data_9F32 # _entry.id 9F32 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9F32 pdb_00009f32 10.2210/pdb9f32/pdb WWPDB D_1292137668 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-01-08 ? 2 'Structure model' 1 1 2025-02-26 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.year' 3 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9F32 _pdbx_database_status.recvd_initial_deposition_date 2024-04-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 knapp@pharmchem.uni-frankfurt.de Stefan Knapp ? 'principal investigator/group leader' 0000-0001-5995-6494 3 matthias.gehringer@uni-tuebingen.de Matthias Gehringer ? 'principal investigator/group leader' 0000-0003-0163-3419 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, G.Q.' 1 0000-0003-2896-3928 'Seidler, N.' 2 0009-0007-4405-2397 'Gehringer, M.' 3 0000-0003-0163-3419 'Knapp, S.' 4 0000-0001-5995-6494 'Structural Genomics Consortium (SGC)' 5 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? GE ? ? primary Angew.Chem.Int.Ed.Engl. ACIEAY 0179 1521-3773 ? ? 64 ? e202419736 e202419736 ;Probing the Protein Kinases' Cysteinome by Covalent Fragments. ; 2025 ? 10.1002/anie.202419736 39716901 ? ? ? ? ? ? ? ? ? GE ? ? 1 Angew.Chem.Int.Ed.Engl. ACIEAY 0179 1521-3773 ? ? 57 ? 4372 4385 'The Cysteinome of Protein Kinases as a Target in Drug Development.' 2018 ? 10.1002/anie.201707875 28994500 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, G.' 1 ? primary 'Seidler, N.J.' 2 0009-0007-4405-2397 primary 'Rohm, S.' 3 0000-0003-3999-712X primary 'Pan, Y.' 4 ? primary 'Liang, X.J.' 5 ? primary 'Haarer, L.' 6 ? primary 'Berger, B.T.' 7 0000-0002-3314-2617 primary 'Sivashanmugam, S.A.' 8 ? primary 'Wydra, V.R.' 9 0009-0004-3295-0526 primary 'Forster, M.' 10 ? primary 'Laufer, S.A.' 11 0000-0001-6952-1486 primary 'Chaikuad, A.' 12 0000-0003-1120-2209 primary 'Gehringer, M.' 13 0000-0003-0163-3419 primary 'Knapp, S.' 14 0000-0001-5995-6494 1 'Chaikuad, A.' 15 ? 1 'Koch, P.' 16 0000-0003-4620-4650 1 'Laufer, S.A.' 17 ? 1 'Knapp, S.' 18 0000-0001-5995-6494 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Serine/threonine-protein kinase ULK1' 32242.316 1 2.7.11.1 ? ? ? 2 non-polymer syn 'N-[4-(1H-indazol-5-yl)phenyl]propanamide' 265.310 1 ? ? ? ? 3 water nat water 18.015 40 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Autophagy-related protein 1 homolog,ATG1,hATG1,Unc-51-like kinase 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVAL YDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNS IRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKT LVPTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVAL YDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNS IRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKT LVPTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-[4-(1H-indazol-5-yl)phenyl]propanamide' A1H9M 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLU n 1 5 PRO n 1 6 GLY n 1 7 ARG n 1 8 GLY n 1 9 GLY n 1 10 THR n 1 11 GLU n 1 12 THR n 1 13 VAL n 1 14 GLY n 1 15 LYS n 1 16 PHE n 1 17 GLU n 1 18 PHE n 1 19 SER n 1 20 ARG n 1 21 LYS n 1 22 ASP n 1 23 LEU n 1 24 ILE n 1 25 GLY n 1 26 HIS n 1 27 GLY n 1 28 ALA n 1 29 PHE n 1 30 ALA n 1 31 VAL n 1 32 VAL n 1 33 PHE n 1 34 LYS n 1 35 GLY n 1 36 ARG n 1 37 HIS n 1 38 ARG n 1 39 GLU n 1 40 LYS n 1 41 HIS n 1 42 ASP n 1 43 LEU n 1 44 GLU n 1 45 VAL n 1 46 ALA n 1 47 VAL n 1 48 LYS n 1 49 CYS n 1 50 ILE n 1 51 ASN n 1 52 LYS n 1 53 LYS n 1 54 ASN n 1 55 LEU n 1 56 ALA n 1 57 LYS n 1 58 SER n 1 59 GLN n 1 60 THR n 1 61 LEU n 1 62 LEU n 1 63 GLY n 1 64 LYS n 1 65 GLU n 1 66 ILE n 1 67 LYS n 1 68 ILE n 1 69 LEU n 1 70 LYS n 1 71 GLU n 1 72 LEU n 1 73 LYS n 1 74 HIS n 1 75 GLU n 1 76 ASN n 1 77 ILE n 1 78 VAL n 1 79 ALA n 1 80 LEU n 1 81 TYR n 1 82 ASP n 1 83 PHE n 1 84 GLN n 1 85 GLU n 1 86 MET n 1 87 ALA n 1 88 ASN n 1 89 SER n 1 90 VAL n 1 91 TYR n 1 92 LEU n 1 93 VAL n 1 94 MET n 1 95 GLU n 1 96 TYR n 1 97 CYS n 1 98 ASN n 1 99 GLY n 1 100 GLY n 1 101 ASP n 1 102 LEU n 1 103 ALA n 1 104 ASP n 1 105 TYR n 1 106 LEU n 1 107 HIS n 1 108 ALA n 1 109 MET n 1 110 ARG n 1 111 THR n 1 112 LEU n 1 113 SER n 1 114 GLU n 1 115 ASP n 1 116 THR n 1 117 ILE n 1 118 ARG n 1 119 LEU n 1 120 PHE n 1 121 LEU n 1 122 GLN n 1 123 GLN n 1 124 ILE n 1 125 ALA n 1 126 GLY n 1 127 ALA n 1 128 MET n 1 129 ARG n 1 130 LEU n 1 131 LEU n 1 132 HIS n 1 133 SER n 1 134 LYS n 1 135 GLY n 1 136 ILE n 1 137 ILE n 1 138 HIS n 1 139 ARG n 1 140 ASP n 1 141 LEU n 1 142 LYS n 1 143 PRO n 1 144 GLN n 1 145 ASN n 1 146 ILE n 1 147 LEU n 1 148 LEU n 1 149 SER n 1 150 ASN n 1 151 PRO n 1 152 ALA n 1 153 GLY n 1 154 ARG n 1 155 ARG n 1 156 ALA n 1 157 ASN n 1 158 PRO n 1 159 ASN n 1 160 SER n 1 161 ILE n 1 162 ARG n 1 163 VAL n 1 164 LYS n 1 165 ILE n 1 166 ALA n 1 167 ASP n 1 168 PHE n 1 169 GLY n 1 170 PHE n 1 171 ALA n 1 172 ARG n 1 173 TYR n 1 174 LEU n 1 175 GLN n 1 176 SER n 1 177 ASN n 1 178 MET n 1 179 MET n 1 180 ALA n 1 181 ALA n 1 182 THR n 1 183 LEU n 1 184 CYS n 1 185 GLY n 1 186 SER n 1 187 PRO n 1 188 MET n 1 189 TYR n 1 190 MET n 1 191 ALA n 1 192 PRO n 1 193 GLU n 1 194 VAL n 1 195 ILE n 1 196 MET n 1 197 SER n 1 198 GLN n 1 199 HIS n 1 200 TYR n 1 201 ASP n 1 202 GLY n 1 203 LYS n 1 204 ALA n 1 205 ASP n 1 206 LEU n 1 207 TRP n 1 208 SER n 1 209 ILE n 1 210 GLY n 1 211 THR n 1 212 ILE n 1 213 VAL n 1 214 TYR n 1 215 GLN n 1 216 CYS n 1 217 LEU n 1 218 THR n 1 219 GLY n 1 220 LYS n 1 221 ALA n 1 222 PRO n 1 223 PHE n 1 224 GLN n 1 225 ALA n 1 226 SER n 1 227 SER n 1 228 PRO n 1 229 GLN n 1 230 ASP n 1 231 LEU n 1 232 ARG n 1 233 LEU n 1 234 PHE n 1 235 TYR n 1 236 GLU n 1 237 LYS n 1 238 ASN n 1 239 LYS n 1 240 THR n 1 241 LEU n 1 242 VAL n 1 243 PRO n 1 244 THR n 1 245 ILE n 1 246 PRO n 1 247 ARG n 1 248 GLU n 1 249 THR n 1 250 SER n 1 251 ALA n 1 252 PRO n 1 253 LEU n 1 254 ARG n 1 255 GLN n 1 256 LEU n 1 257 LEU n 1 258 LEU n 1 259 ALA n 1 260 LEU n 1 261 LEU n 1 262 GLN n 1 263 ARG n 1 264 ASN n 1 265 HIS n 1 266 LYS n 1 267 ASP n 1 268 ARG n 1 269 MET n 1 270 ASP n 1 271 PHE n 1 272 ASP n 1 273 GLU n 1 274 PHE n 1 275 PHE n 1 276 HIS n 1 277 HIS n 1 278 PRO n 1 279 PHE n 1 280 LEU n 1 281 ASP n 1 282 ALA n 1 283 SER n 1 284 PRO n 1 285 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 285 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ULK1, KIAA0722' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1H9M non-polymer . 'N-[4-(1H-indazol-5-yl)phenyl]propanamide' 'N-[4-(1H-indazol-5-yl)phenyl]prop-2-enamide (covalently bound)' 'C16 H15 N3 O' 265.310 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 GLU 4 2 ? ? ? A . n A 1 5 PRO 5 3 ? ? ? A . n A 1 6 GLY 6 4 ? ? ? A . n A 1 7 ARG 7 5 ? ? ? A . n A 1 8 GLY 8 6 ? ? ? A . n A 1 9 GLY 9 7 ? ? ? A . n A 1 10 THR 10 8 8 THR THR A . n A 1 11 GLU 11 9 9 GLU GLU A . n A 1 12 THR 12 10 10 THR THR A . n A 1 13 VAL 13 11 11 VAL VAL A . n A 1 14 GLY 14 12 12 GLY GLY A . n A 1 15 LYS 15 13 13 LYS LYS A . n A 1 16 PHE 16 14 14 PHE PHE A . n A 1 17 GLU 17 15 15 GLU GLU A . n A 1 18 PHE 18 16 16 PHE PHE A . n A 1 19 SER 19 17 17 SER SER A . n A 1 20 ARG 20 18 18 ARG ARG A . n A 1 21 LYS 21 19 19 LYS LYS A . n A 1 22 ASP 22 20 20 ASP ASP A . n A 1 23 LEU 23 21 21 LEU LEU A . n A 1 24 ILE 24 22 22 ILE ILE A . n A 1 25 GLY 25 23 23 GLY GLY A . n A 1 26 HIS 26 24 24 HIS HIS A . n A 1 27 GLY 27 25 25 GLY GLY A . n A 1 28 ALA 28 26 26 ALA ALA A . n A 1 29 PHE 29 27 27 PHE PHE A . n A 1 30 ALA 30 28 28 ALA ALA A . n A 1 31 VAL 31 29 29 VAL VAL A . n A 1 32 VAL 32 30 30 VAL VAL A . n A 1 33 PHE 33 31 31 PHE PHE A . n A 1 34 LYS 34 32 32 LYS LYS A . n A 1 35 GLY 35 33 33 GLY GLY A . n A 1 36 ARG 36 34 34 ARG ARG A . n A 1 37 HIS 37 35 35 HIS HIS A . n A 1 38 ARG 38 36 36 ARG ARG A . n A 1 39 GLU 39 37 37 GLU GLU A . n A 1 40 LYS 40 38 38 LYS LYS A . n A 1 41 HIS 41 39 39 HIS HIS A . n A 1 42 ASP 42 40 40 ASP ASP A . n A 1 43 LEU 43 41 41 LEU LEU A . n A 1 44 GLU 44 42 42 GLU GLU A . n A 1 45 VAL 45 43 43 VAL VAL A . n A 1 46 ALA 46 44 44 ALA ALA A . n A 1 47 VAL 47 45 45 VAL VAL A . n A 1 48 LYS 48 46 46 LYS LYS A . n A 1 49 CYS 49 47 47 CYS CYS A . n A 1 50 ILE 50 48 48 ILE ILE A . n A 1 51 ASN 51 49 49 ASN ASN A . n A 1 52 LYS 52 50 50 LYS LYS A . n A 1 53 LYS 53 51 51 LYS LYS A . n A 1 54 ASN 54 52 ? ? ? A . n A 1 55 LEU 55 53 ? ? ? A . n A 1 56 ALA 56 54 ? ? ? A . n A 1 57 LYS 57 55 ? ? ? A . n A 1 58 SER 58 56 ? ? ? A . n A 1 59 GLN 59 57 ? ? ? A . n A 1 60 THR 60 58 ? ? ? A . n A 1 61 LEU 61 59 ? ? ? A . n A 1 62 LEU 62 60 ? ? ? A . n A 1 63 GLY 63 61 ? ? ? A . n A 1 64 LYS 64 62 ? ? ? A . n A 1 65 GLU 65 63 ? ? ? A . n A 1 66 ILE 66 64 ? ? ? A . n A 1 67 LYS 67 65 65 LYS LYS A . n A 1 68 ILE 68 66 66 ILE ILE A . n A 1 69 LEU 69 67 67 LEU LEU A . n A 1 70 LYS 70 68 68 LYS LYS A . n A 1 71 GLU 71 69 69 GLU GLU A . n A 1 72 LEU 72 70 70 LEU LEU A . n A 1 73 LYS 73 71 71 LYS LYS A . n A 1 74 HIS 74 72 72 HIS HIS A . n A 1 75 GLU 75 73 73 GLU GLU A . n A 1 76 ASN 76 74 74 ASN ASN A . n A 1 77 ILE 77 75 75 ILE ILE A . n A 1 78 VAL 78 76 76 VAL VAL A . n A 1 79 ALA 79 77 77 ALA ALA A . n A 1 80 LEU 80 78 78 LEU LEU A . n A 1 81 TYR 81 79 79 TYR TYR A . n A 1 82 ASP 82 80 80 ASP ASP A . n A 1 83 PHE 83 81 81 PHE PHE A . n A 1 84 GLN 84 82 82 GLN GLN A . n A 1 85 GLU 85 83 83 GLU GLU A . n A 1 86 MET 86 84 84 MET MET A . n A 1 87 ALA 87 85 85 ALA ALA A . n A 1 88 ASN 88 86 86 ASN ASN A . n A 1 89 SER 89 87 87 SER SER A . n A 1 90 VAL 90 88 88 VAL VAL A . n A 1 91 TYR 91 89 89 TYR TYR A . n A 1 92 LEU 92 90 90 LEU LEU A . n A 1 93 VAL 93 91 91 VAL VAL A . n A 1 94 MET 94 92 92 MET MET A . n A 1 95 GLU 95 93 93 GLU GLU A . n A 1 96 TYR 96 94 94 TYR TYR A . n A 1 97 CYS 97 95 95 CYS CYS A . n A 1 98 ASN 98 96 96 ASN ASN A . n A 1 99 GLY 99 97 97 GLY GLY A . n A 1 100 GLY 100 98 98 GLY GLY A . n A 1 101 ASP 101 99 99 ASP ASP A . n A 1 102 LEU 102 100 100 LEU LEU A . n A 1 103 ALA 103 101 101 ALA ALA A . n A 1 104 ASP 104 102 102 ASP ASP A . n A 1 105 TYR 105 103 103 TYR TYR A . n A 1 106 LEU 106 104 104 LEU LEU A . n A 1 107 HIS 107 105 105 HIS HIS A . n A 1 108 ALA 108 106 106 ALA ALA A . n A 1 109 MET 109 107 107 MET MET A . n A 1 110 ARG 110 108 108 ARG ARG A . n A 1 111 THR 111 109 109 THR THR A . n A 1 112 LEU 112 110 110 LEU LEU A . n A 1 113 SER 113 111 111 SER SER A . n A 1 114 GLU 114 112 112 GLU GLU A . n A 1 115 ASP 115 113 113 ASP ASP A . n A 1 116 THR 116 114 114 THR THR A . n A 1 117 ILE 117 115 115 ILE ILE A . n A 1 118 ARG 118 116 116 ARG ARG A . n A 1 119 LEU 119 117 117 LEU LEU A . n A 1 120 PHE 120 118 118 PHE PHE A . n A 1 121 LEU 121 119 119 LEU LEU A . n A 1 122 GLN 122 120 120 GLN GLN A . n A 1 123 GLN 123 121 121 GLN GLN A . n A 1 124 ILE 124 122 122 ILE ILE A . n A 1 125 ALA 125 123 123 ALA ALA A . n A 1 126 GLY 126 124 124 GLY GLY A . n A 1 127 ALA 127 125 125 ALA ALA A . n A 1 128 MET 128 126 126 MET MET A . n A 1 129 ARG 129 127 127 ARG ARG A . n A 1 130 LEU 130 128 128 LEU LEU A . n A 1 131 LEU 131 129 129 LEU LEU A . n A 1 132 HIS 132 130 130 HIS HIS A . n A 1 133 SER 133 131 131 SER SER A . n A 1 134 LYS 134 132 132 LYS LYS A . n A 1 135 GLY 135 133 133 GLY GLY A . n A 1 136 ILE 136 134 134 ILE ILE A . n A 1 137 ILE 137 135 135 ILE ILE A . n A 1 138 HIS 138 136 136 HIS HIS A . n A 1 139 ARG 139 137 137 ARG ARG A . n A 1 140 ASP 140 138 138 ASP ASP A . n A 1 141 LEU 141 139 139 LEU LEU A . n A 1 142 LYS 142 140 140 LYS LYS A . n A 1 143 PRO 143 141 141 PRO PRO A . n A 1 144 GLN 144 142 142 GLN GLN A . n A 1 145 ASN 145 143 143 ASN ASN A . n A 1 146 ILE 146 144 144 ILE ILE A . n A 1 147 LEU 147 145 145 LEU LEU A . n A 1 148 LEU 148 146 146 LEU LEU A . n A 1 149 SER 149 147 147 SER SER A . n A 1 150 ASN 150 148 148 ASN ASN A . n A 1 151 PRO 151 149 149 PRO PRO A . n A 1 152 ALA 152 150 ? ? ? A . n A 1 153 GLY 153 151 ? ? ? A . n A 1 154 ARG 154 152 ? ? ? A . n A 1 155 ARG 155 153 ? ? ? A . n A 1 156 ALA 156 154 ? ? ? A . n A 1 157 ASN 157 155 ? ? ? A . n A 1 158 PRO 158 156 ? ? ? A . n A 1 159 ASN 159 157 157 ASN ASN A . n A 1 160 SER 160 158 158 SER SER A . n A 1 161 ILE 161 159 159 ILE ILE A . n A 1 162 ARG 162 160 160 ARG ARG A . n A 1 163 VAL 163 161 161 VAL VAL A . n A 1 164 LYS 164 162 162 LYS LYS A . n A 1 165 ILE 165 163 163 ILE ILE A . n A 1 166 ALA 166 164 164 ALA ALA A . n A 1 167 ASP 167 165 165 ASP ASP A . n A 1 168 PHE 168 166 166 PHE PHE A . n A 1 169 GLY 169 167 ? ? ? A . n A 1 170 PHE 170 168 ? ? ? A . n A 1 171 ALA 171 169 ? ? ? A . n A 1 172 ARG 172 170 ? ? ? A . n A 1 173 TYR 173 171 ? ? ? A . n A 1 174 LEU 174 172 ? ? ? A . n A 1 175 GLN 175 173 ? ? ? A . n A 1 176 SER 176 174 ? ? ? A . n A 1 177 ASN 177 175 ? ? ? A . n A 1 178 MET 178 176 ? ? ? A . n A 1 179 MET 179 177 ? ? ? A . n A 1 180 ALA 180 178 ? ? ? A . n A 1 181 ALA 181 179 ? ? ? A . n A 1 182 THR 182 180 ? ? ? A . n A 1 183 LEU 183 181 ? ? ? A . n A 1 184 CYS 184 182 182 CYS CYS A . n A 1 185 GLY 185 183 183 GLY GLY A . n A 1 186 SER 186 184 184 SER SER A . n A 1 187 PRO 187 185 185 PRO PRO A . n A 1 188 MET 188 186 186 MET MET A . n A 1 189 TYR 189 187 187 TYR TYR A . n A 1 190 MET 190 188 188 MET MET A . n A 1 191 ALA 191 189 189 ALA ALA A . n A 1 192 PRO 192 190 190 PRO PRO A . n A 1 193 GLU 193 191 191 GLU GLU A . n A 1 194 VAL 194 192 192 VAL VAL A . n A 1 195 ILE 195 193 193 ILE ILE A . n A 1 196 MET 196 194 194 MET MET A . n A 1 197 SER 197 195 195 SER SER A . n A 1 198 GLN 198 196 196 GLN GLN A . n A 1 199 HIS 199 197 197 HIS HIS A . n A 1 200 TYR 200 198 198 TYR TYR A . n A 1 201 ASP 201 199 199 ASP ASP A . n A 1 202 GLY 202 200 200 GLY GLY A . n A 1 203 LYS 203 201 201 LYS LYS A . n A 1 204 ALA 204 202 202 ALA ALA A . n A 1 205 ASP 205 203 203 ASP ASP A . n A 1 206 LEU 206 204 204 LEU LEU A . n A 1 207 TRP 207 205 205 TRP TRP A . n A 1 208 SER 208 206 206 SER SER A . n A 1 209 ILE 209 207 207 ILE ILE A . n A 1 210 GLY 210 208 208 GLY GLY A . n A 1 211 THR 211 209 209 THR THR A . n A 1 212 ILE 212 210 210 ILE ILE A . n A 1 213 VAL 213 211 211 VAL VAL A . n A 1 214 TYR 214 212 212 TYR TYR A . n A 1 215 GLN 215 213 213 GLN GLN A . n A 1 216 CYS 216 214 214 CYS CYS A . n A 1 217 LEU 217 215 215 LEU LEU A . n A 1 218 THR 218 216 216 THR THR A . n A 1 219 GLY 219 217 217 GLY GLY A . n A 1 220 LYS 220 218 218 LYS LYS A . n A 1 221 ALA 221 219 219 ALA ALA A . n A 1 222 PRO 222 220 220 PRO PRO A . n A 1 223 PHE 223 221 221 PHE PHE A . n A 1 224 GLN 224 222 222 GLN GLN A . n A 1 225 ALA 225 223 223 ALA ALA A . n A 1 226 SER 226 224 224 SER SER A . n A 1 227 SER 227 225 225 SER SER A . n A 1 228 PRO 228 226 226 PRO PRO A . n A 1 229 GLN 229 227 227 GLN GLN A . n A 1 230 ASP 230 228 228 ASP ASP A . n A 1 231 LEU 231 229 229 LEU LEU A . n A 1 232 ARG 232 230 230 ARG ARG A . n A 1 233 LEU 233 231 231 LEU LEU A . n A 1 234 PHE 234 232 232 PHE PHE A . n A 1 235 TYR 235 233 233 TYR TYR A . n A 1 236 GLU 236 234 234 GLU GLU A . n A 1 237 LYS 237 235 235 LYS LYS A . n A 1 238 ASN 238 236 236 ASN ASN A . n A 1 239 LYS 239 237 237 LYS LYS A . n A 1 240 THR 240 238 238 THR THR A . n A 1 241 LEU 241 239 239 LEU LEU A . n A 1 242 VAL 242 240 240 VAL VAL A . n A 1 243 PRO 243 241 241 PRO PRO A . n A 1 244 THR 244 242 242 THR THR A . n A 1 245 ILE 245 243 243 ILE ILE A . n A 1 246 PRO 246 244 244 PRO PRO A . n A 1 247 ARG 247 245 245 ARG ARG A . n A 1 248 GLU 248 246 246 GLU GLU A . n A 1 249 THR 249 247 247 THR THR A . n A 1 250 SER 250 248 248 SER SER A . n A 1 251 ALA 251 249 249 ALA ALA A . n A 1 252 PRO 252 250 250 PRO PRO A . n A 1 253 LEU 253 251 251 LEU LEU A . n A 1 254 ARG 254 252 252 ARG ARG A . n A 1 255 GLN 255 253 253 GLN GLN A . n A 1 256 LEU 256 254 254 LEU LEU A . n A 1 257 LEU 257 255 255 LEU LEU A . n A 1 258 LEU 258 256 256 LEU LEU A . n A 1 259 ALA 259 257 257 ALA ALA A . n A 1 260 LEU 260 258 258 LEU LEU A . n A 1 261 LEU 261 259 259 LEU LEU A . n A 1 262 GLN 262 260 260 GLN GLN A . n A 1 263 ARG 263 261 261 ARG ARG A . n A 1 264 ASN 264 262 262 ASN ASN A . n A 1 265 HIS 265 263 263 HIS HIS A . n A 1 266 LYS 266 264 264 LYS LYS A . n A 1 267 ASP 267 265 265 ASP ASP A . n A 1 268 ARG 268 266 266 ARG ARG A . n A 1 269 MET 269 267 267 MET MET A . n A 1 270 ASP 270 268 268 ASP ASP A . n A 1 271 PHE 271 269 269 PHE PHE A . n A 1 272 ASP 272 270 270 ASP ASP A . n A 1 273 GLU 273 271 271 GLU GLU A . n A 1 274 PHE 274 272 272 PHE PHE A . n A 1 275 PHE 275 273 273 PHE PHE A . n A 1 276 HIS 276 274 274 HIS HIS A . n A 1 277 HIS 277 275 275 HIS HIS A . n A 1 278 PRO 278 276 276 PRO PRO A . n A 1 279 PHE 279 277 277 PHE PHE A . n A 1 280 LEU 280 278 278 LEU LEU A . n A 1 281 ASP 281 279 279 ASP ASP A . n A 1 282 ALA 282 280 280 ALA ALA A . n A 1 283 SER 283 281 281 SER SER A . n A 1 284 PRO 284 282 282 PRO PRO A . n A 1 285 SER 285 283 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1H9M _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1H9M _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1H9M 1 301 301 A1H9M LIG A . C 3 HOH 1 401 13 HOH HOH A . C 3 HOH 2 402 1 HOH HOH A . C 3 HOH 3 403 28 HOH HOH A . C 3 HOH 4 404 25 HOH HOH A . C 3 HOH 5 405 17 HOH HOH A . C 3 HOH 6 406 22 HOH HOH A . C 3 HOH 7 407 4 HOH HOH A . C 3 HOH 8 408 40 HOH HOH A . C 3 HOH 9 409 18 HOH HOH A . C 3 HOH 10 410 26 HOH HOH A . C 3 HOH 11 411 9 HOH HOH A . C 3 HOH 12 412 30 HOH HOH A . C 3 HOH 13 413 27 HOH HOH A . C 3 HOH 14 414 6 HOH HOH A . C 3 HOH 15 415 19 HOH HOH A . C 3 HOH 16 416 8 HOH HOH A . C 3 HOH 17 417 41 HOH HOH A . C 3 HOH 18 418 35 HOH HOH A . C 3 HOH 19 419 36 HOH HOH A . C 3 HOH 20 420 21 HOH HOH A . C 3 HOH 21 421 23 HOH HOH A . C 3 HOH 22 422 11 HOH HOH A . C 3 HOH 23 423 39 HOH HOH A . C 3 HOH 24 424 38 HOH HOH A . C 3 HOH 25 425 14 HOH HOH A . C 3 HOH 26 426 5 HOH HOH A . C 3 HOH 27 427 20 HOH HOH A . C 3 HOH 28 428 15 HOH HOH A . C 3 HOH 29 429 3 HOH HOH A . C 3 HOH 30 430 7 HOH HOH A . C 3 HOH 31 431 37 HOH HOH A . C 3 HOH 32 432 42 HOH HOH A . C 3 HOH 33 433 34 HOH HOH A . C 3 HOH 34 434 12 HOH HOH A . C 3 HOH 35 435 2 HOH HOH A . C 3 HOH 36 436 31 HOH HOH A . C 3 HOH 37 437 24 HOH HOH A . C 3 HOH 38 438 33 HOH HOH A . C 3 HOH 39 439 32 HOH HOH A . C 3 HOH 40 440 10 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 27 ? CG ? A PHE 29 CG 2 1 Y 1 A PHE 27 ? CD1 ? A PHE 29 CD1 3 1 Y 1 A PHE 27 ? CD2 ? A PHE 29 CD2 4 1 Y 1 A PHE 27 ? CE1 ? A PHE 29 CE1 5 1 Y 1 A PHE 27 ? CE2 ? A PHE 29 CE2 6 1 Y 1 A PHE 27 ? CZ ? A PHE 29 CZ 7 1 Y 1 A LYS 65 ? CG ? A LYS 67 CG 8 1 Y 1 A LYS 65 ? CD ? A LYS 67 CD 9 1 Y 1 A LYS 65 ? CE ? A LYS 67 CE 10 1 Y 1 A LYS 65 ? NZ ? A LYS 67 NZ 11 1 Y 1 A LYS 68 ? CG ? A LYS 70 CG 12 1 Y 1 A LYS 68 ? CD ? A LYS 70 CD 13 1 Y 1 A LYS 68 ? CE ? A LYS 70 CE 14 1 Y 1 A LYS 68 ? NZ ? A LYS 70 NZ 15 1 Y 1 A GLU 69 ? CG ? A GLU 71 CG 16 1 Y 1 A GLU 69 ? CD ? A GLU 71 CD 17 1 Y 1 A GLU 69 ? OE1 ? A GLU 71 OE1 18 1 Y 1 A GLU 69 ? OE2 ? A GLU 71 OE2 19 1 Y 1 A LYS 71 ? CG ? A LYS 73 CG 20 1 Y 1 A LYS 71 ? CD ? A LYS 73 CD 21 1 Y 1 A LYS 71 ? CE ? A LYS 73 CE 22 1 Y 1 A LYS 71 ? NZ ? A LYS 73 NZ 23 1 Y 1 A PHE 166 ? CG ? A PHE 168 CG 24 1 Y 1 A PHE 166 ? CD1 ? A PHE 168 CD1 25 1 Y 1 A PHE 166 ? CD2 ? A PHE 168 CD2 26 1 Y 1 A PHE 166 ? CE1 ? A PHE 168 CE1 27 1 Y 1 A PHE 166 ? CE2 ? A PHE 168 CE2 28 1 Y 1 A PHE 166 ? CZ ? A PHE 168 CZ 29 1 Y 1 A HIS 197 ? CG ? A HIS 199 CG 30 1 Y 1 A HIS 197 ? ND1 ? A HIS 199 ND1 31 1 Y 1 A HIS 197 ? CD2 ? A HIS 199 CD2 32 1 Y 1 A HIS 197 ? CE1 ? A HIS 199 CE1 33 1 Y 1 A HIS 197 ? NE2 ? A HIS 199 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9F32 _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.921 _cell.length_a_esd ? _cell.length_b 56.946 _cell.length_b_esd ? _cell.length_c 115.825 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9F32 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9F32 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.63 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% w/v PEG 10000---- 0.1M Sodium HEPES, pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-06-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00002 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00002 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9F32 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.1 _reflns.d_resolution_low 43.92 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17644 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.1 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1388 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.804 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.10 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.69 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -0.79 _refine.B_iso_max ? _refine.B_iso_mean 47.634 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.945 _refine.correlation_coeff_Fo_to_Fc_free 0.932 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9F32 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 41.10 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16717 _refine.ls_number_reflns_R_free 873 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.97 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.22305 _refine.ls_R_factor_R_free 0.25361 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22144 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.223 _refine.pdbx_overall_ESU_R_Free 0.186 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.022 _refine.overall_SU_ML 0.134 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 41.10 _refine_hist.number_atoms_solvent 40 _refine_hist.number_atoms_total 1961 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1901 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.009 0.013 1969 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 1883 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.650 1.640 2658 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.339 1.583 4328 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.949 5.000 238 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.191 21.845 103 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.300 15.000 346 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 22.248 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.074 0.200 253 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 2206 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 455 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.499 4.776 961 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.496 4.775 960 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.354 7.122 1196 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.352 7.124 1197 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.434 5.251 1008 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.431 5.252 1009 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.985 7.651 1463 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 11.211 89.448 7974 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 11.214 89.438 7963 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.100 _refine_ls_shell.d_res_low 2.155 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 62 _refine_ls_shell.number_reflns_R_work 1174 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.249 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.278 # _struct.entry_id 9F32 _struct.title 'Crystal structure of ULK1 with a covalent compound GCL 99' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9F32 _struct_keywords.text 'Kinase, Covalent, inhibitor, MAP2K6, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ULK1_HUMAN _struct_ref.pdbx_db_accession O75385 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENIVALYD FQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPAGRRANPNSIR VKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTLV PTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPS ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9F32 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 285 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O75385 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 283 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 283 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9F32 GLY A 1 ? UNP O75385 ? ? 'expression tag' -1 1 1 9F32 SER A 2 ? UNP O75385 ? ? 'expression tag' 0 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12250 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 101 ? ARG A 110 ? ASP A 99 ARG A 108 1 ? 10 HELX_P HELX_P2 AA2 SER A 113 ? LYS A 134 ? SER A 111 LYS A 132 1 ? 22 HELX_P HELX_P3 AA3 LYS A 142 ? GLN A 144 ? LYS A 140 GLN A 142 5 ? 3 HELX_P HELX_P4 AA4 ALA A 191 ? MET A 196 ? ALA A 189 MET A 194 1 ? 6 HELX_P HELX_P5 AA5 GLY A 202 ? GLY A 219 ? GLY A 200 GLY A 217 1 ? 18 HELX_P HELX_P6 AA6 SER A 227 ? ASN A 238 ? SER A 225 ASN A 236 1 ? 12 HELX_P HELX_P7 AA7 SER A 250 ? LEU A 261 ? SER A 248 LEU A 259 1 ? 12 HELX_P HELX_P8 AA8 ASP A 270 ? HIS A 276 ? ASP A 268 HIS A 274 1 ? 7 HELX_P HELX_P9 AA9 HIS A 277 ? ALA A 282 ? HIS A 275 ALA A 280 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 184 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id A1H9M _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 182 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id A1H9M _struct_conn.ptnr2_auth_seq_id 301 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.760 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1H9M _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 184 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1H9M _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 301 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 182 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C1 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1H9M _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 11 ? VAL A 13 ? GLU A 9 VAL A 11 AA1 2 PHE A 16 ? GLY A 27 ? PHE A 14 GLY A 25 AA1 3 ALA A 30 ? HIS A 37 ? ALA A 28 HIS A 35 AA1 4 GLU A 44 ? ASN A 51 ? GLU A 42 ASN A 49 AA1 5 SER A 89 ? GLU A 95 ? SER A 87 GLU A 93 AA1 6 LEU A 80 ? GLU A 85 ? LEU A 78 GLU A 83 AA2 1 ILE A 146 ? SER A 149 ? ILE A 144 SER A 147 AA2 2 ARG A 162 ? ILE A 165 ? ARG A 160 ILE A 163 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 13 ? N VAL A 11 O PHE A 16 ? O PHE A 14 AA1 2 3 N ILE A 24 ? N ILE A 22 O VAL A 32 ? O VAL A 30 AA1 3 4 N PHE A 33 ? N PHE A 31 O VAL A 47 ? O VAL A 45 AA1 4 5 N ALA A 46 ? N ALA A 44 O MET A 94 ? O MET A 92 AA1 5 6 O VAL A 93 ? O VAL A 91 N ASP A 82 ? N ASP A 80 AA2 1 2 N LEU A 147 ? N LEU A 145 O LYS A 164 ? O LYS A 162 # _pdbx_entry_details.entry_id 9F32 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 182 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 182 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 SG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 182 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 121.07 _pdbx_validate_rmsd_angle.angle_target_value 114.20 _pdbx_validate_rmsd_angle.angle_deviation 6.87 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 20 ? ? -101.32 66.54 2 1 GLN A 82 ? ? -165.88 105.64 3 1 MET A 84 ? ? -111.32 -162.04 4 1 ARG A 108 ? ? 69.67 -58.62 5 1 ARG A 137 ? ? 89.02 -22.91 6 1 ASP A 138 ? ? -140.10 43.05 7 1 ASP A 199 ? ? -141.93 -155.95 8 1 LEU A 259 ? ? -87.26 49.79 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 0 ? A SER 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A GLU 2 ? A GLU 4 5 1 Y 1 A PRO 3 ? A PRO 5 6 1 Y 1 A GLY 4 ? A GLY 6 7 1 Y 1 A ARG 5 ? A ARG 7 8 1 Y 1 A GLY 6 ? A GLY 8 9 1 Y 1 A GLY 7 ? A GLY 9 10 1 Y 1 A ASN 52 ? A ASN 54 11 1 Y 1 A LEU 53 ? A LEU 55 12 1 Y 1 A ALA 54 ? A ALA 56 13 1 Y 1 A LYS 55 ? A LYS 57 14 1 Y 1 A SER 56 ? A SER 58 15 1 Y 1 A GLN 57 ? A GLN 59 16 1 Y 1 A THR 58 ? A THR 60 17 1 Y 1 A LEU 59 ? A LEU 61 18 1 Y 1 A LEU 60 ? A LEU 62 19 1 Y 1 A GLY 61 ? A GLY 63 20 1 Y 1 A LYS 62 ? A LYS 64 21 1 Y 1 A GLU 63 ? A GLU 65 22 1 Y 1 A ILE 64 ? A ILE 66 23 1 Y 1 A ALA 150 ? A ALA 152 24 1 Y 1 A GLY 151 ? A GLY 153 25 1 Y 1 A ARG 152 ? A ARG 154 26 1 Y 1 A ARG 153 ? A ARG 155 27 1 Y 1 A ALA 154 ? A ALA 156 28 1 Y 1 A ASN 155 ? A ASN 157 29 1 Y 1 A PRO 156 ? A PRO 158 30 1 Y 1 A GLY 167 ? A GLY 169 31 1 Y 1 A PHE 168 ? A PHE 170 32 1 Y 1 A ALA 169 ? A ALA 171 33 1 Y 1 A ARG 170 ? A ARG 172 34 1 Y 1 A TYR 171 ? A TYR 173 35 1 Y 1 A LEU 172 ? A LEU 174 36 1 Y 1 A GLN 173 ? A GLN 175 37 1 Y 1 A SER 174 ? A SER 176 38 1 Y 1 A ASN 175 ? A ASN 177 39 1 Y 1 A MET 176 ? A MET 178 40 1 Y 1 A MET 177 ? A MET 179 41 1 Y 1 A ALA 178 ? A ALA 180 42 1 Y 1 A ALA 179 ? A ALA 181 43 1 Y 1 A THR 180 ? A THR 182 44 1 Y 1 A LEU 181 ? A LEU 183 45 1 Y 1 A SER 283 ? A SER 285 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1H9M C1 C N N 1 A1H9M C2 C N N 2 A1H9M C3 C N N 3 A1H9M O1 O N N 4 A1H9M N1 N N N 5 A1H9M C4 C Y N 6 A1H9M C5 C Y N 7 A1H9M C6 C Y N 8 A1H9M C7 C Y N 9 A1H9M C8 C Y N 10 A1H9M C9 C Y N 11 A1H9M C10 C Y N 12 A1H9M C11 C Y N 13 A1H9M N2 N Y N 14 A1H9M N3 N Y N 15 A1H9M C12 C Y N 16 A1H9M C13 C Y N 17 A1H9M C14 C Y N 18 A1H9M C15 C Y N 19 A1H9M C16 C Y N 20 A1H9M H1 H N N 21 A1H9M H2 H N N 22 A1H9M H4 H N N 23 A1H9M H6 H N N 24 A1H9M H7 H N N 25 A1H9M H8 H N N 26 A1H9M H9 H N N 27 A1H9M H10 H N N 28 A1H9M H11 H N N 29 A1H9M H12 H N N 30 A1H9M H13 H N N 31 A1H9M H14 H N N 32 A1H9M H15 H N N 33 A1H9M H3 H N N 34 A1H9M H5 H N N 35 ALA N N N N 36 ALA CA C N S 37 ALA C C N N 38 ALA O O N N 39 ALA CB C N N 40 ALA OXT O N N 41 ALA H H N N 42 ALA H2 H N N 43 ALA HA H N N 44 ALA HB1 H N N 45 ALA HB2 H N N 46 ALA HB3 H N N 47 ALA HXT H N N 48 ARG N N N N 49 ARG CA C N S 50 ARG C C N N 51 ARG O O N N 52 ARG CB C N N 53 ARG CG C N N 54 ARG CD C N N 55 ARG NE N N N 56 ARG CZ C N N 57 ARG NH1 N N N 58 ARG NH2 N N N 59 ARG OXT O N N 60 ARG H H N N 61 ARG H2 H N N 62 ARG HA H N N 63 ARG HB2 H N N 64 ARG HB3 H N N 65 ARG HG2 H N N 66 ARG HG3 H N N 67 ARG HD2 H N N 68 ARG HD3 H N N 69 ARG HE H N N 70 ARG HH11 H N N 71 ARG HH12 H N N 72 ARG HH21 H N N 73 ARG HH22 H N N 74 ARG HXT H N N 75 ASN N N N N 76 ASN CA C N S 77 ASN C C N N 78 ASN O O N N 79 ASN CB C N N 80 ASN CG C N N 81 ASN OD1 O N N 82 ASN ND2 N N N 83 ASN OXT O N N 84 ASN H H N N 85 ASN H2 H N N 86 ASN HA H N N 87 ASN HB2 H N N 88 ASN HB3 H N N 89 ASN HD21 H N N 90 ASN HD22 H N N 91 ASN HXT H N N 92 ASP N N N N 93 ASP CA C N S 94 ASP C C N N 95 ASP O O N N 96 ASP CB C N N 97 ASP CG C N N 98 ASP OD1 O N N 99 ASP OD2 O N N 100 ASP OXT O N N 101 ASP H H N N 102 ASP H2 H N N 103 ASP HA H N N 104 ASP HB2 H N N 105 ASP HB3 H N N 106 ASP HD2 H N N 107 ASP HXT H N N 108 CYS N N N N 109 CYS CA C N R 110 CYS C C N N 111 CYS O O N N 112 CYS CB C N N 113 CYS SG S N N 114 CYS OXT O N N 115 CYS H H N N 116 CYS H2 H N N 117 CYS HA H N N 118 CYS HB2 H N N 119 CYS HB3 H N N 120 CYS HG H N N 121 CYS HXT H N N 122 GLN N N N N 123 GLN CA C N S 124 GLN C C N N 125 GLN O O N N 126 GLN CB C N N 127 GLN CG C N N 128 GLN CD C N N 129 GLN OE1 O N N 130 GLN NE2 N N N 131 GLN OXT O N N 132 GLN H H N N 133 GLN H2 H N N 134 GLN HA H N N 135 GLN HB2 H N N 136 GLN HB3 H N N 137 GLN HG2 H N N 138 GLN HG3 H N N 139 GLN HE21 H N N 140 GLN HE22 H N N 141 GLN HXT H N N 142 GLU N N N N 143 GLU CA C N S 144 GLU C C N N 145 GLU O O N N 146 GLU CB C N N 147 GLU CG C N N 148 GLU CD C N N 149 GLU OE1 O N N 150 GLU OE2 O N N 151 GLU OXT O N N 152 GLU H H N N 153 GLU H2 H N N 154 GLU HA H N N 155 GLU HB2 H N N 156 GLU HB3 H N N 157 GLU HG2 H N N 158 GLU HG3 H N N 159 GLU HE2 H N N 160 GLU HXT H N N 161 GLY N N N N 162 GLY CA C N N 163 GLY C C N N 164 GLY O O N N 165 GLY OXT O N N 166 GLY H H N N 167 GLY H2 H N N 168 GLY HA2 H N N 169 GLY HA3 H N N 170 GLY HXT H N N 171 HIS N N N N 172 HIS CA C N S 173 HIS C C N N 174 HIS O O N N 175 HIS CB C N N 176 HIS CG C Y N 177 HIS ND1 N Y N 178 HIS CD2 C Y N 179 HIS CE1 C Y N 180 HIS NE2 N Y N 181 HIS OXT O N N 182 HIS H H N N 183 HIS H2 H N N 184 HIS HA H N N 185 HIS HB2 H N N 186 HIS HB3 H N N 187 HIS HD1 H N N 188 HIS HD2 H N N 189 HIS HE1 H N N 190 HIS HE2 H N N 191 HIS HXT H N N 192 HOH O O N N 193 HOH H1 H N N 194 HOH H2 H N N 195 ILE N N N N 196 ILE CA C N S 197 ILE C C N N 198 ILE O O N N 199 ILE CB C N S 200 ILE CG1 C N N 201 ILE CG2 C N N 202 ILE CD1 C N N 203 ILE OXT O N N 204 ILE H H N N 205 ILE H2 H N N 206 ILE HA H N N 207 ILE HB H N N 208 ILE HG12 H N N 209 ILE HG13 H N N 210 ILE HG21 H N N 211 ILE HG22 H N N 212 ILE HG23 H N N 213 ILE HD11 H N N 214 ILE HD12 H N N 215 ILE HD13 H N N 216 ILE HXT H N N 217 LEU N N N N 218 LEU CA C N S 219 LEU C C N N 220 LEU O O N N 221 LEU CB C N N 222 LEU CG C N N 223 LEU CD1 C N N 224 LEU CD2 C N N 225 LEU OXT O N N 226 LEU H H N N 227 LEU H2 H N N 228 LEU HA H N N 229 LEU HB2 H N N 230 LEU HB3 H N N 231 LEU HG H N N 232 LEU HD11 H N N 233 LEU HD12 H N N 234 LEU HD13 H N N 235 LEU HD21 H N N 236 LEU HD22 H N N 237 LEU HD23 H N N 238 LEU HXT H N N 239 LYS N N N N 240 LYS CA C N S 241 LYS C C N N 242 LYS O O N N 243 LYS CB C N N 244 LYS CG C N N 245 LYS CD C N N 246 LYS CE C N N 247 LYS NZ N N N 248 LYS OXT O N N 249 LYS H H N N 250 LYS H2 H N N 251 LYS HA H N N 252 LYS HB2 H N N 253 LYS HB3 H N N 254 LYS HG2 H N N 255 LYS HG3 H N N 256 LYS HD2 H N N 257 LYS HD3 H N N 258 LYS HE2 H N N 259 LYS HE3 H N N 260 LYS HZ1 H N N 261 LYS HZ2 H N N 262 LYS HZ3 H N N 263 LYS HXT H N N 264 MET N N N N 265 MET CA C N S 266 MET C C N N 267 MET O O N N 268 MET CB C N N 269 MET CG C N N 270 MET SD S N N 271 MET CE C N N 272 MET OXT O N N 273 MET H H N N 274 MET H2 H N N 275 MET HA H N N 276 MET HB2 H N N 277 MET HB3 H N N 278 MET HG2 H N N 279 MET HG3 H N N 280 MET HE1 H N N 281 MET HE2 H N N 282 MET HE3 H N N 283 MET HXT H N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TRP N N N N 356 TRP CA C N S 357 TRP C C N N 358 TRP O O N N 359 TRP CB C N N 360 TRP CG C Y N 361 TRP CD1 C Y N 362 TRP CD2 C Y N 363 TRP NE1 N Y N 364 TRP CE2 C Y N 365 TRP CE3 C Y N 366 TRP CZ2 C Y N 367 TRP CZ3 C Y N 368 TRP CH2 C Y N 369 TRP OXT O N N 370 TRP H H N N 371 TRP H2 H N N 372 TRP HA H N N 373 TRP HB2 H N N 374 TRP HB3 H N N 375 TRP HD1 H N N 376 TRP HE1 H N N 377 TRP HE3 H N N 378 TRP HZ2 H N N 379 TRP HZ3 H N N 380 TRP HH2 H N N 381 TRP HXT H N N 382 TYR N N N N 383 TYR CA C N S 384 TYR C C N N 385 TYR O O N N 386 TYR CB C N N 387 TYR CG C Y N 388 TYR CD1 C Y N 389 TYR CD2 C Y N 390 TYR CE1 C Y N 391 TYR CE2 C Y N 392 TYR CZ C Y N 393 TYR OH O N N 394 TYR OXT O N N 395 TYR H H N N 396 TYR H2 H N N 397 TYR HA H N N 398 TYR HB2 H N N 399 TYR HB3 H N N 400 TYR HD1 H N N 401 TYR HD2 H N N 402 TYR HE1 H N N 403 TYR HE2 H N N 404 TYR HH H N N 405 TYR HXT H N N 406 VAL N N N N 407 VAL CA C N S 408 VAL C C N N 409 VAL O O N N 410 VAL CB C N N 411 VAL CG1 C N N 412 VAL CG2 C N N 413 VAL OXT O N N 414 VAL H H N N 415 VAL H2 H N N 416 VAL HA H N N 417 VAL HB H N N 418 VAL HG11 H N N 419 VAL HG12 H N N 420 VAL HG13 H N N 421 VAL HG21 H N N 422 VAL HG22 H N N 423 VAL HG23 H N N 424 VAL HXT H N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1H9M C1 C2 sing N N 1 A1H9M C2 C3 sing N N 2 A1H9M C3 O1 doub N N 3 A1H9M C3 N1 sing N N 4 A1H9M N1 C4 sing N N 5 A1H9M C4 C16 doub Y N 6 A1H9M C4 C5 sing Y N 7 A1H9M C16 C15 sing Y N 8 A1H9M C5 C6 doub Y N 9 A1H9M C15 C7 doub Y N 10 A1H9M C6 C7 sing Y N 11 A1H9M C7 C8 sing N N 12 A1H9M C8 C9 sing Y N 13 A1H9M C8 C14 doub Y N 14 A1H9M C9 C10 doub Y N 15 A1H9M C14 C13 sing Y N 16 A1H9M C10 C11 sing Y N 17 A1H9M C13 C11 doub Y N 18 A1H9M C13 C12 sing Y N 19 A1H9M C11 N2 sing Y N 20 A1H9M C12 N3 doub Y N 21 A1H9M N2 N3 sing Y N 22 A1H9M C1 H1 sing N N 23 A1H9M C1 H2 sing N N 24 A1H9M C2 H4 sing N N 25 A1H9M N1 H6 sing N N 26 A1H9M C5 H7 sing N N 27 A1H9M C6 H8 sing N N 28 A1H9M C9 H9 sing N N 29 A1H9M C10 H10 sing N N 30 A1H9M N2 H11 sing N N 31 A1H9M C12 H12 sing N N 32 A1H9M C14 H13 sing N N 33 A1H9M C15 H14 sing N N 34 A1H9M C16 H15 sing N N 35 A1H9M C1 H3 sing N N 36 A1H9M C2 H5 sing N N 37 ALA N CA sing N N 38 ALA N H sing N N 39 ALA N H2 sing N N 40 ALA CA C sing N N 41 ALA CA CB sing N N 42 ALA CA HA sing N N 43 ALA C O doub N N 44 ALA C OXT sing N N 45 ALA CB HB1 sing N N 46 ALA CB HB2 sing N N 47 ALA CB HB3 sing N N 48 ALA OXT HXT sing N N 49 ARG N CA sing N N 50 ARG N H sing N N 51 ARG N H2 sing N N 52 ARG CA C sing N N 53 ARG CA CB sing N N 54 ARG CA HA sing N N 55 ARG C O doub N N 56 ARG C OXT sing N N 57 ARG CB CG sing N N 58 ARG CB HB2 sing N N 59 ARG CB HB3 sing N N 60 ARG CG CD sing N N 61 ARG CG HG2 sing N N 62 ARG CG HG3 sing N N 63 ARG CD NE sing N N 64 ARG CD HD2 sing N N 65 ARG CD HD3 sing N N 66 ARG NE CZ sing N N 67 ARG NE HE sing N N 68 ARG CZ NH1 sing N N 69 ARG CZ NH2 doub N N 70 ARG NH1 HH11 sing N N 71 ARG NH1 HH12 sing N N 72 ARG NH2 HH21 sing N N 73 ARG NH2 HH22 sing N N 74 ARG OXT HXT sing N N 75 ASN N CA sing N N 76 ASN N H sing N N 77 ASN N H2 sing N N 78 ASN CA C sing N N 79 ASN CA CB sing N N 80 ASN CA HA sing N N 81 ASN C O doub N N 82 ASN C OXT sing N N 83 ASN CB CG sing N N 84 ASN CB HB2 sing N N 85 ASN CB HB3 sing N N 86 ASN CG OD1 doub N N 87 ASN CG ND2 sing N N 88 ASN ND2 HD21 sing N N 89 ASN ND2 HD22 sing N N 90 ASN OXT HXT sing N N 91 ASP N CA sing N N 92 ASP N H sing N N 93 ASP N H2 sing N N 94 ASP CA C sing N N 95 ASP CA CB sing N N 96 ASP CA HA sing N N 97 ASP C O doub N N 98 ASP C OXT sing N N 99 ASP CB CG sing N N 100 ASP CB HB2 sing N N 101 ASP CB HB3 sing N N 102 ASP CG OD1 doub N N 103 ASP CG OD2 sing N N 104 ASP OD2 HD2 sing N N 105 ASP OXT HXT sing N N 106 CYS N CA sing N N 107 CYS N H sing N N 108 CYS N H2 sing N N 109 CYS CA C sing N N 110 CYS CA CB sing N N 111 CYS CA HA sing N N 112 CYS C O doub N N 113 CYS C OXT sing N N 114 CYS CB SG sing N N 115 CYS CB HB2 sing N N 116 CYS CB HB3 sing N N 117 CYS SG HG sing N N 118 CYS OXT HXT sing N N 119 GLN N CA sing N N 120 GLN N H sing N N 121 GLN N H2 sing N N 122 GLN CA C sing N N 123 GLN CA CB sing N N 124 GLN CA HA sing N N 125 GLN C O doub N N 126 GLN C OXT sing N N 127 GLN CB CG sing N N 128 GLN CB HB2 sing N N 129 GLN CB HB3 sing N N 130 GLN CG CD sing N N 131 GLN CG HG2 sing N N 132 GLN CG HG3 sing N N 133 GLN CD OE1 doub N N 134 GLN CD NE2 sing N N 135 GLN NE2 HE21 sing N N 136 GLN NE2 HE22 sing N N 137 GLN OXT HXT sing N N 138 GLU N CA sing N N 139 GLU N H sing N N 140 GLU N H2 sing N N 141 GLU CA C sing N N 142 GLU CA CB sing N N 143 GLU CA HA sing N N 144 GLU C O doub N N 145 GLU C OXT sing N N 146 GLU CB CG sing N N 147 GLU CB HB2 sing N N 148 GLU CB HB3 sing N N 149 GLU CG CD sing N N 150 GLU CG HG2 sing N N 151 GLU CG HG3 sing N N 152 GLU CD OE1 doub N N 153 GLU CD OE2 sing N N 154 GLU OE2 HE2 sing N N 155 GLU OXT HXT sing N N 156 GLY N CA sing N N 157 GLY N H sing N N 158 GLY N H2 sing N N 159 GLY CA C sing N N 160 GLY CA HA2 sing N N 161 GLY CA HA3 sing N N 162 GLY C O doub N N 163 GLY C OXT sing N N 164 GLY OXT HXT sing N N 165 HIS N CA sing N N 166 HIS N H sing N N 167 HIS N H2 sing N N 168 HIS CA C sing N N 169 HIS CA CB sing N N 170 HIS CA HA sing N N 171 HIS C O doub N N 172 HIS C OXT sing N N 173 HIS CB CG sing N N 174 HIS CB HB2 sing N N 175 HIS CB HB3 sing N N 176 HIS CG ND1 sing Y N 177 HIS CG CD2 doub Y N 178 HIS ND1 CE1 doub Y N 179 HIS ND1 HD1 sing N N 180 HIS CD2 NE2 sing Y N 181 HIS CD2 HD2 sing N N 182 HIS CE1 NE2 sing Y N 183 HIS CE1 HE1 sing N N 184 HIS NE2 HE2 sing N N 185 HIS OXT HXT sing N N 186 HOH O H1 sing N N 187 HOH O H2 sing N N 188 ILE N CA sing N N 189 ILE N H sing N N 190 ILE N H2 sing N N 191 ILE CA C sing N N 192 ILE CA CB sing N N 193 ILE CA HA sing N N 194 ILE C O doub N N 195 ILE C OXT sing N N 196 ILE CB CG1 sing N N 197 ILE CB CG2 sing N N 198 ILE CB HB sing N N 199 ILE CG1 CD1 sing N N 200 ILE CG1 HG12 sing N N 201 ILE CG1 HG13 sing N N 202 ILE CG2 HG21 sing N N 203 ILE CG2 HG22 sing N N 204 ILE CG2 HG23 sing N N 205 ILE CD1 HD11 sing N N 206 ILE CD1 HD12 sing N N 207 ILE CD1 HD13 sing N N 208 ILE OXT HXT sing N N 209 LEU N CA sing N N 210 LEU N H sing N N 211 LEU N H2 sing N N 212 LEU CA C sing N N 213 LEU CA CB sing N N 214 LEU CA HA sing N N 215 LEU C O doub N N 216 LEU C OXT sing N N 217 LEU CB CG sing N N 218 LEU CB HB2 sing N N 219 LEU CB HB3 sing N N 220 LEU CG CD1 sing N N 221 LEU CG CD2 sing N N 222 LEU CG HG sing N N 223 LEU CD1 HD11 sing N N 224 LEU CD1 HD12 sing N N 225 LEU CD1 HD13 sing N N 226 LEU CD2 HD21 sing N N 227 LEU CD2 HD22 sing N N 228 LEU CD2 HD23 sing N N 229 LEU OXT HXT sing N N 230 LYS N CA sing N N 231 LYS N H sing N N 232 LYS N H2 sing N N 233 LYS CA C sing N N 234 LYS CA CB sing N N 235 LYS CA HA sing N N 236 LYS C O doub N N 237 LYS C OXT sing N N 238 LYS CB CG sing N N 239 LYS CB HB2 sing N N 240 LYS CB HB3 sing N N 241 LYS CG CD sing N N 242 LYS CG HG2 sing N N 243 LYS CG HG3 sing N N 244 LYS CD CE sing N N 245 LYS CD HD2 sing N N 246 LYS CD HD3 sing N N 247 LYS CE NZ sing N N 248 LYS CE HE2 sing N N 249 LYS CE HE3 sing N N 250 LYS NZ HZ1 sing N N 251 LYS NZ HZ2 sing N N 252 LYS NZ HZ3 sing N N 253 LYS OXT HXT sing N N 254 MET N CA sing N N 255 MET N H sing N N 256 MET N H2 sing N N 257 MET CA C sing N N 258 MET CA CB sing N N 259 MET CA HA sing N N 260 MET C O doub N N 261 MET C OXT sing N N 262 MET CB CG sing N N 263 MET CB HB2 sing N N 264 MET CB HB3 sing N N 265 MET CG SD sing N N 266 MET CG HG2 sing N N 267 MET CG HG3 sing N N 268 MET SD CE sing N N 269 MET CE HE1 sing N N 270 MET CE HE2 sing N N 271 MET CE HE3 sing N N 272 MET OXT HXT sing N N 273 PHE N CA sing N N 274 PHE N H sing N N 275 PHE N H2 sing N N 276 PHE CA C sing N N 277 PHE CA CB sing N N 278 PHE CA HA sing N N 279 PHE C O doub N N 280 PHE C OXT sing N N 281 PHE CB CG sing N N 282 PHE CB HB2 sing N N 283 PHE CB HB3 sing N N 284 PHE CG CD1 doub Y N 285 PHE CG CD2 sing Y N 286 PHE CD1 CE1 sing Y N 287 PHE CD1 HD1 sing N N 288 PHE CD2 CE2 doub Y N 289 PHE CD2 HD2 sing N N 290 PHE CE1 CZ doub Y N 291 PHE CE1 HE1 sing N N 292 PHE CE2 CZ sing Y N 293 PHE CE2 HE2 sing N N 294 PHE CZ HZ sing N N 295 PHE OXT HXT sing N N 296 PRO N CA sing N N 297 PRO N CD sing N N 298 PRO N H sing N N 299 PRO CA C sing N N 300 PRO CA CB sing N N 301 PRO CA HA sing N N 302 PRO C O doub N N 303 PRO C OXT sing N N 304 PRO CB CG sing N N 305 PRO CB HB2 sing N N 306 PRO CB HB3 sing N N 307 PRO CG CD sing N N 308 PRO CG HG2 sing N N 309 PRO CG HG3 sing N N 310 PRO CD HD2 sing N N 311 PRO CD HD3 sing N N 312 PRO OXT HXT sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 THR N CA sing N N 327 THR N H sing N N 328 THR N H2 sing N N 329 THR CA C sing N N 330 THR CA CB sing N N 331 THR CA HA sing N N 332 THR C O doub N N 333 THR C OXT sing N N 334 THR CB OG1 sing N N 335 THR CB CG2 sing N N 336 THR CB HB sing N N 337 THR OG1 HG1 sing N N 338 THR CG2 HG21 sing N N 339 THR CG2 HG22 sing N N 340 THR CG2 HG23 sing N N 341 THR OXT HXT sing N N 342 TRP N CA sing N N 343 TRP N H sing N N 344 TRP N H2 sing N N 345 TRP CA C sing N N 346 TRP CA CB sing N N 347 TRP CA HA sing N N 348 TRP C O doub N N 349 TRP C OXT sing N N 350 TRP CB CG sing N N 351 TRP CB HB2 sing N N 352 TRP CB HB3 sing N N 353 TRP CG CD1 doub Y N 354 TRP CG CD2 sing Y N 355 TRP CD1 NE1 sing Y N 356 TRP CD1 HD1 sing N N 357 TRP CD2 CE2 doub Y N 358 TRP CD2 CE3 sing Y N 359 TRP NE1 CE2 sing Y N 360 TRP NE1 HE1 sing N N 361 TRP CE2 CZ2 sing Y N 362 TRP CE3 CZ3 doub Y N 363 TRP CE3 HE3 sing N N 364 TRP CZ2 CH2 doub Y N 365 TRP CZ2 HZ2 sing N N 366 TRP CZ3 CH2 sing Y N 367 TRP CZ3 HZ3 sing N N 368 TRP CH2 HH2 sing N N 369 TRP OXT HXT sing N N 370 TYR N CA sing N N 371 TYR N H sing N N 372 TYR N H2 sing N N 373 TYR CA C sing N N 374 TYR CA CB sing N N 375 TYR CA HA sing N N 376 TYR C O doub N N 377 TYR C OXT sing N N 378 TYR CB CG sing N N 379 TYR CB HB2 sing N N 380 TYR CB HB3 sing N N 381 TYR CG CD1 doub Y N 382 TYR CG CD2 sing Y N 383 TYR CD1 CE1 sing Y N 384 TYR CD1 HD1 sing N N 385 TYR CD2 CE2 doub Y N 386 TYR CD2 HD2 sing N N 387 TYR CE1 CZ doub Y N 388 TYR CE1 HE1 sing N N 389 TYR CE2 CZ sing Y N 390 TYR CE2 HE2 sing N N 391 TYR CZ OH sing N N 392 TYR OH HH sing N N 393 TYR OXT HXT sing N N 394 VAL N CA sing N N 395 VAL N H sing N N 396 VAL N H2 sing N N 397 VAL CA C sing N N 398 VAL CA CB sing N N 399 VAL CA HA sing N N 400 VAL C O doub N N 401 VAL C OXT sing N N 402 VAL CB CG1 sing N N 403 VAL CB CG2 sing N N 404 VAL CB HB sing N N 405 VAL CG1 HG11 sing N N 406 VAL CG1 HG12 sing N N 407 VAL CG1 HG13 sing N N 408 VAL CG2 HG21 sing N N 409 VAL CG2 HG22 sing N N 410 VAL CG2 HG23 sing N N 411 VAL OXT HXT sing N N 412 # _pdbx_audit_support.funding_organization 'The Structural Genomics Consortium (SGC)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4WNO _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9F32 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.022768 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017560 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008634 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #