data_9F80 # _entry.id 9F80 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9F80 pdb_00009f80 10.2210/pdb9f80/pdb WWPDB D_1292138371 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2024-12-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9F80 _pdbx_database_status.recvd_initial_deposition_date 2024-05-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email rene.wintjens@ulb.be _pdbx_contact_author.name_first Rene _pdbx_contact_author.name_last Wintjens _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0234-7847 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Megalizzi, V.' 1 0000-0003-4229-5022 'Tanina, A.' 2 0000-0003-0924-0185 'Grosse, C.' 3 0000-0002-9550-4943 'Mirgaux, M.' 4 0000-0002-6469-0552 'Legrand, P.' 5 0000-0003-2431-2255 'Dias Mirandela, G.' 6 0000-0001-5871-6288 'Wohlkonig, A.' 7 0000-0003-3103-5022 'Bifani, P.' 8 0000-0001-9651-6439 'Wintjens, R.' 9 0000-0002-0234-7847 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Heliyon _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2405-8440 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 10 _citation.language ? _citation.page_first e40494 _citation.page_last e40494 _citation.title 'Domain architecture of the Mycobacterium tuberculosis MabR ( Rv2242 ), a member of the PucR transcription factor family.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.heliyon.2024.e40494 _citation.pdbx_database_id_PubMed 39641026 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Megalizzi, V.' 1 ? primary 'Tanina, A.' 2 ? primary 'Grosse, C.' 3 ? primary 'Mirgaux, M.' 4 ? primary 'Legrand, P.' 5 ? primary 'Dias Mirandela, G.' 6 ? primary 'Wohlkonig, A.' 7 ? primary 'Bifani, P.' 8 ? primary 'Wintjens, R.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein Rv2242' 29106.840 1 ? ? ? ? 2 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 water nat water 18.015 38 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMARGTWDSRMEASVVDAVVRGDTGPELLSRAAALNWDTTAPATVLVGTPAPGPNGSNSDG DSERASQDVRDTAARHGRAALTDVHGTWLVAIVSGQLSPTEKFLKDLLAAFADAPVVIGPTAPMLTAAHRSASEAISGMN AVAGWRGAPRPVLARELLPERALMGDASAIVALHTDVMRPLADAGPTLIETLDAYLDCGGAIEACARKLFVHPNTVRYRL KRITDFTGRDPTQPRDAYVLRVAATVGQLNYPTPH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMARGTWDSRMEASVVDAVVRGDTGPELLSRAAALNWDTTAPATVLVGTPAPGPNGSNSDG DSERASQDVRDTAARHGRAALTDVHGTWLVAIVSGQLSPTEKFLKDLLAAFADAPVVIGPTAPMLTAAHRSASEAISGMN AVAGWRGAPRPVLARELLPERALMGDASAIVALHTDVMRPLADAGPTLIETLDAYLDCGGAIEACARKLFVHPNTVRYRL KRITDFTGRDPTQPRDAYVLRVAATVGQLNYPTPH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 3 'SODIUM ION' NA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 ARG n 1 24 GLY n 1 25 THR n 1 26 TRP n 1 27 ASP n 1 28 SER n 1 29 ARG n 1 30 MET n 1 31 GLU n 1 32 ALA n 1 33 SER n 1 34 VAL n 1 35 VAL n 1 36 ASP n 1 37 ALA n 1 38 VAL n 1 39 VAL n 1 40 ARG n 1 41 GLY n 1 42 ASP n 1 43 THR n 1 44 GLY n 1 45 PRO n 1 46 GLU n 1 47 LEU n 1 48 LEU n 1 49 SER n 1 50 ARG n 1 51 ALA n 1 52 ALA n 1 53 ALA n 1 54 LEU n 1 55 ASN n 1 56 TRP n 1 57 ASP n 1 58 THR n 1 59 THR n 1 60 ALA n 1 61 PRO n 1 62 ALA n 1 63 THR n 1 64 VAL n 1 65 LEU n 1 66 VAL n 1 67 GLY n 1 68 THR n 1 69 PRO n 1 70 ALA n 1 71 PRO n 1 72 GLY n 1 73 PRO n 1 74 ASN n 1 75 GLY n 1 76 SER n 1 77 ASN n 1 78 SER n 1 79 ASP n 1 80 GLY n 1 81 ASP n 1 82 SER n 1 83 GLU n 1 84 ARG n 1 85 ALA n 1 86 SER n 1 87 GLN n 1 88 ASP n 1 89 VAL n 1 90 ARG n 1 91 ASP n 1 92 THR n 1 93 ALA n 1 94 ALA n 1 95 ARG n 1 96 HIS n 1 97 GLY n 1 98 ARG n 1 99 ALA n 1 100 ALA n 1 101 LEU n 1 102 THR n 1 103 ASP n 1 104 VAL n 1 105 HIS n 1 106 GLY n 1 107 THR n 1 108 TRP n 1 109 LEU n 1 110 VAL n 1 111 ALA n 1 112 ILE n 1 113 VAL n 1 114 SER n 1 115 GLY n 1 116 GLN n 1 117 LEU n 1 118 SER n 1 119 PRO n 1 120 THR n 1 121 GLU n 1 122 LYS n 1 123 PHE n 1 124 LEU n 1 125 LYS n 1 126 ASP n 1 127 LEU n 1 128 LEU n 1 129 ALA n 1 130 ALA n 1 131 PHE n 1 132 ALA n 1 133 ASP n 1 134 ALA n 1 135 PRO n 1 136 VAL n 1 137 VAL n 1 138 ILE n 1 139 GLY n 1 140 PRO n 1 141 THR n 1 142 ALA n 1 143 PRO n 1 144 MET n 1 145 LEU n 1 146 THR n 1 147 ALA n 1 148 ALA n 1 149 HIS n 1 150 ARG n 1 151 SER n 1 152 ALA n 1 153 SER n 1 154 GLU n 1 155 ALA n 1 156 ILE n 1 157 SER n 1 158 GLY n 1 159 MET n 1 160 ASN n 1 161 ALA n 1 162 VAL n 1 163 ALA n 1 164 GLY n 1 165 TRP n 1 166 ARG n 1 167 GLY n 1 168 ALA n 1 169 PRO n 1 170 ARG n 1 171 PRO n 1 172 VAL n 1 173 LEU n 1 174 ALA n 1 175 ARG n 1 176 GLU n 1 177 LEU n 1 178 LEU n 1 179 PRO n 1 180 GLU n 1 181 ARG n 1 182 ALA n 1 183 LEU n 1 184 MET n 1 185 GLY n 1 186 ASP n 1 187 ALA n 1 188 SER n 1 189 ALA n 1 190 ILE n 1 191 VAL n 1 192 ALA n 1 193 LEU n 1 194 HIS n 1 195 THR n 1 196 ASP n 1 197 VAL n 1 198 MET n 1 199 ARG n 1 200 PRO n 1 201 LEU n 1 202 ALA n 1 203 ASP n 1 204 ALA n 1 205 GLY n 1 206 PRO n 1 207 THR n 1 208 LEU n 1 209 ILE n 1 210 GLU n 1 211 THR n 1 212 LEU n 1 213 ASP n 1 214 ALA n 1 215 TYR n 1 216 LEU n 1 217 ASP n 1 218 CYS n 1 219 GLY n 1 220 GLY n 1 221 ALA n 1 222 ILE n 1 223 GLU n 1 224 ALA n 1 225 CYS n 1 226 ALA n 1 227 ARG n 1 228 LYS n 1 229 LEU n 1 230 PHE n 1 231 VAL n 1 232 HIS n 1 233 PRO n 1 234 ASN n 1 235 THR n 1 236 VAL n 1 237 ARG n 1 238 TYR n 1 239 ARG n 1 240 LEU n 1 241 LYS n 1 242 ARG n 1 243 ILE n 1 244 THR n 1 245 ASP n 1 246 PHE n 1 247 THR n 1 248 GLY n 1 249 ARG n 1 250 ASP n 1 251 PRO n 1 252 THR n 1 253 GLN n 1 254 PRO n 1 255 ARG n 1 256 ASP n 1 257 ALA n 1 258 TYR n 1 259 VAL n 1 260 LEU n 1 261 ARG n 1 262 VAL n 1 263 ALA n 1 264 ALA n 1 265 THR n 1 266 VAL n 1 267 GLY n 1 268 GLN n 1 269 LEU n 1 270 ASN n 1 271 TYR n 1 272 PRO n 1 273 THR n 1 274 PRO n 1 275 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 275 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Rv2242, MTCY427.23' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis H37Rv' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details pET28a _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name plasmid _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 140 ? ? ? A . n A 1 2 GLY 2 141 ? ? ? A . n A 1 3 SER 3 142 ? ? ? A . n A 1 4 SER 4 143 ? ? ? A . n A 1 5 HIS 5 144 ? ? ? A . n A 1 6 HIS 6 145 ? ? ? A . n A 1 7 HIS 7 146 ? ? ? A . n A 1 8 HIS 8 147 ? ? ? A . n A 1 9 HIS 9 148 ? ? ? A . n A 1 10 HIS 10 149 ? ? ? A . n A 1 11 SER 11 150 ? ? ? A . n A 1 12 SER 12 151 ? ? ? A . n A 1 13 GLY 13 152 ? ? ? A . n A 1 14 LEU 14 153 ? ? ? A . n A 1 15 VAL 15 154 ? ? ? A . n A 1 16 PRO 16 155 ? ? ? A . n A 1 17 ARG 17 156 ? ? ? A . n A 1 18 GLY 18 157 ? ? ? A . n A 1 19 SER 19 158 ? ? ? A . n A 1 20 HIS 20 159 ? ? ? A . n A 1 21 MET 21 160 ? ? ? A . n A 1 22 ALA 22 161 ? ? ? A . n A 1 23 ARG 23 162 ? ? ? A . n A 1 24 GLY 24 163 ? ? ? A . n A 1 25 THR 25 164 ? ? ? A . n A 1 26 TRP 26 165 165 TRP TRP A . n A 1 27 ASP 27 166 166 ASP ASP A . n A 1 28 SER 28 167 167 SER SER A . n A 1 29 ARG 29 168 168 ARG ARG A . n A 1 30 MET 30 169 169 MET MET A . n A 1 31 GLU 31 170 170 GLU GLU A . n A 1 32 ALA 32 171 171 ALA ALA A . n A 1 33 SER 33 172 172 SER SER A . n A 1 34 VAL 34 173 173 VAL VAL A . n A 1 35 VAL 35 174 174 VAL VAL A . n A 1 36 ASP 36 175 175 ASP ASP A . n A 1 37 ALA 37 176 176 ALA ALA A . n A 1 38 VAL 38 177 177 VAL VAL A . n A 1 39 VAL 39 178 178 VAL VAL A . n A 1 40 ARG 40 179 179 ARG ARG A . n A 1 41 GLY 41 180 180 GLY GLY A . n A 1 42 ASP 42 181 181 ASP ASP A . n A 1 43 THR 43 182 182 THR THR A . n A 1 44 GLY 44 183 183 GLY GLY A . n A 1 45 PRO 45 184 184 PRO PRO A . n A 1 46 GLU 46 185 185 GLU GLU A . n A 1 47 LEU 47 186 186 LEU LEU A . n A 1 48 LEU 48 187 187 LEU LEU A . n A 1 49 SER 49 188 188 SER SER A . n A 1 50 ARG 50 189 189 ARG ARG A . n A 1 51 ALA 51 190 190 ALA ALA A . n A 1 52 ALA 52 191 191 ALA ALA A . n A 1 53 ALA 53 192 192 ALA ALA A . n A 1 54 LEU 54 193 193 LEU LEU A . n A 1 55 ASN 55 194 194 ASN ASN A . n A 1 56 TRP 56 195 195 TRP TRP A . n A 1 57 ASP 57 196 196 ASP ASP A . n A 1 58 THR 58 197 197 THR THR A . n A 1 59 THR 59 198 198 THR THR A . n A 1 60 ALA 60 199 199 ALA ALA A . n A 1 61 PRO 61 200 200 PRO PRO A . n A 1 62 ALA 62 201 201 ALA ALA A . n A 1 63 THR 63 202 202 THR THR A . n A 1 64 VAL 64 203 203 VAL VAL A . n A 1 65 LEU 65 204 204 LEU LEU A . n A 1 66 VAL 66 205 205 VAL VAL A . n A 1 67 GLY 67 206 206 GLY GLY A . n A 1 68 THR 68 207 207 THR THR A . n A 1 69 PRO 69 208 208 PRO PRO A . n A 1 70 ALA 70 209 209 ALA ALA A . n A 1 71 PRO 71 210 210 PRO PRO A . n A 1 72 GLY 72 211 211 GLY GLY A . n A 1 73 PRO 73 212 212 PRO PRO A . n A 1 74 ASN 74 213 213 ASN ASN A . n A 1 75 GLY 75 214 ? ? ? A . n A 1 76 SER 76 215 ? ? ? A . n A 1 77 ASN 77 216 216 ASN ASN A . n A 1 78 SER 78 217 217 SER SER A . n A 1 79 ASP 79 218 218 ASP ASP A . n A 1 80 GLY 80 219 219 GLY GLY A . n A 1 81 ASP 81 220 220 ASP ASP A . n A 1 82 SER 82 221 221 SER SER A . n A 1 83 GLU 83 222 222 GLU GLU A . n A 1 84 ARG 84 223 223 ARG ARG A . n A 1 85 ALA 85 224 224 ALA ALA A . n A 1 86 SER 86 225 225 SER SER A . n A 1 87 GLN 87 226 226 GLN GLN A . n A 1 88 ASP 88 227 227 ASP ASP A . n A 1 89 VAL 89 228 228 VAL VAL A . n A 1 90 ARG 90 229 229 ARG ARG A . n A 1 91 ASP 91 230 230 ASP ASP A . n A 1 92 THR 92 231 231 THR THR A . n A 1 93 ALA 93 232 232 ALA ALA A . n A 1 94 ALA 94 233 233 ALA ALA A . n A 1 95 ARG 95 234 234 ARG ARG A . n A 1 96 HIS 96 235 235 HIS HIS A . n A 1 97 GLY 97 236 236 GLY GLY A . n A 1 98 ARG 98 237 237 ARG ARG A . n A 1 99 ALA 99 238 238 ALA ALA A . n A 1 100 ALA 100 239 239 ALA ALA A . n A 1 101 LEU 101 240 240 LEU LEU A . n A 1 102 THR 102 241 241 THR THR A . n A 1 103 ASP 103 242 242 ASP ASP A . n A 1 104 VAL 104 243 243 VAL VAL A . n A 1 105 HIS 105 244 244 HIS HIS A . n A 1 106 GLY 106 245 245 GLY GLY A . n A 1 107 THR 107 246 246 THR THR A . n A 1 108 TRP 108 247 247 TRP TRP A . n A 1 109 LEU 109 248 248 LEU LEU A . n A 1 110 VAL 110 249 249 VAL VAL A . n A 1 111 ALA 111 250 250 ALA ALA A . n A 1 112 ILE 112 251 251 ILE ILE A . n A 1 113 VAL 113 252 252 VAL VAL A . n A 1 114 SER 114 253 253 SER SER A . n A 1 115 GLY 115 254 254 GLY GLY A . n A 1 116 GLN 116 255 255 GLN GLN A . n A 1 117 LEU 117 256 256 LEU LEU A . n A 1 118 SER 118 257 257 SER SER A . n A 1 119 PRO 119 258 258 PRO PRO A . n A 1 120 THR 120 259 259 THR THR A . n A 1 121 GLU 121 260 260 GLU GLU A . n A 1 122 LYS 122 261 261 LYS LYS A . n A 1 123 PHE 123 262 262 PHE PHE A . n A 1 124 LEU 124 263 263 LEU LEU A . n A 1 125 LYS 125 264 264 LYS LYS A . n A 1 126 ASP 126 265 265 ASP ASP A . n A 1 127 LEU 127 266 266 LEU LEU A . n A 1 128 LEU 128 267 267 LEU LEU A . n A 1 129 ALA 129 268 268 ALA ALA A . n A 1 130 ALA 130 269 269 ALA ALA A . n A 1 131 PHE 131 270 270 PHE PHE A . n A 1 132 ALA 132 271 271 ALA ALA A . n A 1 133 ASP 133 272 272 ASP ASP A . n A 1 134 ALA 134 273 273 ALA ALA A . n A 1 135 PRO 135 274 274 PRO PRO A . n A 1 136 VAL 136 275 275 VAL VAL A . n A 1 137 VAL 137 276 276 VAL VAL A . n A 1 138 ILE 138 277 277 ILE ILE A . n A 1 139 GLY 139 278 278 GLY GLY A . n A 1 140 PRO 140 279 279 PRO PRO A . n A 1 141 THR 141 280 280 THR THR A . n A 1 142 ALA 142 281 281 ALA ALA A . n A 1 143 PRO 143 282 282 PRO PRO A . n A 1 144 MET 144 283 283 MET MET A . n A 1 145 LEU 145 284 284 LEU LEU A . n A 1 146 THR 146 285 285 THR THR A . n A 1 147 ALA 147 286 286 ALA ALA A . n A 1 148 ALA 148 287 287 ALA ALA A . n A 1 149 HIS 149 288 288 HIS HIS A . n A 1 150 ARG 150 289 289 ARG ARG A . n A 1 151 SER 151 290 290 SER SER A . n A 1 152 ALA 152 291 291 ALA ALA A . n A 1 153 SER 153 292 292 SER SER A . n A 1 154 GLU 154 293 293 GLU GLU A . n A 1 155 ALA 155 294 294 ALA ALA A . n A 1 156 ILE 156 295 295 ILE ILE A . n A 1 157 SER 157 296 296 SER SER A . n A 1 158 GLY 158 297 297 GLY GLY A . n A 1 159 MET 159 298 298 MET MET A . n A 1 160 ASN 160 299 299 ASN ASN A . n A 1 161 ALA 161 300 300 ALA ALA A . n A 1 162 VAL 162 301 301 VAL VAL A . n A 1 163 ALA 163 302 302 ALA ALA A . n A 1 164 GLY 164 303 303 GLY GLY A . n A 1 165 TRP 165 304 304 TRP TRP A . n A 1 166 ARG 166 305 305 ARG ARG A . n A 1 167 GLY 167 306 306 GLY GLY A . n A 1 168 ALA 168 307 307 ALA ALA A . n A 1 169 PRO 169 308 308 PRO PRO A . n A 1 170 ARG 170 309 309 ARG ARG A . n A 1 171 PRO 171 310 310 PRO PRO A . n A 1 172 VAL 172 311 311 VAL VAL A . n A 1 173 LEU 173 312 312 LEU LEU A . n A 1 174 ALA 174 313 313 ALA ALA A . n A 1 175 ARG 175 314 314 ARG ARG A . n A 1 176 GLU 176 315 315 GLU GLU A . n A 1 177 LEU 177 316 316 LEU LEU A . n A 1 178 LEU 178 317 317 LEU LEU A . n A 1 179 PRO 179 318 318 PRO PRO A . n A 1 180 GLU 180 319 319 GLU GLU A . n A 1 181 ARG 181 320 320 ARG ARG A . n A 1 182 ALA 182 321 321 ALA ALA A . n A 1 183 LEU 183 322 322 LEU LEU A . n A 1 184 MET 184 323 323 MET MET A . n A 1 185 GLY 185 324 324 GLY GLY A . n A 1 186 ASP 186 325 325 ASP ASP A . n A 1 187 ALA 187 326 326 ALA ALA A . n A 1 188 SER 188 327 327 SER SER A . n A 1 189 ALA 189 328 328 ALA ALA A . n A 1 190 ILE 190 329 329 ILE ILE A . n A 1 191 VAL 191 330 330 VAL VAL A . n A 1 192 ALA 192 331 331 ALA ALA A . n A 1 193 LEU 193 332 332 LEU LEU A . n A 1 194 HIS 194 333 333 HIS HIS A . n A 1 195 THR 195 334 334 THR THR A . n A 1 196 ASP 196 335 335 ASP ASP A . n A 1 197 VAL 197 336 336 VAL VAL A . n A 1 198 MET 198 337 337 MET MET A . n A 1 199 ARG 199 338 338 ARG ARG A . n A 1 200 PRO 200 339 339 PRO PRO A . n A 1 201 LEU 201 340 340 LEU LEU A . n A 1 202 ALA 202 341 341 ALA ALA A . n A 1 203 ASP 203 342 342 ASP ASP A . n A 1 204 ALA 204 343 343 ALA ALA A . n A 1 205 GLY 205 344 344 GLY GLY A . n A 1 206 PRO 206 345 345 PRO PRO A . n A 1 207 THR 207 346 346 THR THR A . n A 1 208 LEU 208 347 347 LEU LEU A . n A 1 209 ILE 209 348 348 ILE ILE A . n A 1 210 GLU 210 349 349 GLU GLU A . n A 1 211 THR 211 350 350 THR THR A . n A 1 212 LEU 212 351 351 LEU LEU A . n A 1 213 ASP 213 352 352 ASP ASP A . n A 1 214 ALA 214 353 353 ALA ALA A . n A 1 215 TYR 215 354 354 TYR TYR A . n A 1 216 LEU 216 355 355 LEU LEU A . n A 1 217 ASP 217 356 356 ASP ASP A . n A 1 218 CYS 218 357 357 CYS CYS A . n A 1 219 GLY 219 358 358 GLY GLY A . n A 1 220 GLY 220 359 359 GLY GLY A . n A 1 221 ALA 221 360 360 ALA ALA A . n A 1 222 ILE 222 361 361 ILE ILE A . n A 1 223 GLU 223 362 362 GLU GLU A . n A 1 224 ALA 224 363 363 ALA ALA A . n A 1 225 CYS 225 364 364 CYS CYS A . n A 1 226 ALA 226 365 365 ALA ALA A . n A 1 227 ARG 227 366 366 ARG ARG A . n A 1 228 LYS 228 367 367 LYS LYS A . n A 1 229 LEU 229 368 368 LEU LEU A . n A 1 230 PHE 230 369 369 PHE PHE A . n A 1 231 VAL 231 370 370 VAL VAL A . n A 1 232 HIS 232 371 371 HIS HIS A . n A 1 233 PRO 233 372 372 PRO PRO A . n A 1 234 ASN 234 373 373 ASN ASN A . n A 1 235 THR 235 374 374 THR THR A . n A 1 236 VAL 236 375 375 VAL VAL A . n A 1 237 ARG 237 376 376 ARG ARG A . n A 1 238 TYR 238 377 377 TYR TYR A . n A 1 239 ARG 239 378 378 ARG ARG A . n A 1 240 LEU 240 379 379 LEU LEU A . n A 1 241 LYS 241 380 380 LYS LYS A . n A 1 242 ARG 242 381 381 ARG ARG A . n A 1 243 ILE 243 382 382 ILE ILE A . n A 1 244 THR 244 383 383 THR THR A . n A 1 245 ASP 245 384 384 ASP ASP A . n A 1 246 PHE 246 385 385 PHE PHE A . n A 1 247 THR 247 386 386 THR THR A . n A 1 248 GLY 248 387 387 GLY GLY A . n A 1 249 ARG 249 388 388 ARG ARG A . n A 1 250 ASP 250 389 389 ASP ASP A . n A 1 251 PRO 251 390 390 PRO PRO A . n A 1 252 THR 252 391 391 THR THR A . n A 1 253 GLN 253 392 392 GLN GLN A . n A 1 254 PRO 254 393 393 PRO PRO A . n A 1 255 ARG 255 394 394 ARG ARG A . n A 1 256 ASP 256 395 395 ASP ASP A . n A 1 257 ALA 257 396 396 ALA ALA A . n A 1 258 TYR 258 397 397 TYR TYR A . n A 1 259 VAL 259 398 398 VAL VAL A . n A 1 260 LEU 260 399 399 LEU LEU A . n A 1 261 ARG 261 400 400 ARG ARG A . n A 1 262 VAL 262 401 401 VAL VAL A . n A 1 263 ALA 263 402 402 ALA ALA A . n A 1 264 ALA 264 403 403 ALA ALA A . n A 1 265 THR 265 404 404 THR THR A . n A 1 266 VAL 266 405 405 VAL VAL A . n A 1 267 GLY 267 406 406 GLY GLY A . n A 1 268 GLN 268 407 407 GLN GLN A . n A 1 269 LEU 269 408 408 LEU LEU A . n A 1 270 ASN 270 409 409 ASN ASN A . n A 1 271 TYR 271 410 ? ? ? A . n A 1 272 PRO 272 411 ? ? ? A . n A 1 273 THR 273 412 ? ? ? A . n A 1 274 PRO 274 413 ? ? ? A . n A 1 275 HIS 275 414 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TRS 1 501 501 TRS TRS A . C 3 NA 1 502 1 NA NA A . D 4 HOH 1 601 9 HOH HOH A . D 4 HOH 2 602 40 HOH HOH A . D 4 HOH 3 603 5 HOH HOH A . D 4 HOH 4 604 39 HOH HOH A . D 4 HOH 5 605 44 HOH HOH A . D 4 HOH 6 606 42 HOH HOH A . D 4 HOH 7 607 33 HOH HOH A . D 4 HOH 8 608 31 HOH HOH A . D 4 HOH 9 609 4 HOH HOH A . D 4 HOH 10 610 37 HOH HOH A . D 4 HOH 11 611 21 HOH HOH A . D 4 HOH 12 612 14 HOH HOH A . D 4 HOH 13 613 28 HOH HOH A . D 4 HOH 14 614 41 HOH HOH A . D 4 HOH 15 615 36 HOH HOH A . D 4 HOH 16 616 34 HOH HOH A . D 4 HOH 17 617 38 HOH HOH A . D 4 HOH 18 618 3 HOH HOH A . D 4 HOH 19 619 27 HOH HOH A . D 4 HOH 20 620 8 HOH HOH A . D 4 HOH 21 621 13 HOH HOH A . D 4 HOH 22 622 6 HOH HOH A . D 4 HOH 23 623 12 HOH HOH A . D 4 HOH 24 624 20 HOH HOH A . D 4 HOH 25 625 7 HOH HOH A . D 4 HOH 26 626 22 HOH HOH A . D 4 HOH 27 627 17 HOH HOH A . D 4 HOH 28 628 10 HOH HOH A . D 4 HOH 29 629 16 HOH HOH A . D 4 HOH 30 630 2 HOH HOH A . D 4 HOH 31 631 43 HOH HOH A . D 4 HOH 32 632 15 HOH HOH A . D 4 HOH 33 633 25 HOH HOH A . D 4 HOH 34 634 26 HOH HOH A . D 4 HOH 35 635 1 HOH HOH A . D 4 HOH 36 636 32 HOH HOH A . D 4 HOH 37 637 35 HOH HOH A . D 4 HOH 38 638 29 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 168 ? CG ? A ARG 29 CG 2 1 Y 1 A ARG 168 ? CD ? A ARG 29 CD 3 1 Y 1 A ARG 168 ? NE ? A ARG 29 NE 4 1 Y 1 A ARG 168 ? CZ ? A ARG 29 CZ 5 1 Y 1 A ARG 168 ? NH1 ? A ARG 29 NH1 6 1 Y 1 A ARG 168 ? NH2 ? A ARG 29 NH2 7 1 Y 1 A ASN 213 ? CG ? A ASN 74 CG 8 1 Y 1 A ASN 213 ? OD1 ? A ASN 74 OD1 9 1 Y 1 A ASN 213 ? ND2 ? A ASN 74 ND2 10 1 Y 1 A ASN 216 ? CG ? A ASN 77 CG 11 1 Y 1 A ASN 216 ? OD1 ? A ASN 77 OD1 12 1 Y 1 A ASN 216 ? ND2 ? A ASN 77 ND2 13 1 Y 1 A ASP 218 ? CG ? A ASP 79 CG 14 1 Y 1 A ASP 218 ? OD1 ? A ASP 79 OD1 15 1 Y 1 A ASP 218 ? OD2 ? A ASP 79 OD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0405 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20190315 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20190315 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELXD ? ? ? 2016/1 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? 11.7.02 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9F80 _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.040 _cell.length_a_esd ? _cell.length_b 75.280 _cell.length_b_esd ? _cell.length_c 139.520 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9F80 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9F80 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'SLOW COOLING' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20 mM HEPES, pH7.5, 400 mM NaCl, 5% glycerol, 5 mM beta-mercaptoethanol, 400 mM imidazole, temperature 277K, slow cooling' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9786 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 2' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9F80 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.027 _reflns.d_resolution_low 48.378 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21908 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.81 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.073 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.732 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.027 _reflns_shell.d_res_low 2.15 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3440 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.5 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.353 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.681 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.5 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 1.995 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -0.834 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -1.161 _refine.B_iso_max ? _refine.B_iso_mean 51.793 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.965 _refine.correlation_coeff_Fo_to_Fc_free 0.945 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9F80 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.027 _refine.ls_d_res_low 48.378 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21908 _refine.ls_number_reflns_R_free 1096 _refine.ls_number_reflns_R_work 20812 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.754 _refine.ls_percent_reflns_R_free 5.003 _refine.ls_R_factor_all 0.199 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2543 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1964 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.150 _refine.pdbx_overall_ESU_R_Free 0.156 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.703 _refine.overall_SU_ML 0.121 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1787 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 1834 _refine_hist.d_res_high 2.027 _refine_hist.d_res_low 48.378 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.015 0.012 1829 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 1754 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.207 1.653 2501 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.703 1.577 4017 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.114 5.000 241 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 15.777 5.000 19 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.098 10.000 268 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.123 10.000 70 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.093 0.200 297 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 0.020 2212 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 400 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.244 0.200 435 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.205 0.200 1601 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.195 0.200 934 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.088 0.200 1034 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.177 0.200 66 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.120 0.200 12 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.211 0.200 67 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.134 0.200 10 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 6.459 5.090 971 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 6.448 5.090 970 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 8.033 9.079 1209 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 8.045 9.084 1210 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 7.976 5.632 858 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 7.972 5.636 859 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 10.500 10.031 1292 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 10.496 10.030 1293 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 11.606 49.810 2048 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 11.657 49.819 2047 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.027 2.079 1581 . 77 1453 96.7742 . 0.394 . . 0.389 . . . . . 0.386 . 20 . 0.913 0.861 0.484 'X-RAY DIFFRACTION' 2.079 2.136 1588 . 79 1509 100.0000 . 0.303 . . 0.302 . . . . . 0.292 . 20 . 0.945 0.912 0.315 'X-RAY DIFFRACTION' 2.136 2.198 1483 . 74 1409 100.0000 . 0.281 . . 0.279 . . . . . 0.261 . 20 . 0.951 0.949 0.319 'X-RAY DIFFRACTION' 2.198 2.265 1486 . 74 1411 99.9327 . 0.292 . . 0.290 . . . . . 0.265 . 20 . 0.948 0.922 0.327 'X-RAY DIFFRACTION' 2.265 2.339 1449 . 73 1376 100.0000 . 0.225 . . 0.222 . . . . . 0.195 . 20 . 0.970 0.956 0.281 'X-RAY DIFFRACTION' 2.339 2.421 1366 . 68 1298 100.0000 . 0.205 . . 0.203 . . . . . 0.178 . 20 . 0.976 0.965 0.239 'X-RAY DIFFRACTION' 2.421 2.513 1339 . 67 1272 100.0000 . 0.209 . . 0.207 . . . . . 0.177 . 20 . 0.974 0.957 0.250 'X-RAY DIFFRACTION' 2.513 2.615 1287 . 65 1222 100.0000 . 0.226 . . 0.221 . . . . . 0.193 . 20 . 0.970 0.928 0.333 'X-RAY DIFFRACTION' 2.615 2.731 1259 . 62 1197 100.0000 . 0.214 . . 0.209 . . . . . 0.183 . 20 . 0.975 0.938 0.310 'X-RAY DIFFRACTION' 2.731 2.864 1173 . 59 1114 100.0000 . 0.202 . . 0.197 . . . . . 0.175 . 20 . 0.978 0.939 0.294 'X-RAY DIFFRACTION' 2.864 3.018 1133 . 57 1076 100.0000 . 0.218 . . 0.215 . . . . . 0.191 . 20 . 0.974 0.963 0.264 'X-RAY DIFFRACTION' 3.018 3.200 1069 . 53 1016 100.0000 . 0.197 . . 0.193 . . . . . 0.176 . 20 . 0.978 0.957 0.279 'X-RAY DIFFRACTION' 3.200 3.420 1012 . 51 961 100.0000 . 0.206 . . 0.204 . . . . . 0.193 . 20 . 0.976 0.961 0.260 'X-RAY DIFFRACTION' 3.420 3.693 950 . 47 903 100.0000 . 0.219 . . 0.216 . . . . . 0.209 . 20 . 0.976 0.963 0.274 'X-RAY DIFFRACTION' 3.693 4.043 883 . 44 839 100.0000 . 0.193 . . 0.191 . . . . . 0.189 . 20 . 0.979 0.970 0.232 'X-RAY DIFFRACTION' 4.043 4.516 803 . 41 762 100.0000 . 0.159 . . 0.156 . . . . . 0.164 . 20 . 0.986 0.976 0.238 'X-RAY DIFFRACTION' 4.516 5.207 697 . 34 663 100.0000 . 0.162 . . 0.159 . . . . . 0.174 . 20 . 0.987 0.973 0.239 'X-RAY DIFFRACTION' 5.207 6.359 623 . 32 591 100.0000 . 0.199 . . 0.198 . . . . . 0.205 . 20 . 0.981 0.978 0.209 'X-RAY DIFFRACTION' 6.359 8.916 473 . 23 450 100.0000 . 0.146 . . 0.144 . . . . . 0.162 . 20 . 0.989 0.976 0.201 'X-RAY DIFFRACTION' 8.916 48.378 307 . 16 290 99.6743 . 0.155 . . 0.156 . . . . . 0.191 . 20 . 0.982 0.986 0.133 # _struct.entry_id 9F80 _struct.title 'Crystal structure of Rv2242 regulator C-terminal fragment (161-414)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9F80 _struct_keywords.text 'HELIX-TURN-HELIX, PUCR FAMILY, TRANSCRIPTION, TUBERCULOSIS, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y2242_MYCTU _struct_ref.pdbx_db_accession P9WPH5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ARGTWDSRMEASVVDAVVRGDTGPELLSRAAALNWDTTAPATVLVGTPAPGPNGSNSDGDSERASQDVRDTAARHGRAAL TDVHGTWLVAIVSGQLSPTEKFLKDLLAAFADAPVVIGPTAPMLTAAHRSASEAISGMNAVAGWRGAPRPVLARELLPER ALMGDASAIVALHTDVMRPLADAGPTLIETLDAYLDCGGAIEACARKLFVHPNTVRYRLKRITDFTGRDPTQPRDAYVLR VAATVGQLNYPTPH ; _struct_ref.pdbx_align_begin 161 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9F80 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 275 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P9WPH5 _struct_ref_seq.db_align_beg 161 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 414 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 161 _struct_ref_seq.pdbx_auth_seq_align_end 414 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9F80 MET A 1 ? UNP P9WPH5 ? ? 'initiating methionine' 140 1 1 9F80 GLY A 2 ? UNP P9WPH5 ? ? 'expression tag' 141 2 1 9F80 SER A 3 ? UNP P9WPH5 ? ? 'expression tag' 142 3 1 9F80 SER A 4 ? UNP P9WPH5 ? ? 'expression tag' 143 4 1 9F80 HIS A 5 ? UNP P9WPH5 ? ? 'expression tag' 144 5 1 9F80 HIS A 6 ? UNP P9WPH5 ? ? 'expression tag' 145 6 1 9F80 HIS A 7 ? UNP P9WPH5 ? ? 'expression tag' 146 7 1 9F80 HIS A 8 ? UNP P9WPH5 ? ? 'expression tag' 147 8 1 9F80 HIS A 9 ? UNP P9WPH5 ? ? 'expression tag' 148 9 1 9F80 HIS A 10 ? UNP P9WPH5 ? ? 'expression tag' 149 10 1 9F80 SER A 11 ? UNP P9WPH5 ? ? 'expression tag' 150 11 1 9F80 SER A 12 ? UNP P9WPH5 ? ? 'expression tag' 151 12 1 9F80 GLY A 13 ? UNP P9WPH5 ? ? 'expression tag' 152 13 1 9F80 LEU A 14 ? UNP P9WPH5 ? ? 'expression tag' 153 14 1 9F80 VAL A 15 ? UNP P9WPH5 ? ? 'expression tag' 154 15 1 9F80 PRO A 16 ? UNP P9WPH5 ? ? 'expression tag' 155 16 1 9F80 ARG A 17 ? UNP P9WPH5 ? ? 'expression tag' 156 17 1 9F80 GLY A 18 ? UNP P9WPH5 ? ? 'expression tag' 157 18 1 9F80 SER A 19 ? UNP P9WPH5 ? ? 'expression tag' 158 19 1 9F80 HIS A 20 ? UNP P9WPH5 ? ? 'expression tag' 159 20 1 9F80 MET A 21 ? UNP P9WPH5 ? ? 'expression tag' 160 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 260 ? 1 MORE 4 ? 1 'SSA (A^2)' 11750 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 27 ? GLY A 41 ? ASP A 166 GLY A 180 1 ? 15 HELX_P HELX_P2 AA2 GLY A 44 ? ALA A 53 ? GLY A 183 ALA A 192 1 ? 10 HELX_P HELX_P3 AA3 GLY A 80 ? HIS A 96 ? GLY A 219 HIS A 235 1 ? 17 HELX_P HELX_P4 AA4 GLU A 121 ? ALA A 129 ? GLU A 260 ALA A 268 1 ? 9 HELX_P HELX_P5 AA5 MET A 144 ? ALA A 147 ? MET A 283 ALA A 286 5 ? 4 HELX_P HELX_P6 AA6 ALA A 148 ? VAL A 162 ? ALA A 287 VAL A 301 1 ? 15 HELX_P HELX_P7 AA7 ALA A 163 ? TRP A 165 ? ALA A 302 TRP A 304 5 ? 3 HELX_P HELX_P8 AA8 LEU A 177 ? GLY A 185 ? LEU A 316 GLY A 324 1 ? 9 HELX_P HELX_P9 AA9 ASP A 186 ? VAL A 197 ? ASP A 325 VAL A 336 1 ? 12 HELX_P HELX_P10 AB1 VAL A 197 ? ASP A 203 ? VAL A 336 ASP A 342 1 ? 7 HELX_P HELX_P11 AB2 ALA A 204 ? CYS A 218 ? ALA A 343 CYS A 357 1 ? 15 HELX_P HELX_P12 AB3 ALA A 221 ? LEU A 229 ? ALA A 360 LEU A 368 1 ? 9 HELX_P HELX_P13 AB4 HIS A 232 ? GLY A 248 ? HIS A 371 GLY A 387 1 ? 17 HELX_P HELX_P14 AB5 GLN A 253 ? LEU A 269 ? GLN A 392 LEU A 408 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 218 SG ? ? ? 1_555 A CYS 225 SG ? ? A CYS 357 A CYS 364 1_555 ? ? ? ? ? ? ? 2.190 ? ? metalc1 metalc ? ? A THR 63 OG1 ? ? ? 1_555 C NA . NA ? ? A THR 202 A NA 502 1_555 ? ? ? ? ? ? ? 2.556 ? ? metalc2 metalc ? ? A VAL 113 O ? ? ? 1_555 C NA . NA ? ? A VAL 252 A NA 502 1_555 ? ? ? ? ? ? ? 2.881 ? ? metalc3 metalc ? ? A GLY 115 O ? ? ? 1_555 C NA . NA ? ? A GLY 254 A NA 502 1_555 ? ? ? ? ? ? ? 2.563 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG1 ? A THR 63 ? A THR 202 ? 1_555 NA ? C NA . ? A NA 502 ? 1_555 O ? A VAL 113 ? A VAL 252 ? 1_555 106.8 ? 2 OG1 ? A THR 63 ? A THR 202 ? 1_555 NA ? C NA . ? A NA 502 ? 1_555 O ? A GLY 115 ? A GLY 254 ? 1_555 118.1 ? 3 O ? A VAL 113 ? A VAL 252 ? 1_555 NA ? C NA . ? A NA 502 ? 1_555 O ? A GLY 115 ? A GLY 254 ? 1_555 126.7 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 218 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 225 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 357 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 364 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 170 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 309 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 171 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 310 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.45 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 100 ? HIS A 105 ? ALA A 239 HIS A 244 AA1 2 TRP A 108 ? SER A 114 ? TRP A 247 SER A 253 AA1 3 ALA A 62 ? PRO A 69 ? ALA A 201 PRO A 208 AA1 4 PHE A 131 ? ALA A 142 ? PHE A 270 ALA A 281 AA1 5 VAL A 172 ? LEU A 173 ? VAL A 311 LEU A 312 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 101 ? N LEU A 240 O ILE A 112 ? O ILE A 251 AA1 2 3 O LEU A 109 ? O LEU A 248 N GLY A 67 ? N GLY A 206 AA1 3 4 N ALA A 62 ? N ALA A 201 O ALA A 142 ? O ALA A 281 AA1 4 5 N ILE A 138 ? N ILE A 277 O VAL A 172 ? O VAL A 311 # _pdbx_entry_details.entry_id 9F80 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 HIS _pdbx_validate_rmsd_bond.auth_seq_id_1 244 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CD2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 HIS _pdbx_validate_rmsd_bond.auth_seq_id_2 244 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.413 _pdbx_validate_rmsd_bond.bond_target_value 1.354 _pdbx_validate_rmsd_bond.bond_deviation 0.059 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.009 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 237 ? ? CZ A ARG 237 ? ? NH1 A ARG 237 ? ? 116.57 120.30 -3.73 0.50 N 2 1 CG A MET 298 ? ? SD A MET 298 ? ? CE A MET 298 ? ? 88.60 100.20 -11.60 1.60 N 3 1 NE A ARG 305 ? ? CZ A ARG 305 ? ? NH2 A ARG 305 ? ? 123.70 120.30 3.40 0.50 N 4 1 NE A ARG 376 ? ? CZ A ARG 376 ? ? NH1 A ARG 376 ? ? 125.31 120.30 5.01 0.50 N 5 1 NE A ARG 376 ? ? CZ A ARG 376 ? ? NH2 A ARG 376 ? ? 114.58 120.30 -5.72 0.50 N 6 1 CG A ARG 381 ? ? CD A ARG 381 ? ? NE A ARG 381 ? ? 93.18 111.80 -18.62 2.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 181 ? ? -104.29 71.19 2 1 THR A 182 ? ? -117.58 58.82 3 1 VAL A 336 ? ? -124.89 -54.12 4 1 LEU A 408 ? ? -103.29 64.29 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 189 ? ? 0.074 'SIDE CHAIN' 2 1 ARG A 229 ? ? 0.095 'SIDE CHAIN' 3 1 ARG A 237 ? ? 0.194 'SIDE CHAIN' 4 1 ARG A 366 ? ? 0.154 'SIDE CHAIN' 5 1 ARG A 381 ? ? 0.095 'SIDE CHAIN' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 624 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 140 ? A MET 1 2 1 Y 1 A GLY 141 ? A GLY 2 3 1 Y 1 A SER 142 ? A SER 3 4 1 Y 1 A SER 143 ? A SER 4 5 1 Y 1 A HIS 144 ? A HIS 5 6 1 Y 1 A HIS 145 ? A HIS 6 7 1 Y 1 A HIS 146 ? A HIS 7 8 1 Y 1 A HIS 147 ? A HIS 8 9 1 Y 1 A HIS 148 ? A HIS 9 10 1 Y 1 A HIS 149 ? A HIS 10 11 1 Y 1 A SER 150 ? A SER 11 12 1 Y 1 A SER 151 ? A SER 12 13 1 Y 1 A GLY 152 ? A GLY 13 14 1 Y 1 A LEU 153 ? A LEU 14 15 1 Y 1 A VAL 154 ? A VAL 15 16 1 Y 1 A PRO 155 ? A PRO 16 17 1 Y 1 A ARG 156 ? A ARG 17 18 1 Y 1 A GLY 157 ? A GLY 18 19 1 Y 1 A SER 158 ? A SER 19 20 1 Y 1 A HIS 159 ? A HIS 20 21 1 Y 1 A MET 160 ? A MET 21 22 1 Y 1 A ALA 161 ? A ALA 22 23 1 Y 1 A ARG 162 ? A ARG 23 24 1 Y 1 A GLY 163 ? A GLY 24 25 1 Y 1 A THR 164 ? A THR 25 26 1 Y 1 A GLY 214 ? A GLY 75 27 1 Y 1 A SER 215 ? A SER 76 28 1 Y 1 A TYR 410 ? A TYR 271 29 1 Y 1 A PRO 411 ? A PRO 272 30 1 Y 1 A THR 412 ? A THR 273 31 1 Y 1 A PRO 413 ? A PRO 274 32 1 Y 1 A HIS 414 ? A HIS 275 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NA NA NA N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TRS C C N N 349 TRS C1 C N N 350 TRS C2 C N N 351 TRS C3 C N N 352 TRS N N N N 353 TRS O1 O N N 354 TRS O2 O N N 355 TRS O3 O N N 356 TRS H11 H N N 357 TRS H12 H N N 358 TRS H21 H N N 359 TRS H22 H N N 360 TRS H31 H N N 361 TRS H32 H N N 362 TRS HN1 H N N 363 TRS HN2 H N N 364 TRS HN3 H N N 365 TRS HO1 H N N 366 TRS HO2 H N N 367 TRS HO3 H N N 368 TYR N N N N 369 TYR CA C N S 370 TYR C C N N 371 TYR O O N N 372 TYR CB C N N 373 TYR CG C Y N 374 TYR CD1 C Y N 375 TYR CD2 C Y N 376 TYR CE1 C Y N 377 TYR CE2 C Y N 378 TYR CZ C Y N 379 TYR OH O N N 380 TYR OXT O N N 381 TYR H H N N 382 TYR H2 H N N 383 TYR HA H N N 384 TYR HB2 H N N 385 TYR HB3 H N N 386 TYR HD1 H N N 387 TYR HD2 H N N 388 TYR HE1 H N N 389 TYR HE2 H N N 390 TYR HH H N N 391 TYR HXT H N N 392 VAL N N N N 393 VAL CA C N S 394 VAL C C N N 395 VAL O O N N 396 VAL CB C N N 397 VAL CG1 C N N 398 VAL CG2 C N N 399 VAL OXT O N N 400 VAL H H N N 401 VAL H2 H N N 402 VAL HA H N N 403 VAL HB H N N 404 VAL HG11 H N N 405 VAL HG12 H N N 406 VAL HG13 H N N 407 VAL HG21 H N N 408 VAL HG22 H N N 409 VAL HG23 H N N 410 VAL HXT H N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TRS C C1 sing N N 334 TRS C C2 sing N N 335 TRS C C3 sing N N 336 TRS C N sing N N 337 TRS C1 O1 sing N N 338 TRS C1 H11 sing N N 339 TRS C1 H12 sing N N 340 TRS C2 O2 sing N N 341 TRS C2 H21 sing N N 342 TRS C2 H22 sing N N 343 TRS C3 O3 sing N N 344 TRS C3 H31 sing N N 345 TRS C3 H32 sing N N 346 TRS N HN1 sing N N 347 TRS N HN2 sing N N 348 TRS N HN3 sing N N 349 TRS O1 HO1 sing N N 350 TRS O2 HO2 sing N N 351 TRS O3 HO3 sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _pdbx_audit_support.funding_organization 'Fonds National de la Recherche Scientifique (FNRS)' _pdbx_audit_support.country Belgium _pdbx_audit_support.grant_number CR40003580 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 9F80 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015863 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013284 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007167 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 NA 11 11 4.7659 3.2850 3.1758 8.8422 1.2683 0.3136 1.1136 129.4240 0.7332 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0493 # loop_ #