ALA n 1 80 GLN n 1 81 GLY n 1 82 GLU n 1 83 ILE n 1 84 TYR n 1 85 GLU n 1 86 PRO n 1 87 GLU n 1 88 THR n 1 89 GLY n 1 90 TYR n 1 91 TYR n 1 92 LYS n 1 93 LEU n 1 94 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 94 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PAB2165 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus abyssi GE5' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272844 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant Star _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 175 175 GLY GLY A . n A 1 2 THR 2 176 176 THR THR A . n A 1 3 GLY 3 177 177 GLY GLY A . n A 1 4 GLY 4 178 178 GLY GLY A . n A 1 5 ILE 5 179 179 ILE ILE A . n A 1 6 MET 6 180 180 MET MET A . n A 1 7 MET 7 181 181 MET MET A . n A 1 8 GLU 8 182 182 GLU GLU A . n A 1 9 GLU 9 183 183 GLU GLU A . n A 1 10 ARG 10 184 184 ARG ARG A . n A 1 11 SER 11 185 185 SER SER A . n A 1 12 ILE 12 186 186 ILE ILE A . n A 1 13 GLU 13 187 187 GLU GLU A . n A 1 14 GLU 14 188 188 GLU GLU A . n A 1 15 PRO 15 189 189 PRO PRO A . n A 1 16 MET 16 190 190 MET MET A . n A 1 17 GLU 17 191 191 GLU GLU A . n A 1 18 GLU 18 192 192 GLU GLU A . n A 1 19 LEU 19 193 193 LEU LEU A . n A 1 20 LEU 20 194 194 LEU LEU A . n A 1 21 GLU 21 195 195 GLU GLU A . n A 1 22 GLU 22 196 196 GLU GLU A . n A 1 23 GLU 23 197 197 GLU GLU A . n A 1 24 ILE 24 198 198 ILE ILE A . n A 1 25 PRO 25 199 199 PRO PRO A . n A 1 26 GLU 26 200 200 GLU GLU A . n A 1 27 GLU 27 201 201 GLU GLU A . n A 1 28 LYS 28 202 202 LYS LYS A . n A 1 29 GLU 29 203 203 GLU GLU A . n A 1 30 GLU 30 204 204 GLU GLU A . n A 1 31 ASN 31 205 205 ASN ASN A . n A 1 32 GLU 32 206 206 GLU GLU A . n A 1 33 LEU 33 207 207 LEU LEU A . n A 1 34 LEU 34 208 208 LEU LEU A . n A 1 35 GLU 35 209 209 GLU GLU A . n A 1 36 LYS 36 210 210 LYS LYS A . n A 1 37 ALA 37 211 211 ALA ALA A . n A 1 38 LYS 38 212 212 LYS LYS A . n A 1 39 GLU 39 213 213 GLU GLU A . n A 1 40 ASP 40 214 214 ASP ASP A . n A 1 41 ILE 41 215 215 ILE ILE A . n A 1 42 LEU 42 216 216 LEU LEU A . n A 1 43 ASN 43 217 217 ASN ASN A . n A 1 44 ILE 44 218 218 ILE ILE A . n A 1 45 LEU 45 219 219 LEU LEU A . n A 1 46 ARG 46 220 220 ARG ARG A . n A 1 47 GLN 47 221 221 GLN GLN A . n A 1 48 LYS 48 222 222 LYS LYS A . n A 1 49 ARG 49 223 223 ARG ARG A . n A 1 50 THR 50 224 224 THR THR A . n A 1 51 ALA 51 225 225 ALA ALA A . n A 1 52 ILE 52 226 226 ILE ILE A . n A 1 53 SER 53 227 227 SER SER A . n A 1 54 ARG 54 228 228 ARG ARG A . n A 1 55 LYS 55 229 229 LYS LYS A . n A 1 56 TYR 56 230 230 TYR TYR A . n A 1 57 ILE 57 231 231 ILE ILE A . n A 1 58 LEU 58 232 232 LEU LEU A . n A 1 59 LYS 59 233 233 LYS LYS A . n A 1 60 LYS 60 234 234 LYS LYS A . n A 1 61 LEU 61 235 235 LEU LEU A . n A 1 62 GLY 62 236 236 GLY GLY A . n A 1 63 ASP 63 237 237 ASP ASP A . n A 1 64 LYS 64 238 238 LYS LYS A . n A 1 65 TYR 65 239 239 TYR TYR A . n A 1 66 ASP 66 240 240 ASP ASP A . n A 1 67 GLU 67 241 241 GLU GLU A . n A 1 68 GLU 68 242 242 GLU GLU A . n A 1 69 THR 69 243 243 THR THR A . n A 1 70 ILE 70 244 244 ILE ILE A . n A 1 71 ASP 71 245 245 ASP ASP A . n A 1 72 ASP 72 246 246 ASP ASP A . n A 1 73 ALA 73 247 247 ALA ALA A . n A 1 74 ILE 74 248 248 ILE ILE A . n A 1 75 THR 75 249 249 THR THR A . n A 1 76 GLU 76 250 250 GLU GLU A . n A 1 77 LEU 77 251 251 LEU LEU A . n A 1 78 LEU 78 252 252 LEU LEU A . n A 1 79 ALA 79 253 253 ALA ALA A . n A 1 80 GLN 80 254 254 GLN GLN A . n A 1 81 GLY 81 255 255 GLY GLY A . n A 1 82 GLU 82 256 256 GLU GLU A . n A 1 83 ILE 83 257 257 ILE ILE A . n A 1 84 TYR 84 258 258 TYR TYR A . n A 1 85 GLU 85 259 259 GLU GLU A . n A 1 86 PRO 86 260 260 PRO PRO A . n A 1 87 GLU 87 261 261 GLU GLU A . n A 1 88 THR 88 262 262 THR THR A . n A 1 89 GLY 89 263 263 GLY GLY A . n A 1 90 TYR 90 264 264 TYR TYR A . n A 1 91 TYR 91 265 265 TYR TYR A . n A 1 92 LYS 92 266 266 LYS LYS A . n A 1 93 LEU 93 267 267 LEU LEU A . n A 1 94 LEU 94 268 268 LEU LEU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9F27 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9F27 _struct.title 'Solution structure of the Pyrococcus abyssi Rpa2 winged-helix domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9F27 _struct_keywords.text 'Winged-helix domain, Polymerase PolD interaction, Primase PriSL interaction, Disordered linker, REPLICATION' _struct_keywords.pdbx_keywords REPLICATION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9V1Z1_PYRAB _struct_ref.pdbx_db_accession Q9V1Z1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GIMMEERSIEEPMEELLEEEIPEEKEENELLEKAKEDILNILRQKRTAISRKYILKKLGDKYDEETIDDAITELLAQGEI YEPETGYYKLL ; _struct_ref.pdbx_align_begin 182 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9F27 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9V1Z1 _struct_ref_seq.db_align_beg 182 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 272 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 178 _struct_ref_seq.pdbx_auth_seq_align_end 268 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9F27 GLY A 1 ? UNP Q9V1Z1 ? ? 'expression tag' 175 1 1 9F27 THR A 2 ? UNP Q9V1Z1 ? ? 'expression tag' 176 2 1 9F27 GLY A 3 ? UNP Q9V1Z1 ? ? 'expression tag' 177 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR relaxation study' _pdbx_struct_assembly_auth_evidence.details 'NMR self-diffusion and 15N relaxation indicate a monomer' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 31 ? ARG A 49 ? ASN A 205 ARG A 223 1 ? 19 HELX_P HELX_P2 AA2 ARG A 54 ? LEU A 61 ? ARG A 228 LEU A 235 1 ? 8 HELX_P HELX_P3 AA3 GLY A 62 ? LYS A 64 ? GLY A 236 LYS A 238 5 ? 3 HELX_P HELX_P4 AA4 ASP A 66 ? GLN A 80 ? ASP A 240 GLN A 254 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 52 ? SER A 53 ? ILE A 226 SER A 227 AA1 2 TYR A 90 ? LEU A 93 ? TYR A 264 LEU A 267 AA1 3 ILE A 83 ? GLU A 87 ? ILE A 257 GLU A 261 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 52 ? N ILE A 226 O TYR A 91 ? O TYR A 265 AA1 2 3 O LYS A 92 ? O LYS A 266 N TYR A 84 ? N TYR A 258 # _pdbx_entry_details.entry_id 9F27 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 4 _pdbx_validate_close_contact.auth_atom_id_1 HZ2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 212 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 250 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 181 ? ? -97.94 -159.97 2 1 GLU A 195 ? ? -82.62 -71.01 3 1 GLU A 196 ? ? -136.80 -69.38 4 1 GLU A 197 ? ? 54.19 81.07 5 1 GLU A 201 ? ? -113.70 68.51 6 2 MET A 180 ? ? 74.26 -44.29 7 2 PRO A 199 ? ? -71.85 47.28 8 2 LYS A 202 ? ? -101.46 41.71 9 2 GLU A 203 ? ? 65.83 116.03 10 3 THR A 176 ? ? -78.10 -70.90 11 3 SER A 185 ? ? 49.36 100.26 12 3 GLU A 187 ? ? -144.45 -13.31 13 3 MET A 190 ? ? -98.22 -76.22 14 3 GLU A 191 ? ? 57.63 -170.06 15 4 THR A 176 ? ? -101.30 -61.62 16 4 MET A 180 ? ? -99.60 -62.72 17 4 MET A 181 ? ? 56.52 74.93 18 4 PRO A 189 ? ? -67.30 82.38 19 4 LEU A 193 ? ? 67.30 167.62 20 4 GLU A 204 ? ? -102.11 53.50 21 5 ILE A 179 ? ? 68.65 -71.72 22 5 MET A 190 ? ? -164.83 57.55 23 5 GLU A 195 ? ? -140.31 30.00 24 6 GLU A 187 ? ? 51.59 76.93 25 6 GLU A 196 ? ? -146.07 52.40 26 6 GLU A 201 ? ? 63.12 61.69 27 7 ILE A 179 ? ? -102.40 -65.31 28 7 PRO A 199 ? ? -68.85 57.44 29 8 THR A 176 ? ? -116.67 77.94 30 8 GLU A 187 ? ? -164.58 -68.25 31 8 GLU A 188 ? ? 52.63 85.99 32 8 PRO A 189 ? ? -69.91 80.26 33 8 GLU A 192 ? ? -108.41 41.51 34 8 GLU A 197 ? ? 69.89 120.83 35 8 GLU A 201 ? ? 47.94 72.79 36 9 SER A 185 ? ? 69.76 121.70 37 9 GLU A 187 ? ? -91.61 35.08 38 9 PRO A 189 ? ? -82.95 40.83 39 9 MET A 190 ? ? 59.29 78.13 40 9 LEU A 193 ? ? -92.01 39.38 41 9 LEU A 194 ? ? 60.91 89.57 42 9 GLU A 204 ? ? 54.01 81.88 43 10 THR A 176 ? ? 65.05 96.94 44 10 ILE A 179 ? ? -95.32 -76.20 45 10 GLU A 183 ? ? 167.02 109.61 46 10 LYS A 202 ? ? 60.94 79.73 # _pdbx_nmr_ensemble.entry_id 9F27 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9F27 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '300 uM [U-98% 13C; U-98% 15N] RPA2WH, 20 mM MES, 150 mM NaCl, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label 1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 RPA2WH 300 ? uM '[U-98% 13C; U-98% 15N]' 1 MES 20 ? mM 'natural abundance' 1 NaCl 150 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308.15 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 170 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '3D HNCACB' 1 isotropic 4 1 1 '3D HNCA' 1 isotropic 5 1 1 '3D HNCO' 1 isotropic 8 1 1 '3D HN(CO)CA' 1 isotropic 7 1 1 '3D C(CO)NH' 1 isotropic 6 1 1 '3D H(CCO)NH' 1 isotropic 10 1 1 '3D HCCH-TOCSY' 1 isotropic 9 1 1 '3D HBHA(CO)NH' 1 isotropic 11 1 1 '3D HBHAN' 1 isotropic 14 1 1 '3D 1H-15N NOESY' 1 isotropic 13 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 15 1 1 '3D 1H-15N TOCSY' 1 isotropic 16 1 1 '2D CB(CGCD)HD' 1 isotropic 17 1 1 '2D CB(CGCDCE)HE' 1 isotropic # _pdbx_nmr_refine.entry_id 9F27 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;Structures are calculated using a log-harmonic potential with a total of 1106 restraints: 954 distances, 32 hydrogen bonds and 120 backbone dihedral angles ; _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 5 collection TopSpin 4.1.3 'Bruker Biospin' 6 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 1 'chemical shift assignment' 'CcpNmr Analysis' 2.5.2 CCPN 7 'peak picking' 'CcpNmr Analysis' ? CCPN 2 'structure calculation' CNS 1.2.1 'Brunger, Adams, Clore, Gros, Nilges and Read' 8 'chemical shift calculation' ARIA 2.3.2 ;Linge, O'Donoghue and Nilges ; 3 refinement CNS 1.2.1 'Brunger, Adams, Clore, Gros, Nilges and Read' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PRO N N N N 212 PRO CA C N S 213 PRO C C N N 214 PRO O O N N 215 PRO CB C N N 216 PRO CG C N N 217 PRO CD C N N 218 PRO OXT O N N 219 PRO H H N N 220 PRO HA H N N 221 PRO HB2 H N N 222 PRO HB3 H N N 223 PRO HG2 H N N 224 PRO HG3 H N N 225 PRO HD2 H N N 226 PRO HD3 H N N 227 PRO HXT H N N 228 SER N N N N 229 SER CA C N S 230 SER C C N N 231 SER O O N N 232 SER CB C N N 233 SER OG O N N 234 SER OXT O N N 235 SER H H N N 236 SER H2 H N N 237 SER HA H N N 238 SER HB2 H N N 239 SER HB3 H N N 240 SER HG H N N 241 SER HXT H N N 242 THR N N N N 243 THR CA C N S 244 THR C C N N 245 THR O O N N 246 THR CB C N R 247 THR OG1 O N N 248 THR CG2 C N N 249 THR OXT O N N 250 THR H H N N 251 THR H2 H N N 252 THR HA H N N 253 THR HB H N N 254 THR HG1 H N N 255 THR HG21 H N N 256 THR HG22 H N N 257 THR HG23 H N N 258 THR HXT H N N 259 TYR N N N N 260 TYR CA C N S 261 TYR C C N N 262 TYR O O N N 263 TYR CB C N N 264 TYR CG C Y N 265 TYR CD1 C Y N 266 TYR CD2 C Y N 267 TYR CE1 C Y N 268 TYR CE2 C Y N 269 TYR CZ C Y N 270 TYR OH O N N 271 TYR OXT O N N 272 TYR H H N N 273 TYR H2 H N N 274 TYR HA H N N 275 TYR HB2 H N N 276 TYR HB3 H N N 277 TYR HD1 H N N 278 TYR HD2 H N N 279 TYR HE1 H N N 280 TYR HE2 H N N 281 TYR HH H N N 282 TYR HXT H N N 283 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PRO N CA sing N N 201 PRO N CD sing N N 202 PRO N H sing N N 203 PRO CA C sing N N 204 PRO CA CB sing N N 205 PRO CA HA sing N N 206 PRO C O doub N N 207 PRO C OXT sing N N 208 PRO CB CG sing N N 209 PRO CB HB2 sing N N 210 PRO CB HB3 sing N N 211 PRO CG CD sing N N 212 PRO CG HG2 sing N N 213 PRO CG HG3 sing N N 214 PRO CD HD2 sing N N 215 PRO CD HD3 sing N N 216 PRO OXT HXT sing N N 217 SER N CA sing N N 218 SER N H sing N N 219 SER N H2 sing N N 220 SER CA C sing N N 221 SER CA CB sing N N 222 SER CA HA sing N N 223 SER C O doub N N 224 SER C OXT sing N N 225 SER CB OG sing N N 226 SER CB HB2 sing N N 227 SER CB HB3 sing N N 228 SER OG HG sing N N 229 SER OXT HXT sing N N 230 THR N CA sing N N 231 THR N H sing N N 232 THR N H2 sing N N 233 THR CA C sing N N 234 THR CA CB sing N N 235 THR CA HA sing N N 236 THR C O doub N N 237 THR C OXT sing N N 238 THR CB OG1 sing N N 239 THR CB CG2 sing N N 240 THR CB HB sing N N 241 THR OG1 HG1 sing N N 242 THR CG2 HG21 sing N N 243 THR CG2 HG22 sing N N 244 THR CG2 HG23 sing N N 245 THR OXT HXT sing N N 246 TYR N CA sing N N 247 TYR N H sing N N 248 TYR N H2 sing N N 249 TYR CA C sing N N 250 TYR CA CB sing N N 251 TYR CA HA sing N N 252 TYR C O doub N N 253 TYR C OXT sing N N 254 TYR CB CG sing N N 255 TYR CB HB2 sing N N 256 TYR CB HB3 sing N N 257 TYR CG CD1 doub Y N 258 TYR CG CD2 sing Y N 259 TYR CD1 CE1 sing Y N 260 TYR CD1 HD1 sing N N 261 TYR CD2 CE2 doub Y N 262 TYR CD2 HD2 sing N N 263 TYR CE1 CZ doub Y N 264 TYR CE1 HE1 sing N N 265 TYR CE2 CZ sing Y N 266 TYR CE2 HE2 sing N N 267 TYR CZ OH sing N N 268 TYR OH HH sing N N 269 TYR OXT HXT sing N N 270 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE NEO' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details 'Equipped with a cryogenically cooled TCI probe' # _atom_sites.entry_id 9F27 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #