data_9FKZ # _entry.id 9FKZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9FKZ pdb_00009fkz 10.2210/pdb9fkz/pdb WWPDB D_1292137724 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-10-02 2 'Structure model' 1 1 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_entry_details 4 2 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 2 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9FKZ _pdbx_database_status.recvd_initial_deposition_date 2024-06-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email David.Hargreaves@astrazeneca.com _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Hargreaves _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4441-0039 # _audit_author.name 'Hargreaves, D.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0003-4441-0039 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 67 _citation.language ? _citation.page_first 16455 _citation.page_last 16479 _citation.title 'Structure-Based Optimization of a Series of Covalent, Cell Active Bfl-1 Inhibitors.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.4c01288 _citation.pdbx_database_id_PubMed 39291659 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lucas, S.C.C.' 1 ? primary 'Blackwell, J.H.' 2 ? primary 'Borjesson, U.' 3 ? primary 'Hargreaves, D.' 4 ? primary 'Milbradt, A.G.' 5 ? primary 'Bostock, M.J.' 6 ? primary 'Ahmed, S.' 7 ? primary 'Beaumont, K.' 8 ? primary 'Cheung, T.' 9 ? primary 'Demanze, S.' 10 ? primary 'Gohlke, A.' 11 ? primary 'Guerot, C.' 12 ? primary 'Haider, A.' 13 ? primary 'Kantae, V.' 14 ? primary 'Kauffman, G.W.' 15 ? primary 'Kinzel, O.' 16 ? primary 'Kupcova, L.' 17 ? primary 'Lainchbury, M.D.' 18 ? primary 'Lamb, M.L.' 19 ? primary 'Leon, L.' 20 ? primary 'Palisse, A.' 21 ? primary 'Sacchetto, C.' 22 ? primary 'Storer, R.I.' 23 ? primary 'Su, N.' 24 ? primary 'Thomson, C.' 25 ? primary 'Vales, J.' 26 ? primary 'Chen, Y.' 27 ? primary 'Hu, X.' 28 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bcl-2-related protein A1' 17442.889 1 ? ? ? ? 2 non-polymer syn '~{N}-[4-[(1~{R},3~{R})-3-azanylcyclopentyl]oxyphenyl]-~{N}-[(4-chlorophenyl)methyl]prop-2-enamide' 370.873 1 ? ? ? ? 3 water nat water 18.015 51 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bcl-2-like protein 5,Bcl2-L-5,Hemopoietic-specific early response protein,Protein BFL-1,Protein GRS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEF EDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK ; _entity_poly.pdbx_seq_one_letter_code_can ;GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEF EDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-[4-[(1~{R},3~{R})-3-azanylcyclopentyl]oxyphenyl]-~{N}-[(4-chlorophenyl)methyl]prop-2-enamide' A1IDO 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 THR n 1 4 ASP n 1 5 CYS n 1 6 GLU n 1 7 PHE n 1 8 GLY n 1 9 TYR n 1 10 ILE n 1 11 TYR n 1 12 ARG n 1 13 LEU n 1 14 ALA n 1 15 GLN n 1 16 ASP n 1 17 TYR n 1 18 LEU n 1 19 GLN n 1 20 CYS n 1 21 VAL n 1 22 LEU n 1 23 GLN n 1 24 ILE n 1 25 PRO n 1 26 GLN n 1 27 PRO n 1 28 GLY n 1 29 SER n 1 30 GLY n 1 31 PRO n 1 32 SER n 1 33 LYS n 1 34 THR n 1 35 SER n 1 36 ARG n 1 37 VAL n 1 38 LEU n 1 39 GLN n 1 40 ASN n 1 41 VAL n 1 42 ALA n 1 43 PHE n 1 44 SER n 1 45 VAL n 1 46 GLN n 1 47 LYS n 1 48 GLU n 1 49 VAL n 1 50 GLU n 1 51 LYS n 1 52 ASN n 1 53 LEU n 1 54 LYS n 1 55 SER n 1 56 CYS n 1 57 LEU n 1 58 ASP n 1 59 ASN n 1 60 VAL n 1 61 ASN n 1 62 VAL n 1 63 VAL n 1 64 SER n 1 65 VAL n 1 66 ASP n 1 67 THR n 1 68 ALA n 1 69 ARG n 1 70 THR n 1 71 LEU n 1 72 PHE n 1 73 ASN n 1 74 GLN n 1 75 VAL n 1 76 MET n 1 77 GLU n 1 78 LYS n 1 79 GLU n 1 80 PHE n 1 81 GLU n 1 82 ASP n 1 83 GLY n 1 84 ILE n 1 85 ILE n 1 86 ASN n 1 87 TRP n 1 88 GLY n 1 89 ARG n 1 90 ILE n 1 91 VAL n 1 92 THR n 1 93 ILE n 1 94 PHE n 1 95 ALA n 1 96 PHE n 1 97 GLU n 1 98 GLY n 1 99 ILE n 1 100 LEU n 1 101 ILE n 1 102 LYS n 1 103 LYS n 1 104 LEU n 1 105 LEU n 1 106 ARG n 1 107 GLN n 1 108 GLN n 1 109 ILE n 1 110 ALA n 1 111 PRO n 1 112 ASP n 1 113 VAL n 1 114 ASP n 1 115 THR n 1 116 TYR n 1 117 LYS n 1 118 GLU n 1 119 ILE n 1 120 SER n 1 121 TYR n 1 122 PHE n 1 123 VAL n 1 124 ALA n 1 125 GLU n 1 126 PHE n 1 127 ILE n 1 128 MET n 1 129 ASN n 1 130 ASN n 1 131 THR n 1 132 GLY n 1 133 GLU n 1 134 TRP n 1 135 ILE n 1 136 ARG n 1 137 GLN n 1 138 ASN n 1 139 GLY n 1 140 GLY n 1 141 TRP n 1 142 GLU n 1 143 ASN n 1 144 GLY n 1 145 PHE n 1 146 VAL n 1 147 LYS n 1 148 LYS n 1 149 PHE n 1 150 GLU n 1 151 PRO n 1 152 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 152 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BCL2A1, BCL2L5, BFL1, GRS, HBPA1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Petrachloros mirabilis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 2918835 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1IDO non-polymer . '~{N}-[4-[(1~{R},3~{R})-3-azanylcyclopentyl]oxyphenyl]-~{N}-[(4-chlorophenyl)methyl]prop-2-enamide' ? 'C21 H23 Cl N2 O2' 370.873 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 THR 3 2 2 THR THR A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 CYS 5 4 4 CYS CYS A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 PHE 7 6 6 PHE PHE A . n A 1 8 GLY 8 7 7 GLY GLY A . n A 1 9 TYR 9 8 8 TYR TYR A . n A 1 10 ILE 10 9 9 ILE ILE A . n A 1 11 TYR 11 10 10 TYR TYR A . n A 1 12 ARG 12 11 11 ARG ARG A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 ALA 14 13 13 ALA ALA A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 ASP 16 15 15 ASP ASP A . n A 1 17 TYR 17 16 16 TYR TYR A . n A 1 18 LEU 18 17 17 LEU LEU A . n A 1 19 GLN 19 18 18 GLN GLN A . n A 1 20 CYS 20 19 19 CYS CYS A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 GLN 23 22 22 GLN GLN A . n A 1 24 ILE 24 23 23 ILE ILE A . n A 1 25 PRO 25 24 24 PRO PRO A . n A 1 26 GLN 26 25 25 GLN GLN A . n A 1 27 PRO 27 26 26 PRO PRO A . n A 1 28 GLY 28 27 27 GLY GLY A . n A 1 29 SER 29 28 28 SER SER A . n A 1 30 GLY 30 29 29 GLY GLY A . n A 1 31 PRO 31 30 30 PRO PRO A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 LYS 33 32 32 LYS LYS A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 SER 35 34 34 SER SER A . n A 1 36 ARG 36 35 35 ARG ARG A . n A 1 37 VAL 37 36 36 VAL VAL A . n A 1 38 LEU 38 37 37 LEU LEU A . n A 1 39 GLN 39 38 38 GLN GLN A . n A 1 40 ASN 40 39 39 ASN ASN A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 ALA 42 41 41 ALA ALA A . n A 1 43 PHE 43 42 42 PHE PHE A . n A 1 44 SER 44 43 43 SER SER A . n A 1 45 VAL 45 44 44 VAL VAL A . n A 1 46 GLN 46 45 45 GLN GLN A . n A 1 47 LYS 47 46 46 LYS LYS A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 GLU 50 49 49 GLU GLU A . n A 1 51 LYS 51 50 50 LYS LYS A . n A 1 52 ASN 52 51 51 ASN ASN A . n A 1 53 LEU 53 52 52 LEU LEU A . n A 1 54 LYS 54 53 53 LYS LYS A . n A 1 55 SER 55 54 54 SER SER A . n A 1 56 CYS 56 55 55 CYS CYS A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 ASN 59 58 58 ASN ASN A . n A 1 60 VAL 60 59 59 VAL VAL A . n A 1 61 ASN 61 60 60 ASN ASN A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 VAL 63 62 62 VAL VAL A . n A 1 64 SER 64 63 63 SER SER A . n A 1 65 VAL 65 64 64 VAL VAL A . n A 1 66 ASP 66 65 65 ASP ASP A . n A 1 67 THR 67 66 66 THR THR A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 ARG 69 68 68 ARG ARG A . n A 1 70 THR 70 69 69 THR THR A . n A 1 71 LEU 71 70 70 LEU LEU A . n A 1 72 PHE 72 71 71 PHE PHE A . n A 1 73 ASN 73 72 72 ASN ASN A . n A 1 74 GLN 74 73 73 GLN GLN A . n A 1 75 VAL 75 74 74 VAL VAL A . n A 1 76 MET 76 75 75 MET MET A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 GLU 79 78 78 GLU GLU A . n A 1 80 PHE 80 79 79 PHE PHE A . n A 1 81 GLU 81 80 80 GLU GLU A . n A 1 82 ASP 82 81 81 ASP ASP A . n A 1 83 GLY 83 82 82 GLY GLY A . n A 1 84 ILE 84 83 83 ILE ILE A . n A 1 85 ILE 85 84 84 ILE ILE A . n A 1 86 ASN 86 85 85 ASN ASN A . n A 1 87 TRP 87 86 86 TRP TRP A . n A 1 88 GLY 88 87 87 GLY GLY A . n A 1 89 ARG 89 88 88 ARG ARG A . n A 1 90 ILE 90 89 89 ILE ILE A . n A 1 91 VAL 91 90 90 VAL VAL A . n A 1 92 THR 92 91 91 THR THR A . n A 1 93 ILE 93 92 92 ILE ILE A . n A 1 94 PHE 94 93 93 PHE PHE A . n A 1 95 ALA 95 94 94 ALA ALA A . n A 1 96 PHE 96 95 95 PHE PHE A . n A 1 97 GLU 97 96 96 GLU GLU A . n A 1 98 GLY 98 97 97 GLY GLY A . n A 1 99 ILE 99 98 98 ILE ILE A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 ILE 101 100 100 ILE ILE A . n A 1 102 LYS 102 101 101 LYS LYS A . n A 1 103 LYS 103 102 102 LYS LYS A . n A 1 104 LEU 104 103 103 LEU LEU A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 ARG 106 105 105 ARG ARG A . n A 1 107 GLN 107 106 106 GLN GLN A . n A 1 108 GLN 108 107 107 GLN GLN A . n A 1 109 ILE 109 108 108 ILE ILE A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 PRO 111 110 110 PRO PRO A . n A 1 112 ASP 112 111 111 ASP ASP A . n A 1 113 VAL 113 112 112 VAL VAL A . n A 1 114 ASP 114 113 113 ASP ASP A . n A 1 115 THR 115 114 114 THR THR A . n A 1 116 TYR 116 115 115 TYR TYR A . n A 1 117 LYS 117 116 116 LYS LYS A . n A 1 118 GLU 118 117 117 GLU GLU A . n A 1 119 ILE 119 118 118 ILE ILE A . n A 1 120 SER 120 119 119 SER SER A . n A 1 121 TYR 121 120 120 TYR TYR A . n A 1 122 PHE 122 121 121 PHE PHE A . n A 1 123 VAL 123 122 122 VAL VAL A . n A 1 124 ALA 124 123 123 ALA ALA A . n A 1 125 GLU 125 124 124 GLU GLU A . n A 1 126 PHE 126 125 125 PHE PHE A . n A 1 127 ILE 127 126 126 ILE ILE A . n A 1 128 MET 128 127 127 MET MET A . n A 1 129 ASN 129 128 128 ASN ASN A . n A 1 130 ASN 130 129 129 ASN ASN A . n A 1 131 THR 131 130 130 THR THR A . n A 1 132 GLY 132 131 131 GLY GLY A . n A 1 133 GLU 133 132 132 GLU GLU A . n A 1 134 TRP 134 133 133 TRP TRP A . n A 1 135 ILE 135 134 134 ILE ILE A . n A 1 136 ARG 136 135 135 ARG ARG A . n A 1 137 GLN 137 136 136 GLN GLN A . n A 1 138 ASN 138 137 137 ASN ASN A . n A 1 139 GLY 139 138 138 GLY GLY A . n A 1 140 GLY 140 139 139 GLY GLY A . n A 1 141 TRP 141 140 140 TRP TRP A . n A 1 142 GLU 142 141 141 GLU GLU A . n A 1 143 ASN 143 142 142 ASN ASN A . n A 1 144 GLY 144 143 143 GLY GLY A . n A 1 145 PHE 145 144 144 PHE PHE A . n A 1 146 VAL 146 145 145 VAL VAL A . n A 1 147 LYS 147 146 146 LYS LYS A . n A 1 148 LYS 148 147 147 LYS LYS A . n A 1 149 PHE 149 148 148 PHE PHE A . n A 1 150 GLU 150 149 149 GLU GLU A . n A 1 151 PRO 151 150 150 PRO PRO A . n A 1 152 LYS 152 151 151 LYS LYS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1IDO _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1IDO _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1IDO 1 201 201 A1IDO INH A . C 3 HOH 1 301 8 HOH HOH A . C 3 HOH 2 302 25 HOH HOH A . C 3 HOH 3 303 14 HOH HOH A . C 3 HOH 4 304 16 HOH HOH A . C 3 HOH 5 305 3 HOH HOH A . C 3 HOH 6 306 9 HOH HOH A . C 3 HOH 7 307 1 HOH HOH A . C 3 HOH 8 308 7 HOH HOH A . C 3 HOH 9 309 50 HOH HOH A . C 3 HOH 10 310 34 HOH HOH A . C 3 HOH 11 311 38 HOH HOH A . C 3 HOH 12 312 21 HOH HOH A . C 3 HOH 13 313 42 HOH HOH A . C 3 HOH 14 314 13 HOH HOH A . C 3 HOH 15 315 6 HOH HOH A . C 3 HOH 16 316 29 HOH HOH A . C 3 HOH 17 317 11 HOH HOH A . C 3 HOH 18 318 2 HOH HOH A . C 3 HOH 19 319 18 HOH HOH A . C 3 HOH 20 320 51 HOH HOH A . C 3 HOH 21 321 41 HOH HOH A . C 3 HOH 22 322 47 HOH HOH A . C 3 HOH 23 323 39 HOH HOH A . C 3 HOH 24 324 30 HOH HOH A . C 3 HOH 25 325 46 HOH HOH A . C 3 HOH 26 326 28 HOH HOH A . C 3 HOH 27 327 12 HOH HOH A . C 3 HOH 28 328 17 HOH HOH A . C 3 HOH 29 329 48 HOH HOH A . C 3 HOH 30 330 43 HOH HOH A . C 3 HOH 31 331 22 HOH HOH A . C 3 HOH 32 332 44 HOH HOH A . C 3 HOH 33 333 19 HOH HOH A . C 3 HOH 34 334 26 HOH HOH A . C 3 HOH 35 335 5 HOH HOH A . C 3 HOH 36 336 4 HOH HOH A . C 3 HOH 37 337 15 HOH HOH A . C 3 HOH 38 338 40 HOH HOH A . C 3 HOH 39 339 31 HOH HOH A . C 3 HOH 40 340 24 HOH HOH A . C 3 HOH 41 341 32 HOH HOH A . C 3 HOH 42 342 49 HOH HOH A . C 3 HOH 43 343 45 HOH HOH A . C 3 HOH 44 344 27 HOH HOH A . C 3 HOH 45 345 10 HOH HOH A . C 3 HOH 46 346 37 HOH HOH A . C 3 HOH 47 347 23 HOH HOH A . C 3 HOH 48 348 20 HOH HOH A . C 3 HOH 49 349 33 HOH HOH A . C 3 HOH 50 350 36 HOH HOH A . C 3 HOH 51 351 35 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 5 ? CG ? A GLU 6 CG 2 1 Y 1 A GLU 5 ? CD ? A GLU 6 CD 3 1 Y 1 A GLU 5 ? OE1 ? A GLU 6 OE1 4 1 Y 1 A GLU 5 ? OE2 ? A GLU 6 OE2 5 1 Y 1 A GLU 47 ? CG ? A GLU 48 CG 6 1 Y 1 A GLU 47 ? CD ? A GLU 48 CD 7 1 Y 1 A GLU 47 ? OE1 ? A GLU 48 OE1 8 1 Y 1 A GLU 47 ? OE2 ? A GLU 48 OE2 9 1 Y 1 A LYS 116 ? CE ? A LYS 117 CE 10 1 Y 1 A LYS 116 ? NZ ? A LYS 117 NZ 11 1 Y 1 A ARG 135 ? NE ? A ARG 136 NE 12 1 Y 1 A ARG 135 ? CZ ? A ARG 136 CZ 13 1 Y 1 A ARG 135 ? NH1 ? A ARG 136 NH1 14 1 Y 1 A ARG 135 ? NH2 ? A ARG 136 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.11.8 (24-FEB-2021)' 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 95.73 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9FKZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 40.757 _cell.length_a_esd ? _cell.length_b 43.383 _cell.length_b_esd ? _cell.length_c 43.569 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9FKZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9FKZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.02 _exptl_crystal.description 'tiny rod like' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Na3 Cit 1M, PCPT 0.1M pH 7' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 310 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-07-12 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97950 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97950 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9FKZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.668 _reflns.d_resolution_low 40.553 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10198 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 88.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.668 _reflns_shell.d_res_low 1.824 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 479 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.311 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -2.49290 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] -1.49170 _refine.aniso_B[2][2] 1.87840 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 0.61450 _refine.B_iso_max ? _refine.B_iso_mean 31.92 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.905 _refine.correlation_coeff_Fo_to_Fc_free 0.830 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9FKZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.684 _refine.ls_d_res_low 40.55 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10080 _refine.ls_number_reflns_R_free 472 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 58.2 _refine.ls_percent_reflns_R_free 4.680 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2741 _refine.ls_R_factor_R_free 0.3392 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2711 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.244 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.240 _refine.pdbx_overall_SU_R_Blow_DPI 0.275 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.278 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9FKZ _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.36 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.684 _refine_hist.d_res_low 40.55 _refine_hist.number_atoms_solvent 51 _refine_hist.number_atoms_total 1286 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1209 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1263 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 0.87 ? 1709 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 445 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 228 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1263 ? t_it 10.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.45 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 19.23 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 162 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1121 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.684 _refine_ls_shell.d_res_low 1.83 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work 410 _refine_ls_shell.percent_reflns_obs 11.38 _refine_ls_shell.percent_reflns_R_free 6.61 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3211 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.3431 # _struct.entry_id 9FKZ _struct.title 'Discovery of a Series of Covalent, Cell Active Bfl-1 Inhibitors' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9FKZ _struct_keywords.text 'Bfl-1, Bcl-2-related protein A1, covalent, APOPTOSIS' _struct_keywords.pdbx_keywords APOPTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B2LA1_HUMAN _struct_ref.pdbx_db_accession Q16548 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFE DGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9FKZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 152 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16548 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 151 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 151 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9FKZ _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q16548 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 730 ? 1 MORE -4 ? 1 'SSA (A^2)' 8540 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 6 ? GLN A 23 ? GLU A 5 GLN A 22 1 ? 18 HELX_P HELX_P2 AA2 SER A 32 ? LEU A 53 ? SER A 31 LEU A 52 1 ? 22 HELX_P HELX_P3 AA3 LEU A 53 ? ASP A 58 ? LEU A 52 ASP A 57 1 ? 6 HELX_P HELX_P4 AA4 SER A 64 ? PHE A 80 ? SER A 63 PHE A 79 1 ? 17 HELX_P HELX_P5 AA5 ASN A 86 ? GLN A 108 ? ASN A 85 GLN A 107 1 ? 23 HELX_P HELX_P6 AA6 ASP A 112 ? ASP A 114 ? ASP A 111 ASP A 113 5 ? 3 HELX_P HELX_P7 AA7 THR A 115 ? ASN A 138 ? THR A 114 ASN A 137 1 ? 24 HELX_P HELX_P8 AA8 GLY A 144 ? GLU A 150 ? GLY A 143 GLU A 149 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 56 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id A1IDO _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C20 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 55 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id A1IDO _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.770 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1IDO _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 56 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1IDO _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 55 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C20 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1IDO _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _pdbx_entry_details.entry_id 9FKZ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? 32.05 -175.19 2 1 SER A 28 ? ? 76.92 -22.01 3 1 ASP A 111 ? ? -162.01 106.14 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id 0 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1IDO C1 C N N 1 A1IDO C2 C N N 2 A1IDO C3 C N R 3 A1IDO C7 C Y N 4 A1IDO C8 C Y N 5 A1IDO C9 C Y N 6 A1IDO C10 C Y N 7 A1IDO C11 C N N 8 A1IDO C12 C Y N 9 A1IDO C13 C Y N 10 A1IDO C14 C Y N 11 A1IDO C15 C Y N 12 A1IDO C16 C Y N 13 A1IDO C19 C N N 14 A1IDO C20 C N N 15 A1IDO O1 O N N 16 A1IDO C18 C N N 17 A1IDO N1 N N N 18 A1IDO C17 C Y N 19 A1IDO CL CL N N 20 A1IDO C6 C Y N 21 A1IDO C5 C Y N 22 A1IDO O O N N 23 A1IDO C4 C N N 24 A1IDO C C N R 25 A1IDO N N N N 26 A1IDO H1 H N N 27 A1IDO H2 H N N 28 A1IDO H3 H N N 29 A1IDO H4 H N N 30 A1IDO H5 H N N 31 A1IDO H6 H N N 32 A1IDO H7 H N N 33 A1IDO H8 H N N 34 A1IDO H9 H N N 35 A1IDO H10 H N N 36 A1IDO H11 H N N 37 A1IDO H12 H N N 38 A1IDO H13 H N N 39 A1IDO H14 H N N 40 A1IDO H16 H N N 41 A1IDO H17 H N N 42 A1IDO H19 H N N 43 A1IDO H20 H N N 44 A1IDO H21 H N N 45 A1IDO H22 H N N 46 A1IDO H23 H N N 47 A1IDO H24 H N N 48 A1IDO H25 H N N 49 ALA N N N N 50 ALA CA C N S 51 ALA C C N N 52 ALA O O N N 53 ALA CB C N N 54 ALA OXT O N N 55 ALA H H N N 56 ALA H2 H N N 57 ALA HA H N N 58 ALA HB1 H N N 59 ALA HB2 H N N 60 ALA HB3 H N N 61 ALA HXT H N N 62 ARG N N N N 63 ARG CA C N S 64 ARG C C N N 65 ARG O O N N 66 ARG CB C N N 67 ARG CG C N N 68 ARG CD C N N 69 ARG NE N N N 70 ARG CZ C N N 71 ARG NH1 N N N 72 ARG NH2 N N N 73 ARG OXT O N N 74 ARG H H N N 75 ARG H2 H N N 76 ARG HA H N N 77 ARG HB2 H N N 78 ARG HB3 H N N 79 ARG HG2 H N N 80 ARG HG3 H N N 81 ARG HD2 H N N 82 ARG HD3 H N N 83 ARG HE H N N 84 ARG HH11 H N N 85 ARG HH12 H N N 86 ARG HH21 H N N 87 ARG HH22 H N N 88 ARG HXT H N N 89 ASN N N N N 90 ASN CA C N S 91 ASN C C N N 92 ASN O O N N 93 ASN CB C N N 94 ASN CG C N N 95 ASN OD1 O N N 96 ASN ND2 N N N 97 ASN OXT O N N 98 ASN H H N N 99 ASN H2 H N N 100 ASN HA H N N 101 ASN HB2 H N N 102 ASN HB3 H N N 103 ASN HD21 H N N 104 ASN HD22 H N N 105 ASN HXT H N N 106 ASP N N N N 107 ASP CA C N S 108 ASP C C N N 109 ASP O O N N 110 ASP CB C N N 111 ASP CG C N N 112 ASP OD1 O N N 113 ASP OD2 O N N 114 ASP OXT O N N 115 ASP H H N N 116 ASP H2 H N N 117 ASP HA H N N 118 ASP HB2 H N N 119 ASP HB3 H N N 120 ASP HD2 H N N 121 ASP HXT H N N 122 CYS N N N N 123 CYS CA C N R 124 CYS C C N N 125 CYS O O N N 126 CYS CB C N N 127 CYS SG S N N 128 CYS OXT O N N 129 CYS H H N N 130 CYS H2 H N N 131 CYS HA H N N 132 CYS HB2 H N N 133 CYS HB3 H N N 134 CYS HG H N N 135 CYS HXT H N N 136 GLN N N N N 137 GLN CA C N S 138 GLN C C N N 139 GLN O O N N 140 GLN CB C N N 141 GLN CG C N N 142 GLN CD C N N 143 GLN OE1 O N N 144 GLN NE2 N N N 145 GLN OXT O N N 146 GLN H H N N 147 GLN H2 H N N 148 GLN HA H N N 149 GLN HB2 H N N 150 GLN HB3 H N N 151 GLN HG2 H N N 152 GLN HG3 H N N 153 GLN HE21 H N N 154 GLN HE22 H N N 155 GLN HXT H N N 156 GLU N N N N 157 GLU CA C N S 158 GLU C C N N 159 GLU O O N N 160 GLU CB C N N 161 GLU CG C N N 162 GLU CD C N N 163 GLU OE1 O N N 164 GLU OE2 O N N 165 GLU OXT O N N 166 GLU H H N N 167 GLU H2 H N N 168 GLU HA H N N 169 GLU HB2 H N N 170 GLU HB3 H N N 171 GLU HG2 H N N 172 GLU HG3 H N N 173 GLU HE2 H N N 174 GLU HXT H N N 175 GLY N N N N 176 GLY CA C N N 177 GLY C C N N 178 GLY O O N N 179 GLY OXT O N N 180 GLY H H N N 181 GLY H2 H N N 182 GLY HA2 H N N 183 GLY HA3 H N N 184 GLY HXT H N N 185 HOH O O N N 186 HOH H1 H N N 187 HOH H2 H N N 188 ILE N N N N 189 ILE CA C N S 190 ILE C C N N 191 ILE O O N N 192 ILE CB C N S 193 ILE CG1 C N N 194 ILE CG2 C N N 195 ILE CD1 C N N 196 ILE OXT O N N 197 ILE H H N N 198 ILE H2 H N N 199 ILE HA H N N 200 ILE HB H N N 201 ILE HG12 H N N 202 ILE HG13 H N N 203 ILE HG21 H N N 204 ILE HG22 H N N 205 ILE HG23 H N N 206 ILE HD11 H N N 207 ILE HD12 H N N 208 ILE HD13 H N N 209 ILE HXT H N N 210 LEU N N N N 211 LEU CA C N S 212 LEU C C N N 213 LEU O O N N 214 LEU CB C N N 215 LEU CG C N N 216 LEU CD1 C N N 217 LEU CD2 C N N 218 LEU OXT O N N 219 LEU H H N N 220 LEU H2 H N N 221 LEU HA H N N 222 LEU HB2 H N N 223 LEU HB3 H N N 224 LEU HG H N N 225 LEU HD11 H N N 226 LEU HD12 H N N 227 LEU HD13 H N N 228 LEU HD21 H N N 229 LEU HD22 H N N 230 LEU HD23 H N N 231 LEU HXT H N N 232 LYS N N N N 233 LYS CA C N S 234 LYS C C N N 235 LYS O O N N 236 LYS CB C N N 237 LYS CG C N N 238 LYS CD C N N 239 LYS CE C N N 240 LYS NZ N N N 241 LYS OXT O N N 242 LYS H H N N 243 LYS H2 H N N 244 LYS HA H N N 245 LYS HB2 H N N 246 LYS HB3 H N N 247 LYS HG2 H N N 248 LYS HG3 H N N 249 LYS HD2 H N N 250 LYS HD3 H N N 251 LYS HE2 H N N 252 LYS HE3 H N N 253 LYS HZ1 H N N 254 LYS HZ2 H N N 255 LYS HZ3 H N N 256 LYS HXT H N N 257 MET N N N N 258 MET CA C N S 259 MET C C N N 260 MET O O N N 261 MET CB C N N 262 MET CG C N N 263 MET SD S N N 264 MET CE C N N 265 MET OXT O N N 266 MET H H N N 267 MET H2 H N N 268 MET HA H N N 269 MET HB2 H N N 270 MET HB3 H N N 271 MET HG2 H N N 272 MET HG3 H N N 273 MET HE1 H N N 274 MET HE2 H N N 275 MET HE3 H N N 276 MET HXT H N N 277 PHE N N N N 278 PHE CA C N S 279 PHE C C N N 280 PHE O O N N 281 PHE CB C N N 282 PHE CG C Y N 283 PHE CD1 C Y N 284 PHE CD2 C Y N 285 PHE CE1 C Y N 286 PHE CE2 C Y N 287 PHE CZ C Y N 288 PHE OXT O N N 289 PHE H H N N 290 PHE H2 H N N 291 PHE HA H N N 292 PHE HB2 H N N 293 PHE HB3 H N N 294 PHE HD1 H N N 295 PHE HD2 H N N 296 PHE HE1 H N N 297 PHE HE2 H N N 298 PHE HZ H N N 299 PHE HXT H N N 300 PRO N N N N 301 PRO CA C N S 302 PRO C C N N 303 PRO O O N N 304 PRO CB C N N 305 PRO CG C N N 306 PRO CD C N N 307 PRO OXT O N N 308 PRO H H N N 309 PRO HA H N N 310 PRO HB2 H N N 311 PRO HB3 H N N 312 PRO HG2 H N N 313 PRO HG3 H N N 314 PRO HD2 H N N 315 PRO HD3 H N N 316 PRO HXT H N N 317 SER N N N N 318 SER CA C N S 319 SER C C N N 320 SER O O N N 321 SER CB C N N 322 SER OG O N N 323 SER OXT O N N 324 SER H H N N 325 SER H2 H N N 326 SER HA H N N 327 SER HB2 H N N 328 SER HB3 H N N 329 SER HG H N N 330 SER HXT H N N 331 THR N N N N 332 THR CA C N S 333 THR C C N N 334 THR O O N N 335 THR CB C N R 336 THR OG1 O N N 337 THR CG2 C N N 338 THR OXT O N N 339 THR H H N N 340 THR H2 H N N 341 THR HA H N N 342 THR HB H N N 343 THR HG1 H N N 344 THR HG21 H N N 345 THR HG22 H N N 346 THR HG23 H N N 347 THR HXT H N N 348 TRP N N N N 349 TRP CA C N S 350 TRP C C N N 351 TRP O O N N 352 TRP CB C N N 353 TRP CG C Y N 354 TRP CD1 C Y N 355 TRP CD2 C Y N 356 TRP NE1 N Y N 357 TRP CE2 C Y N 358 TRP CE3 C Y N 359 TRP CZ2 C Y N 360 TRP CZ3 C Y N 361 TRP CH2 C Y N 362 TRP OXT O N N 363 TRP H H N N 364 TRP H2 H N N 365 TRP HA H N N 366 TRP HB2 H N N 367 TRP HB3 H N N 368 TRP HD1 H N N 369 TRP HE1 H N N 370 TRP HE3 H N N 371 TRP HZ2 H N N 372 TRP HZ3 H N N 373 TRP HH2 H N N 374 TRP HXT H N N 375 TYR N N N N 376 TYR CA C N S 377 TYR C C N N 378 TYR O O N N 379 TYR CB C N N 380 TYR CG C Y N 381 TYR CD1 C Y N 382 TYR CD2 C Y N 383 TYR CE1 C Y N 384 TYR CE2 C Y N 385 TYR CZ C Y N 386 TYR OH O N N 387 TYR OXT O N N 388 TYR H H N N 389 TYR H2 H N N 390 TYR HA H N N 391 TYR HB2 H N N 392 TYR HB3 H N N 393 TYR HD1 H N N 394 TYR HD2 H N N 395 TYR HE1 H N N 396 TYR HE2 H N N 397 TYR HH H N N 398 TYR HXT H N N 399 VAL N N N N 400 VAL CA C N S 401 VAL C C N N 402 VAL O O N N 403 VAL CB C N N 404 VAL CG1 C N N 405 VAL CG2 C N N 406 VAL OXT O N N 407 VAL H H N N 408 VAL H2 H N N 409 VAL HA H N N 410 VAL HB H N N 411 VAL HG11 H N N 412 VAL HG12 H N N 413 VAL HG13 H N N 414 VAL HG21 H N N 415 VAL HG22 H N N 416 VAL HG23 H N N 417 VAL HXT H N N 418 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1IDO C20 C19 doub N N 1 A1IDO C19 C18 sing N N 2 A1IDO C14 C13 doub Y N 3 A1IDO C14 C15 sing Y N 4 A1IDO C13 C12 sing Y N 5 A1IDO CL C15 sing N N 6 A1IDO C15 C16 doub Y N 7 A1IDO C18 O1 doub N N 8 A1IDO C18 N1 sing N N 9 A1IDO C7 C6 doub Y N 10 A1IDO C7 C8 sing Y N 11 A1IDO C12 C11 sing N N 12 A1IDO C12 C17 doub Y N 13 A1IDO N1 C11 sing N N 14 A1IDO N1 C8 sing N N 15 A1IDO C6 C5 sing Y N 16 A1IDO C16 C17 sing Y N 17 A1IDO C8 C9 doub Y N 18 A1IDO C2 C3 sing N N 19 A1IDO C2 C1 sing N N 20 A1IDO C5 O sing N N 21 A1IDO C5 C10 doub Y N 22 A1IDO C3 O sing N N 23 A1IDO C3 C4 sing N N 24 A1IDO C9 C10 sing Y N 25 A1IDO C1 C sing N N 26 A1IDO C4 C sing N N 27 A1IDO C N sing N N 28 A1IDO C1 H1 sing N N 29 A1IDO C1 H2 sing N N 30 A1IDO C2 H3 sing N N 31 A1IDO C2 H4 sing N N 32 A1IDO C3 H5 sing N N 33 A1IDO C7 H6 sing N N 34 A1IDO C9 H7 sing N N 35 A1IDO C10 H8 sing N N 36 A1IDO C11 H9 sing N N 37 A1IDO C11 H10 sing N N 38 A1IDO C13 H11 sing N N 39 A1IDO C14 H12 sing N N 40 A1IDO C16 H13 sing N N 41 A1IDO C19 H14 sing N N 42 A1IDO C20 H16 sing N N 43 A1IDO C20 H17 sing N N 44 A1IDO C17 H19 sing N N 45 A1IDO C6 H20 sing N N 46 A1IDO C4 H21 sing N N 47 A1IDO C4 H22 sing N N 48 A1IDO C H23 sing N N 49 A1IDO N H24 sing N N 50 A1IDO N H25 sing N N 51 ALA N CA sing N N 52 ALA N H sing N N 53 ALA N H2 sing N N 54 ALA CA C sing N N 55 ALA CA CB sing N N 56 ALA CA HA sing N N 57 ALA C O doub N N 58 ALA C OXT sing N N 59 ALA CB HB1 sing N N 60 ALA CB HB2 sing N N 61 ALA CB HB3 sing N N 62 ALA OXT HXT sing N N 63 ARG N CA sing N N 64 ARG N H sing N N 65 ARG N H2 sing N N 66 ARG CA C sing N N 67 ARG CA CB sing N N 68 ARG CA HA sing N N 69 ARG C O doub N N 70 ARG C OXT sing N N 71 ARG CB CG sing N N 72 ARG CB HB2 sing N N 73 ARG CB HB3 sing N N 74 ARG CG CD sing N N 75 ARG CG HG2 sing N N 76 ARG CG HG3 sing N N 77 ARG CD NE sing N N 78 ARG CD HD2 sing N N 79 ARG CD HD3 sing N N 80 ARG NE CZ sing N N 81 ARG NE HE sing N N 82 ARG CZ NH1 sing N N 83 ARG CZ NH2 doub N N 84 ARG NH1 HH11 sing N N 85 ARG NH1 HH12 sing N N 86 ARG NH2 HH21 sing N N 87 ARG NH2 HH22 sing N N 88 ARG OXT HXT sing N N 89 ASN N CA sing N N 90 ASN N H sing N N 91 ASN N H2 sing N N 92 ASN CA C sing N N 93 ASN CA CB sing N N 94 ASN CA HA sing N N 95 ASN C O doub N N 96 ASN C OXT sing N N 97 ASN CB CG sing N N 98 ASN CB HB2 sing N N 99 ASN CB HB3 sing N N 100 ASN CG OD1 doub N N 101 ASN CG ND2 sing N N 102 ASN ND2 HD21 sing N N 103 ASN ND2 HD22 sing N N 104 ASN OXT HXT sing N N 105 ASP N CA sing N N 106 ASP N H sing N N 107 ASP N H2 sing N N 108 ASP CA C sing N N 109 ASP CA CB sing N N 110 ASP CA HA sing N N 111 ASP C O doub N N 112 ASP C OXT sing N N 113 ASP CB CG sing N N 114 ASP CB HB2 sing N N 115 ASP CB HB3 sing N N 116 ASP CG OD1 doub N N 117 ASP CG OD2 sing N N 118 ASP OD2 HD2 sing N N 119 ASP OXT HXT sing N N 120 CYS N CA sing N N 121 CYS N H sing N N 122 CYS N H2 sing N N 123 CYS CA C sing N N 124 CYS CA CB sing N N 125 CYS CA HA sing N N 126 CYS C O doub N N 127 CYS C OXT sing N N 128 CYS CB SG sing N N 129 CYS CB HB2 sing N N 130 CYS CB HB3 sing N N 131 CYS SG HG sing N N 132 CYS OXT HXT sing N N 133 GLN N CA sing N N 134 GLN N H sing N N 135 GLN N H2 sing N N 136 GLN CA C sing N N 137 GLN CA CB sing N N 138 GLN CA HA sing N N 139 GLN C O doub N N 140 GLN C OXT sing N N 141 GLN CB CG sing N N 142 GLN CB HB2 sing N N 143 GLN CB HB3 sing N N 144 GLN CG CD sing N N 145 GLN CG HG2 sing N N 146 GLN CG HG3 sing N N 147 GLN CD OE1 doub N N 148 GLN CD NE2 sing N N 149 GLN NE2 HE21 sing N N 150 GLN NE2 HE22 sing N N 151 GLN OXT HXT sing N N 152 GLU N CA sing N N 153 GLU N H sing N N 154 GLU N H2 sing N N 155 GLU CA C sing N N 156 GLU CA CB sing N N 157 GLU CA HA sing N N 158 GLU C O doub N N 159 GLU C OXT sing N N 160 GLU CB CG sing N N 161 GLU CB HB2 sing N N 162 GLU CB HB3 sing N N 163 GLU CG CD sing N N 164 GLU CG HG2 sing N N 165 GLU CG HG3 sing N N 166 GLU CD OE1 doub N N 167 GLU CD OE2 sing N N 168 GLU OE2 HE2 sing N N 169 GLU OXT HXT sing N N 170 GLY N CA sing N N 171 GLY N H sing N N 172 GLY N H2 sing N N 173 GLY CA C sing N N 174 GLY CA HA2 sing N N 175 GLY CA HA3 sing N N 176 GLY C O doub N N 177 GLY C OXT sing N N 178 GLY OXT HXT sing N N 179 HOH O H1 sing N N 180 HOH O H2 sing N N 181 ILE N CA sing N N 182 ILE N H sing N N 183 ILE N H2 sing N N 184 ILE CA C sing N N 185 ILE CA CB sing N N 186 ILE CA HA sing N N 187 ILE C O doub N N 188 ILE C OXT sing N N 189 ILE CB CG1 sing N N 190 ILE CB CG2 sing N N 191 ILE CB HB sing N N 192 ILE CG1 CD1 sing N N 193 ILE CG1 HG12 sing N N 194 ILE CG1 HG13 sing N N 195 ILE CG2 HG21 sing N N 196 ILE CG2 HG22 sing N N 197 ILE CG2 HG23 sing N N 198 ILE CD1 HD11 sing N N 199 ILE CD1 HD12 sing N N 200 ILE CD1 HD13 sing N N 201 ILE OXT HXT sing N N 202 LEU N CA sing N N 203 LEU N H sing N N 204 LEU N H2 sing N N 205 LEU CA C sing N N 206 LEU CA CB sing N N 207 LEU CA HA sing N N 208 LEU C O doub N N 209 LEU C OXT sing N N 210 LEU CB CG sing N N 211 LEU CB HB2 sing N N 212 LEU CB HB3 sing N N 213 LEU CG CD1 sing N N 214 LEU CG CD2 sing N N 215 LEU CG HG sing N N 216 LEU CD1 HD11 sing N N 217 LEU CD1 HD12 sing N N 218 LEU CD1 HD13 sing N N 219 LEU CD2 HD21 sing N N 220 LEU CD2 HD22 sing N N 221 LEU CD2 HD23 sing N N 222 LEU OXT HXT sing N N 223 LYS N CA sing N N 224 LYS N H sing N N 225 LYS N H2 sing N N 226 LYS CA C sing N N 227 LYS CA CB sing N N 228 LYS CA HA sing N N 229 LYS C O doub N N 230 LYS C OXT sing N N 231 LYS CB CG sing N N 232 LYS CB HB2 sing N N 233 LYS CB HB3 sing N N 234 LYS CG CD sing N N 235 LYS CG HG2 sing N N 236 LYS CG HG3 sing N N 237 LYS CD CE sing N N 238 LYS CD HD2 sing N N 239 LYS CD HD3 sing N N 240 LYS CE NZ sing N N 241 LYS CE HE2 sing N N 242 LYS CE HE3 sing N N 243 LYS NZ HZ1 sing N N 244 LYS NZ HZ2 sing N N 245 LYS NZ HZ3 sing N N 246 LYS OXT HXT sing N N 247 MET N CA sing N N 248 MET N H sing N N 249 MET N H2 sing N N 250 MET CA C sing N N 251 MET CA CB sing N N 252 MET CA HA sing N N 253 MET C O doub N N 254 MET C OXT sing N N 255 MET CB CG sing N N 256 MET CB HB2 sing N N 257 MET CB HB3 sing N N 258 MET CG SD sing N N 259 MET CG HG2 sing N N 260 MET CG HG3 sing N N 261 MET SD CE sing N N 262 MET CE HE1 sing N N 263 MET CE HE2 sing N N 264 MET CE HE3 sing N N 265 MET OXT HXT sing N N 266 PHE N CA sing N N 267 PHE N H sing N N 268 PHE N H2 sing N N 269 PHE CA C sing N N 270 PHE CA CB sing N N 271 PHE CA HA sing N N 272 PHE C O doub N N 273 PHE C OXT sing N N 274 PHE CB CG sing N N 275 PHE CB HB2 sing N N 276 PHE CB HB3 sing N N 277 PHE CG CD1 doub Y N 278 PHE CG CD2 sing Y N 279 PHE CD1 CE1 sing Y N 280 PHE CD1 HD1 sing N N 281 PHE CD2 CE2 doub Y N 282 PHE CD2 HD2 sing N N 283 PHE CE1 CZ doub Y N 284 PHE CE1 HE1 sing N N 285 PHE CE2 CZ sing Y N 286 PHE CE2 HE2 sing N N 287 PHE CZ HZ sing N N 288 PHE OXT HXT sing N N 289 PRO N CA sing N N 290 PRO N CD sing N N 291 PRO N H sing N N 292 PRO CA C sing N N 293 PRO CA CB sing N N 294 PRO CA HA sing N N 295 PRO C O doub N N 296 PRO C OXT sing N N 297 PRO CB CG sing N N 298 PRO CB HB2 sing N N 299 PRO CB HB3 sing N N 300 PRO CG CD sing N N 301 PRO CG HG2 sing N N 302 PRO CG HG3 sing N N 303 PRO CD HD2 sing N N 304 PRO CD HD3 sing N N 305 PRO OXT HXT sing N N 306 SER N CA sing N N 307 SER N H sing N N 308 SER N H2 sing N N 309 SER CA C sing N N 310 SER CA CB sing N N 311 SER CA HA sing N N 312 SER C O doub N N 313 SER C OXT sing N N 314 SER CB OG sing N N 315 SER CB HB2 sing N N 316 SER CB HB3 sing N N 317 SER OG HG sing N N 318 SER OXT HXT sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TRP N CA sing N N 336 TRP N H sing N N 337 TRP N H2 sing N N 338 TRP CA C sing N N 339 TRP CA CB sing N N 340 TRP CA HA sing N N 341 TRP C O doub N N 342 TRP C OXT sing N N 343 TRP CB CG sing N N 344 TRP CB HB2 sing N N 345 TRP CB HB3 sing N N 346 TRP CG CD1 doub Y N 347 TRP CG CD2 sing Y N 348 TRP CD1 NE1 sing Y N 349 TRP CD1 HD1 sing N N 350 TRP CD2 CE2 doub Y N 351 TRP CD2 CE3 sing Y N 352 TRP NE1 CE2 sing Y N 353 TRP NE1 HE1 sing N N 354 TRP CE2 CZ2 sing Y N 355 TRP CE3 CZ3 doub Y N 356 TRP CE3 HE3 sing N N 357 TRP CZ2 CH2 doub Y N 358 TRP CZ2 HZ2 sing N N 359 TRP CZ3 CH2 sing Y N 360 TRP CZ3 HZ3 sing N N 361 TRP CH2 HH2 sing N N 362 TRP OXT HXT sing N N 363 TYR N CA sing N N 364 TYR N H sing N N 365 TYR N H2 sing N N 366 TYR CA C sing N N 367 TYR CA CB sing N N 368 TYR CA HA sing N N 369 TYR C O doub N N 370 TYR C OXT sing N N 371 TYR CB CG sing N N 372 TYR CB HB2 sing N N 373 TYR CB HB3 sing N N 374 TYR CG CD1 doub Y N 375 TYR CG CD2 sing Y N 376 TYR CD1 CE1 sing Y N 377 TYR CD1 HD1 sing N N 378 TYR CD2 CE2 doub Y N 379 TYR CD2 HD2 sing N N 380 TYR CE1 CZ doub Y N 381 TYR CE1 HE1 sing N N 382 TYR CE2 CZ sing Y N 383 TYR CE2 HE2 sing N N 384 TYR CZ OH sing N N 385 TYR OH HH sing N N 386 TYR OXT HXT sing N N 387 VAL N CA sing N N 388 VAL N H sing N N 389 VAL N H2 sing N N 390 VAL CA C sing N N 391 VAL CA CB sing N N 392 VAL CA HA sing N N 393 VAL C O doub N N 394 VAL C OXT sing N N 395 VAL CB CG1 sing N N 396 VAL CB CG2 sing N N 397 VAL CB HB sing N N 398 VAL CG1 HG11 sing N N 399 VAL CG1 HG12 sing N N 400 VAL CG1 HG13 sing N N 401 VAL CG2 HG21 sing N N 402 VAL CG2 HG22 sing N N 403 VAL CG2 HG23 sing N N 404 VAL OXT HXT sing N N 405 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'in house' # _atom_sites.entry_id 9FKZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.024536 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002462 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023051 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023067 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S # loop_