data_9F5A # _entry.id 9F5A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9F5A pdb_00009f5a 10.2210/pdb9f5a/pdb WWPDB D_1292138203 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-02-26 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9F5A _pdbx_database_status.recvd_initial_deposition_date 2024-04-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email d.n.woolfson@bristol.ac.uk _pdbx_contact_author.name_first Derek _pdbx_contact_author.name_last Woolfson _pdbx_contact_author.name_mi N. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0394-3202 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Petrenas, R.' 1 0000-0002-2997-7187 'Woolfson, D.N.' 2 0000-0002-0394-3202 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 147 _citation.language ? _citation.page_first 3796 _citation.page_last 3803 _citation.title 'Confinement and Catalysis within De Novo Designed Peptide Barrels.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.4c16633 _citation.pdbx_database_id_PubMed 39813445 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Petrenas, R.' 1 ? primary 'Hawkins, O.A.' 2 ? primary 'Jones, J.F.' 3 0009-0004-6876-9243 primary 'Scott, D.A.' 4 ? primary 'Fletcher, J.M.' 5 ? primary 'Obst, U.' 6 ? primary 'Lombardi, L.' 7 0000-0002-5202-9847 primary 'Pirro, F.' 8 ? primary 'Leggett, G.J.' 9 0000-0002-4315-9076 primary 'Oliver, T.A.A.' 10 0000-0003-3979-7857 primary 'Woolfson, D.N.' 11 0000-0002-0394-3202 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn CC-Type2-II-I17V-I21F 3254.860 2 ? ? ? ? 2 water nat water 18.015 34 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)GEIAQAIKEIAKAIKEVAWAFKEIAQAIKG(NH2)' _entity_poly.pdbx_seq_one_letter_code_can XGEIAQAIKEIAKAIKEVAWAFKEIAQAIKGX _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 GLY n 1 3 GLU n 1 4 ILE n 1 5 ALA n 1 6 GLN n 1 7 ALA n 1 8 ILE n 1 9 LYS n 1 10 GLU n 1 11 ILE n 1 12 ALA n 1 13 LYS n 1 14 ALA n 1 15 ILE n 1 16 LYS n 1 17 GLU n 1 18 VAL n 1 19 ALA n 1 20 TRP n 1 21 ALA n 1 22 PHE n 1 23 LYS n 1 24 GLU n 1 25 ILE n 1 26 ALA n 1 27 GLN n 1 28 ALA n 1 29 ILE n 1 30 LYS n 1 31 GLY n 1 32 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 32 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 101 0 ACE ACE A . n A 1 2 GLY 2 102 1 GLY GLY A . n A 1 3 GLU 3 103 2 GLU GLU A . n A 1 4 ILE 4 104 3 ILE ILE A . n A 1 5 ALA 5 105 4 ALA ALA A . n A 1 6 GLN 6 106 5 GLN GLN A . n A 1 7 ALA 7 107 6 ALA ALA A . n A 1 8 ILE 8 108 7 ILE ILE A . n A 1 9 LYS 9 109 8 LYS LYS A . n A 1 10 GLU 10 110 9 GLU GLU A . n A 1 11 ILE 11 111 10 ILE ILE A . n A 1 12 ALA 12 112 11 ALA ALA A . n A 1 13 LYS 13 113 12 LYS LYS A . n A 1 14 ALA 14 114 13 ALA ALA A . n A 1 15 ILE 15 115 14 ILE ILE A . n A 1 16 LYS 16 116 15 LYS LYS A . n A 1 17 GLU 17 117 16 GLU GLU A . n A 1 18 VAL 18 118 17 VAL VAL A . n A 1 19 ALA 19 119 18 ALA ALA A . n A 1 20 TRP 20 120 19 TRP TRP A . n A 1 21 ALA 21 121 20 ALA ALA A . n A 1 22 PHE 22 122 21 PHE PHE A . n A 1 23 LYS 23 123 22 LYS LYS A . n A 1 24 GLU 24 124 23 GLU GLU A . n A 1 25 ILE 25 125 24 ILE ILE A . n A 1 26 ALA 26 126 25 ALA ALA A . n A 1 27 GLN 27 127 26 GLN GLN A . n A 1 28 ALA 28 128 27 ALA ALA A . n A 1 29 ILE 29 129 28 ILE ILE A . n A 1 30 LYS 30 130 29 LYS LYS A . n A 1 31 GLY 31 131 30 GLY GLY A . n A 1 32 NH2 32 132 31 NH2 NH2 A . n B 1 1 ACE 1 101 0 ACE ACE B . n B 1 2 GLY 2 102 1 GLY GLY B . n B 1 3 GLU 3 103 2 GLU GLU B . n B 1 4 ILE 4 104 3 ILE ILE B . n B 1 5 ALA 5 105 4 ALA ALA B . n B 1 6 GLN 6 106 5 GLN GLN B . n B 1 7 ALA 7 107 6 ALA ALA B . n B 1 8 ILE 8 108 7 ILE ILE B . n B 1 9 LYS 9 109 8 LYS LYS B . n B 1 10 GLU 10 110 9 GLU GLU B . n B 1 11 ILE 11 111 10 ILE ILE B . n B 1 12 ALA 12 112 11 ALA ALA B . n B 1 13 LYS 13 113 12 LYS LYS B . n B 1 14 ALA 14 114 13 ALA ALA B . n B 1 15 ILE 15 115 14 ILE ILE B . n B 1 16 LYS 16 116 15 LYS LYS B . n B 1 17 GLU 17 117 16 GLU GLU B . n B 1 18 VAL 18 118 17 VAL VAL B . n B 1 19 ALA 19 119 18 ALA ALA B . n B 1 20 TRP 20 120 19 TRP TRP B . n B 1 21 ALA 21 121 20 ALA ALA B . n B 1 22 PHE 22 122 21 PHE PHE B . n B 1 23 LYS 23 123 22 LYS LYS B . n B 1 24 GLU 24 124 23 GLU GLU B . n B 1 25 ILE 25 125 24 ILE ILE B . n B 1 26 ALA 26 126 25 ALA ALA B . n B 1 27 GLN 27 127 26 GLN GLN B . n B 1 28 ALA 28 128 27 ALA ALA B . n B 1 29 ILE 29 129 28 ILE ILE B . n B 1 30 LYS 30 130 29 LYS LYS B . n B 1 31 GLY 31 131 30 GLY GLY B . n B 1 32 NH2 32 132 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 201 30 HOH HOH A . C 2 HOH 2 202 9 HOH HOH A . C 2 HOH 3 203 7 HOH HOH A . C 2 HOH 4 204 6 HOH HOH A . C 2 HOH 5 205 34 HOH HOH A . C 2 HOH 6 206 13 HOH HOH A . C 2 HOH 7 207 18 HOH HOH A . C 2 HOH 8 208 19 HOH HOH A . C 2 HOH 9 209 4 HOH HOH A . C 2 HOH 10 210 12 HOH HOH A . C 2 HOH 11 211 21 HOH HOH A . C 2 HOH 12 212 11 HOH HOH A . C 2 HOH 13 213 31 HOH HOH A . C 2 HOH 14 214 10 HOH HOH A . C 2 HOH 15 215 28 HOH HOH A . C 2 HOH 16 216 35 HOH HOH A . C 2 HOH 17 217 25 HOH HOH A . C 2 HOH 18 218 26 HOH HOH A . D 2 HOH 1 201 22 HOH HOH B . D 2 HOH 2 202 2 HOH HOH B . D 2 HOH 3 203 17 HOH HOH B . D 2 HOH 4 204 32 HOH HOH B . D 2 HOH 5 205 23 HOH HOH B . D 2 HOH 6 206 16 HOH HOH B . D 2 HOH 7 207 3 HOH HOH B . D 2 HOH 8 208 8 HOH HOH B . D 2 HOH 9 209 27 HOH HOH B . D 2 HOH 10 210 5 HOH HOH B . D 2 HOH 11 211 15 HOH HOH B . D 2 HOH 12 212 20 HOH HOH B . D 2 HOH 13 213 14 HOH HOH B . D 2 HOH 14 214 1 HOH HOH B . D 2 HOH 15 215 29 HOH HOH B . D 2 HOH 16 216 24 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 106 ? CD ? A GLN 6 CD 2 1 Y 1 A GLN 106 ? OE1 ? A GLN 6 OE1 3 1 Y 1 A GLN 106 ? NE2 ? A GLN 6 NE2 4 1 Y 1 A LYS 109 ? NZ ? A LYS 9 NZ 5 1 Y 1 A GLU 110 ? OE1 ? A GLU 10 OE1 6 1 Y 1 A GLU 110 ? OE2 ? A GLU 10 OE2 7 1 Y 1 A LYS 113 ? NZ ? A LYS 13 NZ 8 1 Y 1 A GLU 117 ? OE1 ? A GLU 17 OE1 9 1 Y 1 A GLU 117 ? OE2 ? A GLU 17 OE2 10 1 Y 1 A LYS 130 ? CE ? A LYS 30 CE 11 1 Y 1 A LYS 130 ? NZ ? A LYS 30 NZ 12 1 Y 1 B GLN 106 ? OE1 ? B GLN 6 OE1 13 1 Y 1 B GLN 106 ? NE2 ? B GLN 6 NE2 14 1 Y 1 B LYS 109 ? NZ ? B LYS 9 NZ 15 1 Y 1 B LYS 113 ? NZ ? B LYS 13 NZ 16 1 Y 1 B LYS 116 ? CE ? B LYS 16 CE 17 1 Y 1 B LYS 116 ? NZ ? B LYS 16 NZ 18 1 Y 0 B TRP 120 ? CE3 ? B TRP 20 CE3 19 1 Y 0 B TRP 120 ? CZ2 ? B TRP 20 CZ2 20 1 Y 0 B TRP 120 ? CZ3 ? B TRP 20 CZ3 21 1 Y 0 B TRP 120 ? CH2 ? B TRP 20 CH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9F5A _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.098 _cell.length_a_esd ? _cell.length_b 48.098 _cell.length_b_esd ? _cell.length_c 127.147 _cell.length_c_esd ? _cell.volume 294144.108 _cell.volume_esd ? _cell.Z_PDB 32 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9F5A _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 _symmetry.space_group_name_Hall 'I 4 2' _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9F5A _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.70 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Pact Premier HT-96 F11. 0.2M Sodium citrate. 0.1M Bis Tris propane pH 6.5. 20% w/v PEG 3350.' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-02-04 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 34.31 _reflns.entry_id 9F5A _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 34.01 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5388 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.42 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 37.47 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.007627 _reflns.pdbx_Rpim_I_all 0.005393 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.005393 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.072 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 8.65 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 511 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.0 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.0692 _reflns_shell.pdbx_Rpim_I_all 0.04893 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.998 _reflns_shell.pdbx_CC_star 1 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.02 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.04893 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 42.18 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9F5A _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 34.01 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5359 _refine.ls_number_reflns_R_free 538 _refine.ls_number_reflns_R_work 4821 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.48 _refine.ls_percent_reflns_R_free 10.04 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2405 _refine.ls_R_factor_R_free 0.2525 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2388 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.6893 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2394 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 34.01 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 478 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 437 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0025 ? 452 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.3521 ? 605 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0308 ? 71 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0013 ? 73 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.5367 ? 163 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.00 2.20 . . 130 1159 99.23 . . . . 0.2483 . . . . . . . . . . . 0.2978 'X-RAY DIFFRACTION' 2.20 2.52 . . 132 1186 99.77 . . . . 0.2451 . . . . . . . . . . . 0.2719 'X-RAY DIFFRACTION' 2.52 3.17 . . 132 1185 99.62 . . . . 0.2431 . . . . . . . . . . . 0.2862 'X-RAY DIFFRACTION' 3.18 34.01 . . 144 1291 99.31 . . . . 0.2337 . . . . . . . . . . . 0.2266 # _struct.entry_id 9F5A _struct.title 'Crystal structure of a parallel eight-helix coiled coil CC-Type2-II-I17V-I21F' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9F5A _struct_keywords.text 'COILED COIL, 8-HELIX BUNDLE, DE NOVO PROTEIN DESIGN, PEPTIDE ASSEMBLY, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9F5A _struct_ref.pdbx_db_accession 9F5A _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9F5A A 1 ? 32 ? 9F5A 101 ? 132 ? 101 132 2 1 9F5A B 1 ? 32 ? 9F5A 101 ? 132 ? 101 132 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details hexadecameric _pdbx_struct_assembly.oligomeric_count 16 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 30640 ? 1 MORE -293 ? 1 'SSA (A^2)' 20120 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 48.0980000000 0.0000000000 -1.0000000000 0.0000000000 48.0980000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -y+1,x,z 0.0000000000 -1.0000000000 0.0000000000 48.0980000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_565 y,-x+1,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 48.0980000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_655 -x+1,y,-z -1.0000000000 0.0000000000 0.0000000000 48.0980000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 6 'crystal symmetry operation' 6_565 x,-y+1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 48.0980000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 8 'crystal symmetry operation' 8_665 -y+1,-x+1,-z 0.0000000000 -1.0000000000 0.0000000000 48.0980000000 -1.0000000000 0.0000000000 0.0000000000 48.0980000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 2 ? GLY A 31 ? GLY A 102 GLY A 131 1 ? 30 HELX_P HELX_P2 AA2 GLY B 2 ? GLY B 31 ? GLY B 102 GLY B 131 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A GLY 2 N ? ? A ACE 101 A GLY 102 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A GLY 31 C ? ? ? 1_555 A NH2 32 N ? ? A GLY 131 A NH2 132 1_555 ? ? ? ? ? ? ? 1.430 ? ? covale3 covale both ? B ACE 1 C ? ? ? 1_555 B GLY 2 N ? ? B ACE 101 B GLY 102 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 ACE A 1 ? GLY A 2 ? ACE A 101 ? 1_555 GLY A 102 ? 1_555 . . GLY 12 ACE None 'Terminal acetylation' 2 ACE B 1 ? GLY B 2 ? ACE B 101 ? 1_555 GLY B 102 ? 1_555 . . GLY 12 ACE None 'Terminal acetylation' 3 NH2 A 32 ? GLY A 31 ? NH2 A 132 ? 1_555 GLY A 131 ? 1_555 . . GLY 12 NH2 None 'Terminal amidation' # _pdbx_entry_details.entry_id 9F5A _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 O _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLY _pdbx_validate_rmsd_angle.auth_seq_id_1 131 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 C _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLY _pdbx_validate_rmsd_angle.auth_seq_id_2 131 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 N _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 NH2 _pdbx_validate_rmsd_angle.auth_seq_id_3 132 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 110.61 _pdbx_validate_rmsd_angle.angle_target_value 122.70 _pdbx_validate_rmsd_angle.angle_deviation -12.09 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.60 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 214 ? C HOH . 2 1 A HOH 216 ? C HOH . 3 1 B HOH 214 ? D HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x,z 3 y,-x,z 4 x,-y,-z 5 -x,y,-z 6 -x,-y,z 7 y,x,-z 8 -y,-x,-z 9 x+1/2,y+1/2,z+1/2 10 -y+1/2,x+1/2,z+1/2 11 y+1/2,-x+1/2,z+1/2 12 x+1/2,-y+1/2,-z+1/2 13 -x+1/2,y+1/2,-z+1/2 14 -x+1/2,-y+1/2,z+1/2 15 y+1/2,x+1/2,-z+1/2 16 -y+1/2,-x+1/2,-z+1/2 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 215 ? 6.18 . 2 1 O ? A HOH 216 ? 6.59 . 3 1 O ? A HOH 217 ? 6.63 . 4 1 O ? A HOH 218 ? 7.10 . 5 1 O ? B HOH 215 ? 6.08 . 6 1 O ? B HOH 216 ? 6.41 . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id B _pdbx_unobs_or_zero_occ_residues.auth_comp_id NH2 _pdbx_unobs_or_zero_occ_residues.auth_seq_id 132 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id B _pdbx_unobs_or_zero_occ_residues.label_comp_id NH2 _pdbx_unobs_or_zero_occ_residues.label_seq_id 32 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACE C C N N 1 ACE O O N N 2 ACE CH3 C N N 3 ACE H H N N 4 ACE H1 H N N 5 ACE H2 H N N 6 ACE H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 GLN N N N N 21 GLN CA C N S 22 GLN C C N N 23 GLN O O N N 24 GLN CB C N N 25 GLN CG C N N 26 GLN CD C N N 27 GLN OE1 O N N 28 GLN NE2 N N N 29 GLN OXT O N N 30 GLN H H N N 31 GLN H2 H N N 32 GLN HA H N N 33 GLN HB2 H N N 34 GLN HB3 H N N 35 GLN HG2 H N N 36 GLN HG3 H N N 37 GLN HE21 H N N 38 GLN HE22 H N N 39 GLN HXT H N N 40 GLU N N N N 41 GLU CA C N S 42 GLU C C N N 43 GLU O O N N 44 GLU CB C N N 45 GLU CG C N N 46 GLU CD C N N 47 GLU OE1 O N N 48 GLU OE2 O N N 49 GLU OXT O N N 50 GLU H H N N 51 GLU H2 H N N 52 GLU HA H N N 53 GLU HB2 H N N 54 GLU HB3 H N N 55 GLU HG2 H N N 56 GLU HG3 H N N 57 GLU HE2 H N N 58 GLU HXT H N N 59 GLY N N N N 60 GLY CA C N N 61 GLY C C N N 62 GLY O O N N 63 GLY OXT O N N 64 GLY H H N N 65 GLY H2 H N N 66 GLY HA2 H N N 67 GLY HA3 H N N 68 GLY HXT H N N 69 HOH O O N N 70 HOH H1 H N N 71 HOH H2 H N N 72 ILE N N N N 73 ILE CA C N S 74 ILE C C N N 75 ILE O O N N 76 ILE CB C N S 77 ILE CG1 C N N 78 ILE CG2 C N N 79 ILE CD1 C N N 80 ILE OXT O N N 81 ILE H H N N 82 ILE H2 H N N 83 ILE HA H N N 84 ILE HB H N N 85 ILE HG12 H N N 86 ILE HG13 H N N 87 ILE HG21 H N N 88 ILE HG22 H N N 89 ILE HG23 H N N 90 ILE HD11 H N N 91 ILE HD12 H N N 92 ILE HD13 H N N 93 ILE HXT H N N 94 LYS N N N N 95 LYS CA C N S 96 LYS C C N N 97 LYS O O N N 98 LYS CB C N N 99 LYS CG C N N 100 LYS CD C N N 101 LYS CE C N N 102 LYS NZ N N N 103 LYS OXT O N N 104 LYS H H N N 105 LYS H2 H N N 106 LYS HA H N N 107 LYS HB2 H N N 108 LYS HB3 H N N 109 LYS HG2 H N N 110 LYS HG3 H N N 111 LYS HD2 H N N 112 LYS HD3 H N N 113 LYS HE2 H N N 114 LYS HE3 H N N 115 LYS HZ1 H N N 116 LYS HZ2 H N N 117 LYS HZ3 H N N 118 LYS HXT H N N 119 NH2 N N N N 120 NH2 HN1 H N N 121 NH2 HN2 H N N 122 PHE N N N N 123 PHE CA C N S 124 PHE C C N N 125 PHE O O N N 126 PHE CB C N N 127 PHE CG C Y N 128 PHE CD1 C Y N 129 PHE CD2 C Y N 130 PHE CE1 C Y N 131 PHE CE2 C Y N 132 PHE CZ C Y N 133 PHE OXT O N N 134 PHE H H N N 135 PHE H2 H N N 136 PHE HA H N N 137 PHE HB2 H N N 138 PHE HB3 H N N 139 PHE HD1 H N N 140 PHE HD2 H N N 141 PHE HE1 H N N 142 PHE HE2 H N N 143 PHE HZ H N N 144 PHE HXT H N N 145 TRP N N N N 146 TRP CA C N S 147 TRP C C N N 148 TRP O O N N 149 TRP CB C N N 150 TRP CG C Y N 151 TRP CD1 C Y N 152 TRP CD2 C Y N 153 TRP NE1 N Y N 154 TRP CE2 C Y N 155 TRP CE3 C Y N 156 TRP CZ2 C Y N 157 TRP CZ3 C Y N 158 TRP CH2 C Y N 159 TRP OXT O N N 160 TRP H H N N 161 TRP H2 H N N 162 TRP HA H N N 163 TRP HB2 H N N 164 TRP HB3 H N N 165 TRP HD1 H N N 166 TRP HE1 H N N 167 TRP HE3 H N N 168 TRP HZ2 H N N 169 TRP HZ3 H N N 170 TRP HH2 H N N 171 TRP HXT H N N 172 VAL N N N N 173 VAL CA C N S 174 VAL C C N N 175 VAL O O N N 176 VAL CB C N N 177 VAL CG1 C N N 178 VAL CG2 C N N 179 VAL OXT O N N 180 VAL H H N N 181 VAL H2 H N N 182 VAL HA H N N 183 VAL HB H N N 184 VAL HG11 H N N 185 VAL HG12 H N N 186 VAL HG13 H N N 187 VAL HG21 H N N 188 VAL HG22 H N N 189 VAL HG23 H N N 190 VAL HXT H N N 191 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACE C O doub N N 1 ACE C CH3 sing N N 2 ACE C H sing N N 3 ACE CH3 H1 sing N N 4 ACE CH3 H2 sing N N 5 ACE CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 GLN N CA sing N N 19 GLN N H sing N N 20 GLN N H2 sing N N 21 GLN CA C sing N N 22 GLN CA CB sing N N 23 GLN CA HA sing N N 24 GLN C O doub N N 25 GLN C OXT sing N N 26 GLN CB CG sing N N 27 GLN CB HB2 sing N N 28 GLN CB HB3 sing N N 29 GLN CG CD sing N N 30 GLN CG HG2 sing N N 31 GLN CG HG3 sing N N 32 GLN CD OE1 doub N N 33 GLN CD NE2 sing N N 34 GLN NE2 HE21 sing N N 35 GLN NE2 HE22 sing N N 36 GLN OXT HXT sing N N 37 GLU N CA sing N N 38 GLU N H sing N N 39 GLU N H2 sing N N 40 GLU CA C sing N N 41 GLU CA CB sing N N 42 GLU CA HA sing N N 43 GLU C O doub N N 44 GLU C OXT sing N N 45 GLU CB CG sing N N 46 GLU CB HB2 sing N N 47 GLU CB HB3 sing N N 48 GLU CG CD sing N N 49 GLU CG HG2 sing N N 50 GLU CG HG3 sing N N 51 GLU CD OE1 doub N N 52 GLU CD OE2 sing N N 53 GLU OE2 HE2 sing N N 54 GLU OXT HXT sing N N 55 GLY N CA sing N N 56 GLY N H sing N N 57 GLY N H2 sing N N 58 GLY CA C sing N N 59 GLY CA HA2 sing N N 60 GLY CA HA3 sing N N 61 GLY C O doub N N 62 GLY C OXT sing N N 63 GLY OXT HXT sing N N 64 HOH O H1 sing N N 65 HOH O H2 sing N N 66 ILE N CA sing N N 67 ILE N H sing N N 68 ILE N H2 sing N N 69 ILE CA C sing N N 70 ILE CA CB sing N N 71 ILE CA HA sing N N 72 ILE C O doub N N 73 ILE C OXT sing N N 74 ILE CB CG1 sing N N 75 ILE CB CG2 sing N N 76 ILE CB HB sing N N 77 ILE CG1 CD1 sing N N 78 ILE CG1 HG12 sing N N 79 ILE CG1 HG13 sing N N 80 ILE CG2 HG21 sing N N 81 ILE CG2 HG22 sing N N 82 ILE CG2 HG23 sing N N 83 ILE CD1 HD11 sing N N 84 ILE CD1 HD12 sing N N 85 ILE CD1 HD13 sing N N 86 ILE OXT HXT sing N N 87 LYS N CA sing N N 88 LYS N H sing N N 89 LYS N H2 sing N N 90 LYS CA C sing N N 91 LYS CA CB sing N N 92 LYS CA HA sing N N 93 LYS C O doub N N 94 LYS C OXT sing N N 95 LYS CB CG sing N N 96 LYS CB HB2 sing N N 97 LYS CB HB3 sing N N 98 LYS CG CD sing N N 99 LYS CG HG2 sing N N 100 LYS CG HG3 sing N N 101 LYS CD CE sing N N 102 LYS CD HD2 sing N N 103 LYS CD HD3 sing N N 104 LYS CE NZ sing N N 105 LYS CE HE2 sing N N 106 LYS CE HE3 sing N N 107 LYS NZ HZ1 sing N N 108 LYS NZ HZ2 sing N N 109 LYS NZ HZ3 sing N N 110 LYS OXT HXT sing N N 111 NH2 N HN1 sing N N 112 NH2 N HN2 sing N N 113 PHE N CA sing N N 114 PHE N H sing N N 115 PHE N H2 sing N N 116 PHE CA C sing N N 117 PHE CA CB sing N N 118 PHE CA HA sing N N 119 PHE C O doub N N 120 PHE C OXT sing N N 121 PHE CB CG sing N N 122 PHE CB HB2 sing N N 123 PHE CB HB3 sing N N 124 PHE CG CD1 doub Y N 125 PHE CG CD2 sing Y N 126 PHE CD1 CE1 sing Y N 127 PHE CD1 HD1 sing N N 128 PHE CD2 CE2 doub Y N 129 PHE CD2 HD2 sing N N 130 PHE CE1 CZ doub Y N 131 PHE CE1 HE1 sing N N 132 PHE CE2 CZ sing Y N 133 PHE CE2 HE2 sing N N 134 PHE CZ HZ sing N N 135 PHE OXT HXT sing N N 136 TRP N CA sing N N 137 TRP N H sing N N 138 TRP N H2 sing N N 139 TRP CA C sing N N 140 TRP CA CB sing N N 141 TRP CA HA sing N N 142 TRP C O doub N N 143 TRP C OXT sing N N 144 TRP CB CG sing N N 145 TRP CB HB2 sing N N 146 TRP CB HB3 sing N N 147 TRP CG CD1 doub Y N 148 TRP CG CD2 sing Y N 149 TRP CD1 NE1 sing Y N 150 TRP CD1 HD1 sing N N 151 TRP CD2 CE2 doub Y N 152 TRP CD2 CE3 sing Y N 153 TRP NE1 CE2 sing Y N 154 TRP NE1 HE1 sing N N 155 TRP CE2 CZ2 sing Y N 156 TRP CE3 CZ3 doub Y N 157 TRP CE3 HE3 sing N N 158 TRP CZ2 CH2 doub Y N 159 TRP CZ2 HZ2 sing N N 160 TRP CZ3 CH2 sing Y N 161 TRP CZ3 HZ3 sing N N 162 TRP CH2 HH2 sing N N 163 TRP OXT HXT sing N N 164 VAL N CA sing N N 165 VAL N H sing N N 166 VAL N H2 sing N N 167 VAL CA C sing N N 168 VAL CA CB sing N N 169 VAL CA HA sing N N 170 VAL C O doub N N 171 VAL C OXT sing N N 172 VAL CB CG1 sing N N 173 VAL CB CG2 sing N N 174 VAL CB HB sing N N 175 VAL CG1 HG11 sing N N 176 VAL CG1 HG12 sing N N 177 VAL CG1 HG13 sing N N 178 VAL CG2 HG21 sing N N 179 VAL CG2 HG22 sing N N 180 VAL CG2 HG23 sing N N 181 VAL OXT HXT sing N N 182 # _pdbx_audit_support.funding_organization 'Biotechnology and Biological Sciences Research Council (BBSRC)' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ISAMBARD # _space_group.name_H-M_alt 'I 4 2 2' _space_group.name_Hall 'I 4 2' _space_group.IT_number 97 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9F5A _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.020791 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020791 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007865 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #