data_9FNR # _entry.id 9FNR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.401 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9FNR pdb_00009fnr 10.2210/pdb9fnr/pdb WWPDB D_1292138673 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-01-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9FNR _pdbx_database_status.recvd_initial_deposition_date 2024-06-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'S112V N49M mutant with same ligand' _pdbx_database_related.db_id 9FFJ _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email xile.hu@epfl.ch _pdbx_contact_author.name_first Xile _pdbx_contact_author.name_last Hu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8335-1196 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lau, K.' 1 0000-0002-9040-7597 'Wang, W.' 2 0000-0002-3080-1365 'Pojer, F.' 3 0000-0002-9183-7206 'Larabi, A.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Angew.Chem.Int.Ed.Engl. _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first e202422783 _citation.page_last e202422783 _citation.title 'Artificial Metalloenzymes with Two Catalytic Cofactors for Tandem Abiotic Transformations.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.202422783 _citation.pdbx_database_id_PubMed 39760306 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, W.' 1 ? primary 'Tachibana, R.' 2 ? primary 'Zhang, K.' 3 ? primary 'Lau, K.' 4 ? primary 'Pojer, F.' 5 ? primary 'Ward, T.R.' 6 ? primary 'Hu, X.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Streptavidin 16581.086 1 ? ? ? ? 2 non-polymer syn ;N-methyl-N-[(4,4,6,6-tetrahydroxy-4,6-dioxido-1,3,3a,5,6a-tetrahydrothien[3,4-d]imidazol-4-ium-2-yl)methyl]-5-(2,4,4-trihydroxy-2-keto-3,3a,5,6-tetrahydro-1H-thien[3,4-d]imidazol-4-ium-6-yl ; 574.275 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 30 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASMTGGQQMGRDQAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWK NNYRNAHSATTWSGQYVGGAEARINTQWLLTVGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MASMTGGQQMGRDQAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWK NNYRNAHSATTWSGQYVGGAEARINTQWLLTVGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;N-methyl-N-[(4,4,6,6-tetrahydroxy-4,6-dioxido-1,3,3a,5,6a-tetrahydrothien[3,4-d]imidazol-4-ium-2-yl)methyl]-5-(2,4,4-trihydroxy-2-keto-3,3a,5,6-tetrahydro-1H-thien[3,4-d]imidazol-4-ium-6-yl ; A1ICD 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 MET n 1 5 THR n 1 6 GLY n 1 7 GLY n 1 8 GLN n 1 9 GLN n 1 10 MET n 1 11 GLY n 1 12 ARG n 1 13 ASP n 1 14 GLN n 1 15 ALA n 1 16 GLY n 1 17 ILE n 1 18 THR n 1 19 GLY n 1 20 THR n 1 21 TRP n 1 22 TYR n 1 23 ASN n 1 24 GLN n 1 25 LEU n 1 26 GLY n 1 27 SER n 1 28 THR n 1 29 PHE n 1 30 ILE n 1 31 VAL n 1 32 THR n 1 33 ALA n 1 34 GLY n 1 35 ALA n 1 36 ASP n 1 37 GLY n 1 38 ALA n 1 39 LEU n 1 40 THR n 1 41 GLY n 1 42 THR n 1 43 TYR n 1 44 GLU n 1 45 SER n 1 46 ALA n 1 47 VAL n 1 48 GLY n 1 49 ASN n 1 50 ALA n 1 51 GLU n 1 52 SER n 1 53 ARG n 1 54 TYR n 1 55 VAL n 1 56 LEU n 1 57 THR n 1 58 GLY n 1 59 ARG n 1 60 TYR n 1 61 ASP n 1 62 SER n 1 63 ALA n 1 64 PRO n 1 65 ALA n 1 66 THR n 1 67 ASP n 1 68 GLY n 1 69 SER n 1 70 GLY n 1 71 THR n 1 72 ALA n 1 73 LEU n 1 74 GLY n 1 75 TRP n 1 76 THR n 1 77 VAL n 1 78 ALA n 1 79 TRP n 1 80 LYS n 1 81 ASN n 1 82 ASN n 1 83 TYR n 1 84 ARG n 1 85 ASN n 1 86 ALA n 1 87 HIS n 1 88 SER n 1 89 ALA n 1 90 THR n 1 91 THR n 1 92 TRP n 1 93 SER n 1 94 GLY n 1 95 GLN n 1 96 TYR n 1 97 VAL n 1 98 GLY n 1 99 GLY n 1 100 ALA n 1 101 GLU n 1 102 ALA n 1 103 ARG n 1 104 ILE n 1 105 ASN n 1 106 THR n 1 107 GLN n 1 108 TRP n 1 109 LEU n 1 110 LEU n 1 111 THR n 1 112 VAL n 1 113 GLY n 1 114 THR n 1 115 THR n 1 116 GLU n 1 117 ALA n 1 118 ASN n 1 119 ALA n 1 120 TRP n 1 121 LYS n 1 122 SER n 1 123 THR n 1 124 LEU n 1 125 VAL n 1 126 GLY n 1 127 HIS n 1 128 ASP n 1 129 THR n 1 130 PHE n 1 131 THR n 1 132 LYS n 1 133 VAL n 1 134 LYS n 1 135 PRO n 1 136 SER n 1 137 ALA n 1 138 ALA n 1 139 SER n 1 140 ILE n 1 141 ASP n 1 142 ALA n 1 143 ALA n 1 144 LYS n 1 145 LYS n 1 146 ALA n 1 147 GLY n 1 148 VAL n 1 149 ASN n 1 150 ASN n 1 151 GLY n 1 152 ASN n 1 153 PRO n 1 154 LEU n 1 155 ASP n 1 156 ALA n 1 157 VAL n 1 158 GLN n 1 159 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 159 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces avidinii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1895 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1ICD non-polymer . ;N-methyl-N-[(4,4,6,6-tetrahydroxy-4,6-dioxido-1,3,3a,5,6a-tetrahydrothien[3,4-d]imidazol-4-ium-2-yl)methyl]-5-(2,4,4-trihydroxy-2-keto-3,3a,5,6-tetrahydro-1H-thien[3,4-d]imidazol-4-ium-6-yl ; ? 'C24 H29 N5 Ni O6 S' 574.275 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 MET 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 GLN 8 8 ? ? ? A . n A 1 9 GLN 9 9 ? ? ? A . n A 1 10 MET 10 10 ? ? ? A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 TRP 92 92 92 TRP TRP A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 TRP 108 108 108 TRP TRP A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 TRP 120 120 120 TRP TRP A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 PRO 135 135 ? ? ? A . n A 1 136 SER 136 136 ? ? ? A . n A 1 137 ALA 137 137 ? ? ? A . n A 1 138 ALA 138 138 ? ? ? A . n A 1 139 SER 139 139 ? ? ? A . n A 1 140 ILE 140 140 ? ? ? A . n A 1 141 ASP 141 141 ? ? ? A . n A 1 142 ALA 142 142 ? ? ? A . n A 1 143 ALA 143 143 ? ? ? A . n A 1 144 LYS 144 144 ? ? ? A . n A 1 145 LYS 145 145 ? ? ? A . n A 1 146 ALA 146 146 ? ? ? A . n A 1 147 GLY 147 147 ? ? ? A . n A 1 148 VAL 148 148 ? ? ? A . n A 1 149 ASN 149 149 ? ? ? A . n A 1 150 ASN 150 150 ? ? ? A . n A 1 151 GLY 151 151 ? ? ? A . n A 1 152 ASN 152 152 ? ? ? A . n A 1 153 PRO 153 153 ? ? ? A . n A 1 154 LEU 154 154 ? ? ? A . n A 1 155 ASP 155 155 ? ? ? A . n A 1 156 ALA 156 156 ? ? ? A . n A 1 157 VAL 157 157 ? ? ? A . n A 1 158 GLN 158 158 ? ? ? A . n A 1 159 GLN 159 159 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1ICD _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1ICD _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1ICD 1 201 201 A1ICD YZT A . C 3 SO4 1 202 1 SO4 SO4 A . D 4 HOH 1 301 59 HOH HOH A . D 4 HOH 2 302 4 HOH HOH A . D 4 HOH 3 303 34 HOH HOH A . D 4 HOH 4 304 9 HOH HOH A . D 4 HOH 5 305 72 HOH HOH A . D 4 HOH 6 306 32 HOH HOH A . D 4 HOH 7 307 35 HOH HOH A . D 4 HOH 8 308 11 HOH HOH A . D 4 HOH 9 309 6 HOH HOH A . D 4 HOH 10 310 1 HOH HOH A . D 4 HOH 11 311 37 HOH HOH A . D 4 HOH 12 312 3 HOH HOH A . D 4 HOH 13 313 81 HOH HOH A . D 4 HOH 14 314 26 HOH HOH A . D 4 HOH 15 315 8 HOH HOH A . D 4 HOH 16 316 87 HOH HOH A . D 4 HOH 17 317 14 HOH HOH A . D 4 HOH 18 318 15 HOH HOH A . D 4 HOH 19 319 27 HOH HOH A . D 4 HOH 20 320 7 HOH HOH A . D 4 HOH 21 321 25 HOH HOH A . D 4 HOH 22 322 89 HOH HOH A . D 4 HOH 23 323 10 HOH HOH A . D 4 HOH 24 324 17 HOH HOH A . D 4 HOH 25 325 24 HOH HOH A . D 4 HOH 26 326 86 HOH HOH A . D 4 HOH 27 327 88 HOH HOH A . D 4 HOH 28 328 85 HOH HOH A . D 4 HOH 29 329 53 HOH HOH A . D 4 HOH 30 330 90 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A THR 129 ? OG1 B A THR 129 OG1 2 1 Y 0 A THR 129 ? CG2 B A THR 129 CG2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_5246 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9FNR _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.100 _cell.length_a_esd ? _cell.length_b 57.100 _cell.length_b_esd ? _cell.length_c 172.197 _cell.length_c_esd ? _cell.volume 561432.821 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9FNR _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall 'I 4bw 2bw' _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9FNR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.88 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.6M Magnesium sulfate heptahydrate,0.1M HEPES 7.2, 6% v/v Glycerol' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-04-11 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.965460 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.965460 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 32.12 _reflns.entry_id 9FNR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.64 _reflns.d_resolution_low 43.05 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 31995 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.25 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.36 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.054 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.00 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.64 _reflns_shell.d_res_low 1.73 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4478 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.39 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.512 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 79.2 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 44.32 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9FNR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.64 _refine.ls_d_res_low 43.05 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 31546 _refine.ls_number_reflns_R_free 1582 _refine.ls_number_reflns_R_work 29964 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.89 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1643 _refine.ls_R_factor_R_free 0.2057 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1621 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.0845 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2029 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.64 _refine_hist.d_res_low 43.05 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 1001 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 929 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0102 ? 999 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.7725 ? 1379 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0595 ? 148 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0074 ? 168 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.9284 ? 317 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.64 1.69 . . 84 1685 59.10 . . . . 0.3190 . . . . . . . . . . . 0.3706 'X-RAY DIFFRACTION' 1.69 1.76 . . 135 2560 88.30 . . . . 0.2595 . . . . . . . . . . . 0.2879 'X-RAY DIFFRACTION' 1.76 1.83 . . 143 2761 96.83 . . . . 0.2256 . . . . . . . . . . . 0.2544 'X-RAY DIFFRACTION' 1.83 1.91 . . 152 2850 99.34 . . . . 0.1864 . . . . . . . . . . . 0.2553 'X-RAY DIFFRACTION' 1.91 2.01 . . 152 2863 100.00 . . . . 0.1736 . . . . . . . . . . . 0.2333 'X-RAY DIFFRACTION' 2.01 2.13 . . 151 2874 100.00 . . . . 0.1453 . . . . . . . . . . . 0.1975 'X-RAY DIFFRACTION' 2.14 2.30 . . 150 2877 99.97 . . . . 0.1496 . . . . . . . . . . . 0.2101 'X-RAY DIFFRACTION' 2.30 2.53 . . 157 2865 100.00 . . . . 0.1960 . . . . . . . . . . . 0.2360 'X-RAY DIFFRACTION' 2.53 2.90 . . 150 2879 100.00 . . . . 0.1714 . . . . . . . . . . . 0.2267 'X-RAY DIFFRACTION' 2.90 3.65 . . 152 2870 99.97 . . . . 0.1582 . . . . . . . . . . . 0.1860 'X-RAY DIFFRACTION' 3.65 43.05 . . 156 2880 100.00 . . . . 0.1438 . . . . . . . . . . . 0.1855 # _struct.entry_id 9FNR _struct.title 'Artificial metalloenzyme with a nickel-based 1,10-phenanthroline cofactor and streptavidin S112V mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9FNR _struct_keywords.text 'Artificial metalloenzyme, nickel, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SAV_STRAV _struct_ref.pdbx_db_accession P22629 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSG QYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ ; _struct_ref.pdbx_align_begin 39 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9FNR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 15 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 159 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22629 _struct_ref_seq.db_align_beg 39 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 15 _struct_ref_seq.pdbx_auth_seq_align_end 159 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9FNR MET A 1 ? UNP P22629 ? ? 'initiating methionine' 1 1 1 9FNR ALA A 2 ? UNP P22629 ? ? 'expression tag' 2 2 1 9FNR SER A 3 ? UNP P22629 ? ? 'expression tag' 3 3 1 9FNR MET A 4 ? UNP P22629 ? ? 'expression tag' 4 4 1 9FNR THR A 5 ? UNP P22629 ? ? 'expression tag' 5 5 1 9FNR GLY A 6 ? UNP P22629 ? ? 'expression tag' 6 6 1 9FNR GLY A 7 ? UNP P22629 ? ? 'expression tag' 7 7 1 9FNR GLN A 8 ? UNP P22629 ? ? 'expression tag' 8 8 1 9FNR GLN A 9 ? UNP P22629 ? ? 'expression tag' 9 9 1 9FNR MET A 10 ? UNP P22629 ? ? 'expression tag' 10 10 1 9FNR GLY A 11 ? UNP P22629 ? ? 'expression tag' 11 11 1 9FNR ARG A 12 ? UNP P22629 ? ? 'expression tag' 12 12 1 9FNR ASP A 13 ? UNP P22629 ? ? 'expression tag' 13 13 1 9FNR GLN A 14 ? UNP P22629 ? ? 'expression tag' 14 14 1 9FNR VAL A 112 ? UNP P22629 SER 136 'engineered mutation' 112 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9270 ? 1 MORE -57 ? 1 'SSA (A^2)' 18880 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'mass spectrometry' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 10_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 15_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 13 ? THR A 18 ? ASP A 13 THR A 18 1 ? 6 HELX_P HELX_P2 AA2 THR A 115 ? LYS A 121 ? THR A 115 LYS A 121 5 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 19 ? TYR A 22 ? GLY A 19 TYR A 22 AA1 2 THR A 28 ? ALA A 33 ? THR A 28 ALA A 33 AA1 3 ALA A 38 ? GLU A 44 ? ALA A 38 GLU A 44 AA1 4 ARG A 53 ? TYR A 60 ? ARG A 53 TYR A 60 AA1 5 THR A 71 ? LYS A 80 ? THR A 71 LYS A 80 AA1 6 ASN A 85 ? VAL A 97 ? ASN A 85 VAL A 97 AA1 7 ARG A 103 ? VAL A 112 ? ARG A 103 VAL A 112 AA1 8 THR A 123 ? THR A 131 ? THR A 123 THR A 131 AA1 9 GLY A 19 ? TYR A 22 ? GLY A 19 TYR A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TRP A 21 ? N TRP A 21 O PHE A 29 ? O PHE A 29 AA1 2 3 N THR A 28 ? N THR A 28 O GLU A 44 ? O GLU A 44 AA1 3 4 N TYR A 43 ? N TYR A 43 O TYR A 54 ? O TYR A 54 AA1 4 5 N THR A 57 ? N THR A 57 O THR A 76 ? O THR A 76 AA1 5 6 N TRP A 79 ? N TRP A 79 O SER A 88 ? O SER A 88 AA1 6 7 N VAL A 97 ? N VAL A 97 O ARG A 103 ? O ARG A 103 AA1 7 8 N ILE A 104 ? N ILE A 104 O PHE A 130 ? O PHE A 130 AA1 8 9 O THR A 131 ? O THR A 131 N TYR A 22 ? N TYR A 22 # _pdbx_entry_details.entry_id 9FNR _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 49 ? ? -93.34 49.43 2 1 GLU A 51 ? ? -138.57 -99.81 3 1 SER A 52 ? ? -60.88 -143.37 4 1 GLU A 101 ? ? -109.51 69.38 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 301 ? D HOH . 2 1 A HOH 310 ? D HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x,z+3/4 3 y+1/2,-x,z+3/4 4 x+1/2,-y,-z+3/4 5 -x+1/2,y,-z+3/4 6 -x,-y,z 7 y,x,-z 8 -y,-x,-z 9 x+1/2,y+1/2,z+1/2 10 -y+1,x+1/2,z+5/4 11 y+1,-x+1/2,z+5/4 12 x+1,-y+1/2,-z+5/4 13 -x+1,y+1/2,-z+5/4 14 -x+1/2,-y+1/2,z+1/2 15 y+1/2,x+1/2,-z+1/2 16 -y+1/2,-x+1/2,-z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A MET 4 ? A MET 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A GLN 8 ? A GLN 8 9 1 Y 1 A GLN 9 ? A GLN 9 10 1 Y 1 A MET 10 ? A MET 10 11 1 Y 1 A PRO 135 ? A PRO 135 12 1 Y 1 A SER 136 ? A SER 136 13 1 Y 1 A ALA 137 ? A ALA 137 14 1 Y 1 A ALA 138 ? A ALA 138 15 1 Y 1 A SER 139 ? A SER 139 16 1 Y 1 A ILE 140 ? A ILE 140 17 1 Y 1 A ASP 141 ? A ASP 141 18 1 Y 1 A ALA 142 ? A ALA 142 19 1 Y 1 A ALA 143 ? A ALA 143 20 1 Y 1 A LYS 144 ? A LYS 144 21 1 Y 1 A LYS 145 ? A LYS 145 22 1 Y 1 A ALA 146 ? A ALA 146 23 1 Y 1 A GLY 147 ? A GLY 147 24 1 Y 1 A VAL 148 ? A VAL 148 25 1 Y 1 A ASN 149 ? A ASN 149 26 1 Y 1 A ASN 150 ? A ASN 150 27 1 Y 1 A GLY 151 ? A GLY 151 28 1 Y 1 A ASN 152 ? A ASN 152 29 1 Y 1 A PRO 153 ? A PRO 153 30 1 Y 1 A LEU 154 ? A LEU 154 31 1 Y 1 A ASP 155 ? A ASP 155 32 1 Y 1 A ALA 156 ? A ALA 156 33 1 Y 1 A VAL 157 ? A VAL 157 34 1 Y 1 A GLN 158 ? A GLN 158 35 1 Y 1 A GLN 159 ? A GLN 159 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1ICD C02 C N N 1 A1ICD C04 C N S 2 A1ICD C05 C N R 3 A1ICD C06 C N N 4 A1ICD C09 C N S 5 A1ICD C10 C N N 6 A1ICD C11 C N N 7 A1ICD C12 C N N 8 A1ICD C13 C N N 9 A1ICD C14 C N N 10 A1ICD C16 C N N 11 A1ICD C17 C Y N 12 A1ICD C18 C Y N 13 A1ICD C19 C Y N 14 A1ICD C26 C Y N 15 A1ICD C27 C Y N 16 A1ICD C28 C Y N 17 A1ICD C29 C Y N 18 A1ICD C30 C Y N 19 A1ICD C31 C Y N 20 A1ICD C33 C Y N 21 A1ICD C34 C Y N 22 A1ICD C35 C Y N 23 A1ICD N03 N N N 24 A1ICD N08 N N N 25 A1ICD N15 N N N 26 A1ICD N20 N Y N 27 A1ICD N32 N Y N 28 A1ICD O01 O N N 29 A1ICD O22 O N N 30 A1ICD O23 O N N 31 A1ICD O24 O N N 32 A1ICD O25 O N N 33 A1ICD O36 O N N 34 A1ICD S07 S N N 35 A1ICD NI21 NI N N 36 A1ICD C36 C N N 37 A1ICD H1 H N N 38 A1ICD H2 H N N 39 A1ICD H3 H N N 40 A1ICD H4 H N N 41 A1ICD H5 H N N 42 A1ICD H6 H N N 43 A1ICD H7 H N N 44 A1ICD H8 H N N 45 A1ICD H9 H N N 46 A1ICD H10 H N N 47 A1ICD H11 H N N 48 A1ICD H12 H N N 49 A1ICD H13 H N N 50 A1ICD H14 H N N 51 A1ICD H15 H N N 52 A1ICD H16 H N N 53 A1ICD H17 H N N 54 A1ICD H18 H N N 55 A1ICD H19 H N N 56 A1ICD H20 H N N 57 A1ICD H21 H N N 58 A1ICD H22 H N N 59 A1ICD H23 H N N 60 A1ICD H24 H N N 61 A1ICD H29 H N N 62 A1ICD H30 H N N 63 A1ICD H31 H N N 64 A1ICD H25 H N N 65 A1ICD H26 H N N 66 ALA N N N N 67 ALA CA C N S 68 ALA C C N N 69 ALA O O N N 70 ALA CB C N N 71 ALA OXT O N N 72 ALA H H N N 73 ALA H2 H N N 74 ALA HA H N N 75 ALA HB1 H N N 76 ALA HB2 H N N 77 ALA HB3 H N N 78 ALA HXT H N N 79 ARG N N N N 80 ARG CA C N S 81 ARG C C N N 82 ARG O O N N 83 ARG CB C N N 84 ARG CG C N N 85 ARG CD C N N 86 ARG NE N N N 87 ARG CZ C N N 88 ARG NH1 N N N 89 ARG NH2 N N N 90 ARG OXT O N N 91 ARG H H N N 92 ARG H2 H N N 93 ARG HA H N N 94 ARG HB2 H N N 95 ARG HB3 H N N 96 ARG HG2 H N N 97 ARG HG3 H N N 98 ARG HD2 H N N 99 ARG HD3 H N N 100 ARG HE H N N 101 ARG HH11 H N N 102 ARG HH12 H N N 103 ARG HH21 H N N 104 ARG HH22 H N N 105 ARG HXT H N N 106 ASN N N N N 107 ASN CA C N S 108 ASN C C N N 109 ASN O O N N 110 ASN CB C N N 111 ASN CG C N N 112 ASN OD1 O N N 113 ASN ND2 N N N 114 ASN OXT O N N 115 ASN H H N N 116 ASN H2 H N N 117 ASN HA H N N 118 ASN HB2 H N N 119 ASN HB3 H N N 120 ASN HD21 H N N 121 ASN HD22 H N N 122 ASN HXT H N N 123 ASP N N N N 124 ASP CA C N S 125 ASP C C N N 126 ASP O O N N 127 ASP CB C N N 128 ASP CG C N N 129 ASP OD1 O N N 130 ASP OD2 O N N 131 ASP OXT O N N 132 ASP H H N N 133 ASP H2 H N N 134 ASP HA H N N 135 ASP HB2 H N N 136 ASP HB3 H N N 137 ASP HD2 H N N 138 ASP HXT H N N 139 GLN N N N N 140 GLN CA C N S 141 GLN C C N N 142 GLN O O N N 143 GLN CB C N N 144 GLN CG C N N 145 GLN CD C N N 146 GLN OE1 O N N 147 GLN NE2 N N N 148 GLN OXT O N N 149 GLN H H N N 150 GLN H2 H N N 151 GLN HA H N N 152 GLN HB2 H N N 153 GLN HB3 H N N 154 GLN HG2 H N N 155 GLN HG3 H N N 156 GLN HE21 H N N 157 GLN HE22 H N N 158 GLN HXT H N N 159 GLU N N N N 160 GLU CA C N S 161 GLU C C N N 162 GLU O O N N 163 GLU CB C N N 164 GLU CG C N N 165 GLU CD C N N 166 GLU OE1 O N N 167 GLU OE2 O N N 168 GLU OXT O N N 169 GLU H H N N 170 GLU H2 H N N 171 GLU HA H N N 172 GLU HB2 H N N 173 GLU HB3 H N N 174 GLU HG2 H N N 175 GLU HG3 H N N 176 GLU HE2 H N N 177 GLU HXT H N N 178 GLY N N N N 179 GLY CA C N N 180 GLY C C N N 181 GLY O O N N 182 GLY OXT O N N 183 GLY H H N N 184 GLY H2 H N N 185 GLY HA2 H N N 186 GLY HA3 H N N 187 GLY HXT H N N 188 HIS N N N N 189 HIS CA C N S 190 HIS C C N N 191 HIS O O N N 192 HIS CB C N N 193 HIS CG C Y N 194 HIS ND1 N Y N 195 HIS CD2 C Y N 196 HIS CE1 C Y N 197 HIS NE2 N Y N 198 HIS OXT O N N 199 HIS H H N N 200 HIS H2 H N N 201 HIS HA H N N 202 HIS HB2 H N N 203 HIS HB3 H N N 204 HIS HD1 H N N 205 HIS HD2 H N N 206 HIS HE1 H N N 207 HIS HE2 H N N 208 HIS HXT H N N 209 HOH O O N N 210 HOH H1 H N N 211 HOH H2 H N N 212 ILE N N N N 213 ILE CA C N S 214 ILE C C N N 215 ILE O O N N 216 ILE CB C N S 217 ILE CG1 C N N 218 ILE CG2 C N N 219 ILE CD1 C N N 220 ILE OXT O N N 221 ILE H H N N 222 ILE H2 H N N 223 ILE HA H N N 224 ILE HB H N N 225 ILE HG12 H N N 226 ILE HG13 H N N 227 ILE HG21 H N N 228 ILE HG22 H N N 229 ILE HG23 H N N 230 ILE HD11 H N N 231 ILE HD12 H N N 232 ILE HD13 H N N 233 ILE HXT H N N 234 LEU N N N N 235 LEU CA C N S 236 LEU C C N N 237 LEU O O N N 238 LEU CB C N N 239 LEU CG C N N 240 LEU CD1 C N N 241 LEU CD2 C N N 242 LEU OXT O N N 243 LEU H H N N 244 LEU H2 H N N 245 LEU HA H N N 246 LEU HB2 H N N 247 LEU HB3 H N N 248 LEU HG H N N 249 LEU HD11 H N N 250 LEU HD12 H N N 251 LEU HD13 H N N 252 LEU HD21 H N N 253 LEU HD22 H N N 254 LEU HD23 H N N 255 LEU HXT H N N 256 LYS N N N N 257 LYS CA C N S 258 LYS C C N N 259 LYS O O N N 260 LYS CB C N N 261 LYS CG C N N 262 LYS CD C N N 263 LYS CE C N N 264 LYS NZ N N N 265 LYS OXT O N N 266 LYS H H N N 267 LYS H2 H N N 268 LYS HA H N N 269 LYS HB2 H N N 270 LYS HB3 H N N 271 LYS HG2 H N N 272 LYS HG3 H N N 273 LYS HD2 H N N 274 LYS HD3 H N N 275 LYS HE2 H N N 276 LYS HE3 H N N 277 LYS HZ1 H N N 278 LYS HZ2 H N N 279 LYS HZ3 H N N 280 LYS HXT H N N 281 MET N N N N 282 MET CA C N S 283 MET C C N N 284 MET O O N N 285 MET CB C N N 286 MET CG C N N 287 MET SD S N N 288 MET CE C N N 289 MET OXT O N N 290 MET H H N N 291 MET H2 H N N 292 MET HA H N N 293 MET HB2 H N N 294 MET HB3 H N N 295 MET HG2 H N N 296 MET HG3 H N N 297 MET HE1 H N N 298 MET HE2 H N N 299 MET HE3 H N N 300 MET HXT H N N 301 PHE N N N N 302 PHE CA C N S 303 PHE C C N N 304 PHE O O N N 305 PHE CB C N N 306 PHE CG C Y N 307 PHE CD1 C Y N 308 PHE CD2 C Y N 309 PHE CE1 C Y N 310 PHE CE2 C Y N 311 PHE CZ C Y N 312 PHE OXT O N N 313 PHE H H N N 314 PHE H2 H N N 315 PHE HA H N N 316 PHE HB2 H N N 317 PHE HB3 H N N 318 PHE HD1 H N N 319 PHE HD2 H N N 320 PHE HE1 H N N 321 PHE HE2 H N N 322 PHE HZ H N N 323 PHE HXT H N N 324 PRO N N N N 325 PRO CA C N S 326 PRO C C N N 327 PRO O O N N 328 PRO CB C N N 329 PRO CG C N N 330 PRO CD C N N 331 PRO OXT O N N 332 PRO H H N N 333 PRO HA H N N 334 PRO HB2 H N N 335 PRO HB3 H N N 336 PRO HG2 H N N 337 PRO HG3 H N N 338 PRO HD2 H N N 339 PRO HD3 H N N 340 PRO HXT H N N 341 SER N N N N 342 SER CA C N S 343 SER C C N N 344 SER O O N N 345 SER CB C N N 346 SER OG O N N 347 SER OXT O N N 348 SER H H N N 349 SER H2 H N N 350 SER HA H N N 351 SER HB2 H N N 352 SER HB3 H N N 353 SER HG H N N 354 SER HXT H N N 355 SO4 S S N N 356 SO4 O1 O N N 357 SO4 O2 O N N 358 SO4 O3 O N N 359 SO4 O4 O N N 360 THR N N N N 361 THR CA C N S 362 THR C C N N 363 THR O O N N 364 THR CB C N R 365 THR OG1 O N N 366 THR CG2 C N N 367 THR OXT O N N 368 THR H H N N 369 THR H2 H N N 370 THR HA H N N 371 THR HB H N N 372 THR HG1 H N N 373 THR HG21 H N N 374 THR HG22 H N N 375 THR HG23 H N N 376 THR HXT H N N 377 TRP N N N N 378 TRP CA C N S 379 TRP C C N N 380 TRP O O N N 381 TRP CB C N N 382 TRP CG C Y N 383 TRP CD1 C Y N 384 TRP CD2 C Y N 385 TRP NE1 N Y N 386 TRP CE2 C Y N 387 TRP CE3 C Y N 388 TRP CZ2 C Y N 389 TRP CZ3 C Y N 390 TRP CH2 C Y N 391 TRP OXT O N N 392 TRP H H N N 393 TRP H2 H N N 394 TRP HA H N N 395 TRP HB2 H N N 396 TRP HB3 H N N 397 TRP HD1 H N N 398 TRP HE1 H N N 399 TRP HE3 H N N 400 TRP HZ2 H N N 401 TRP HZ3 H N N 402 TRP HH2 H N N 403 TRP HXT H N N 404 TYR N N N N 405 TYR CA C N S 406 TYR C C N N 407 TYR O O N N 408 TYR CB C N N 409 TYR CG C Y N 410 TYR CD1 C Y N 411 TYR CD2 C Y N 412 TYR CE1 C Y N 413 TYR CE2 C Y N 414 TYR CZ C Y N 415 TYR OH O N N 416 TYR OXT O N N 417 TYR H H N N 418 TYR H2 H N N 419 TYR HA H N N 420 TYR HB2 H N N 421 TYR HB3 H N N 422 TYR HD1 H N N 423 TYR HD2 H N N 424 TYR HE1 H N N 425 TYR HE2 H N N 426 TYR HH H N N 427 TYR HXT H N N 428 VAL N N N N 429 VAL CA C N S 430 VAL C C N N 431 VAL O O N N 432 VAL CB C N N 433 VAL CG1 C N N 434 VAL CG2 C N N 435 VAL OXT O N N 436 VAL H H N N 437 VAL H2 H N N 438 VAL HA H N N 439 VAL HB H N N 440 VAL HG11 H N N 441 VAL HG12 H N N 442 VAL HG13 H N N 443 VAL HG21 H N N 444 VAL HG22 H N N 445 VAL HG23 H N N 446 VAL HXT H N N 447 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1ICD C02 O01 doub N N 1 A1ICD N03 C02 sing N N 2 A1ICD C04 N03 sing N N 3 A1ICD S07 C06 sing N N 4 A1ICD C06 C05 sing N N 5 A1ICD N08 C05 sing N N 6 A1ICD C05 C04 sing N N 7 A1ICD C09 C04 sing N N 8 A1ICD C10 C09 sing N N 9 A1ICD C11 C10 sing N N 10 A1ICD C12 C11 sing N N 11 A1ICD C13 C12 sing N N 12 A1ICD C14 C13 sing N N 13 A1ICD C16 N15 sing N N 14 A1ICD C17 C16 sing N N 15 A1ICD C18 C17 doub Y N 16 A1ICD C19 C18 sing Y N 17 A1ICD N20 C19 doub Y N 18 A1ICD O22 NI21 sing N N 19 A1ICD O23 NI21 sing N N 20 A1ICD O24 NI21 sing N N 21 A1ICD O25 NI21 sing N N 22 A1ICD NI21 N20 sing N N 23 A1ICD C26 N20 sing Y N 24 A1ICD C27 C26 doub Y N 25 A1ICD C28 C27 sing Y N 26 A1ICD C29 C28 doub Y N 27 A1ICD C30 C29 sing Y N 28 A1ICD C31 C30 doub Y N 29 A1ICD N32 C31 sing Y N 30 A1ICD C33 N32 doub Y N 31 A1ICD C34 C33 sing Y N 32 A1ICD C35 C34 doub Y N 33 A1ICD N15 C14 sing N N 34 A1ICD O36 C14 doub N N 35 A1ICD C02 N08 sing N N 36 A1ICD S07 C09 sing N N 37 A1ICD C17 C27 sing Y N 38 A1ICD NI21 N32 sing N N 39 A1ICD C26 C31 sing Y N 40 A1ICD C30 C35 sing Y N 41 A1ICD C36 N15 sing N N 42 A1ICD C04 H1 sing N N 43 A1ICD C05 H2 sing N N 44 A1ICD C06 H3 sing N N 45 A1ICD C06 H4 sing N N 46 A1ICD C09 H5 sing N N 47 A1ICD C10 H6 sing N N 48 A1ICD C10 H7 sing N N 49 A1ICD C11 H8 sing N N 50 A1ICD C11 H9 sing N N 51 A1ICD C12 H10 sing N N 52 A1ICD C12 H11 sing N N 53 A1ICD C13 H12 sing N N 54 A1ICD C13 H13 sing N N 55 A1ICD C16 H14 sing N N 56 A1ICD C16 H15 sing N N 57 A1ICD C18 H16 sing N N 58 A1ICD C19 H17 sing N N 59 A1ICD C28 H18 sing N N 60 A1ICD C29 H19 sing N N 61 A1ICD C33 H20 sing N N 62 A1ICD C34 H21 sing N N 63 A1ICD C35 H22 sing N N 64 A1ICD N03 H23 sing N N 65 A1ICD N08 H24 sing N N 66 A1ICD C36 H29 sing N N 67 A1ICD C36 H30 sing N N 68 A1ICD C36 H31 sing N N 69 A1ICD O24 H25 sing N N 70 A1ICD O25 H26 sing N N 71 ALA N CA sing N N 72 ALA N H sing N N 73 ALA N H2 sing N N 74 ALA CA C sing N N 75 ALA CA CB sing N N 76 ALA CA HA sing N N 77 ALA C O doub N N 78 ALA C OXT sing N N 79 ALA CB HB1 sing N N 80 ALA CB HB2 sing N N 81 ALA CB HB3 sing N N 82 ALA OXT HXT sing N N 83 ARG N CA sing N N 84 ARG N H sing N N 85 ARG N H2 sing N N 86 ARG CA C sing N N 87 ARG CA CB sing N N 88 ARG CA HA sing N N 89 ARG C O doub N N 90 ARG C OXT sing N N 91 ARG CB CG sing N N 92 ARG CB HB2 sing N N 93 ARG CB HB3 sing N N 94 ARG CG CD sing N N 95 ARG CG HG2 sing N N 96 ARG CG HG3 sing N N 97 ARG CD NE sing N N 98 ARG CD HD2 sing N N 99 ARG CD HD3 sing N N 100 ARG NE CZ sing N N 101 ARG NE HE sing N N 102 ARG CZ NH1 sing N N 103 ARG CZ NH2 doub N N 104 ARG NH1 HH11 sing N N 105 ARG NH1 HH12 sing N N 106 ARG NH2 HH21 sing N N 107 ARG NH2 HH22 sing N N 108 ARG OXT HXT sing N N 109 ASN N CA sing N N 110 ASN N H sing N N 111 ASN N H2 sing N N 112 ASN CA C sing N N 113 ASN CA CB sing N N 114 ASN CA HA sing N N 115 ASN C O doub N N 116 ASN C OXT sing N N 117 ASN CB CG sing N N 118 ASN CB HB2 sing N N 119 ASN CB HB3 sing N N 120 ASN CG OD1 doub N N 121 ASN CG ND2 sing N N 122 ASN ND2 HD21 sing N N 123 ASN ND2 HD22 sing N N 124 ASN OXT HXT sing N N 125 ASP N CA sing N N 126 ASP N H sing N N 127 ASP N H2 sing N N 128 ASP CA C sing N N 129 ASP CA CB sing N N 130 ASP CA HA sing N N 131 ASP C O doub N N 132 ASP C OXT sing N N 133 ASP CB CG sing N N 134 ASP CB HB2 sing N N 135 ASP CB HB3 sing N N 136 ASP CG OD1 doub N N 137 ASP CG OD2 sing N N 138 ASP OD2 HD2 sing N N 139 ASP OXT HXT sing N N 140 GLN N CA sing N N 141 GLN N H sing N N 142 GLN N H2 sing N N 143 GLN CA C sing N N 144 GLN CA CB sing N N 145 GLN CA HA sing N N 146 GLN C O doub N N 147 GLN C OXT sing N N 148 GLN CB CG sing N N 149 GLN CB HB2 sing N N 150 GLN CB HB3 sing N N 151 GLN CG CD sing N N 152 GLN CG HG2 sing N N 153 GLN CG HG3 sing N N 154 GLN CD OE1 doub N N 155 GLN CD NE2 sing N N 156 GLN NE2 HE21 sing N N 157 GLN NE2 HE22 sing N N 158 GLN OXT HXT sing N N 159 GLU N CA sing N N 160 GLU N H sing N N 161 GLU N H2 sing N N 162 GLU CA C sing N N 163 GLU CA CB sing N N 164 GLU CA HA sing N N 165 GLU C O doub N N 166 GLU C OXT sing N N 167 GLU CB CG sing N N 168 GLU CB HB2 sing N N 169 GLU CB HB3 sing N N 170 GLU CG CD sing N N 171 GLU CG HG2 sing N N 172 GLU CG HG3 sing N N 173 GLU CD OE1 doub N N 174 GLU CD OE2 sing N N 175 GLU OE2 HE2 sing N N 176 GLU OXT HXT sing N N 177 GLY N CA sing N N 178 GLY N H sing N N 179 GLY N H2 sing N N 180 GLY CA C sing N N 181 GLY CA HA2 sing N N 182 GLY CA HA3 sing N N 183 GLY C O doub N N 184 GLY C OXT sing N N 185 GLY OXT HXT sing N N 186 HIS N CA sing N N 187 HIS N H sing N N 188 HIS N H2 sing N N 189 HIS CA C sing N N 190 HIS CA CB sing N N 191 HIS CA HA sing N N 192 HIS C O doub N N 193 HIS C OXT sing N N 194 HIS CB CG sing N N 195 HIS CB HB2 sing N N 196 HIS CB HB3 sing N N 197 HIS CG ND1 sing Y N 198 HIS CG CD2 doub Y N 199 HIS ND1 CE1 doub Y N 200 HIS ND1 HD1 sing N N 201 HIS CD2 NE2 sing Y N 202 HIS CD2 HD2 sing N N 203 HIS CE1 NE2 sing Y N 204 HIS CE1 HE1 sing N N 205 HIS NE2 HE2 sing N N 206 HIS OXT HXT sing N N 207 HOH O H1 sing N N 208 HOH O H2 sing N N 209 ILE N CA sing N N 210 ILE N H sing N N 211 ILE N H2 sing N N 212 ILE CA C sing N N 213 ILE CA CB sing N N 214 ILE CA HA sing N N 215 ILE C O doub N N 216 ILE C OXT sing N N 217 ILE CB CG1 sing N N 218 ILE CB CG2 sing N N 219 ILE CB HB sing N N 220 ILE CG1 CD1 sing N N 221 ILE CG1 HG12 sing N N 222 ILE CG1 HG13 sing N N 223 ILE CG2 HG21 sing N N 224 ILE CG2 HG22 sing N N 225 ILE CG2 HG23 sing N N 226 ILE CD1 HD11 sing N N 227 ILE CD1 HD12 sing N N 228 ILE CD1 HD13 sing N N 229 ILE OXT HXT sing N N 230 LEU N CA sing N N 231 LEU N H sing N N 232 LEU N H2 sing N N 233 LEU CA C sing N N 234 LEU CA CB sing N N 235 LEU CA HA sing N N 236 LEU C O doub N N 237 LEU C OXT sing N N 238 LEU CB CG sing N N 239 LEU CB HB2 sing N N 240 LEU CB HB3 sing N N 241 LEU CG CD1 sing N N 242 LEU CG CD2 sing N N 243 LEU CG HG sing N N 244 LEU CD1 HD11 sing N N 245 LEU CD1 HD12 sing N N 246 LEU CD1 HD13 sing N N 247 LEU CD2 HD21 sing N N 248 LEU CD2 HD22 sing N N 249 LEU CD2 HD23 sing N N 250 LEU OXT HXT sing N N 251 LYS N CA sing N N 252 LYS N H sing N N 253 LYS N H2 sing N N 254 LYS CA C sing N N 255 LYS CA CB sing N N 256 LYS CA HA sing N N 257 LYS C O doub N N 258 LYS C OXT sing N N 259 LYS CB CG sing N N 260 LYS CB HB2 sing N N 261 LYS CB HB3 sing N N 262 LYS CG CD sing N N 263 LYS CG HG2 sing N N 264 LYS CG HG3 sing N N 265 LYS CD CE sing N N 266 LYS CD HD2 sing N N 267 LYS CD HD3 sing N N 268 LYS CE NZ sing N N 269 LYS CE HE2 sing N N 270 LYS CE HE3 sing N N 271 LYS NZ HZ1 sing N N 272 LYS NZ HZ2 sing N N 273 LYS NZ HZ3 sing N N 274 LYS OXT HXT sing N N 275 MET N CA sing N N 276 MET N H sing N N 277 MET N H2 sing N N 278 MET CA C sing N N 279 MET CA CB sing N N 280 MET CA HA sing N N 281 MET C O doub N N 282 MET C OXT sing N N 283 MET CB CG sing N N 284 MET CB HB2 sing N N 285 MET CB HB3 sing N N 286 MET CG SD sing N N 287 MET CG HG2 sing N N 288 MET CG HG3 sing N N 289 MET SD CE sing N N 290 MET CE HE1 sing N N 291 MET CE HE2 sing N N 292 MET CE HE3 sing N N 293 MET OXT HXT sing N N 294 PHE N CA sing N N 295 PHE N H sing N N 296 PHE N H2 sing N N 297 PHE CA C sing N N 298 PHE CA CB sing N N 299 PHE CA HA sing N N 300 PHE C O doub N N 301 PHE C OXT sing N N 302 PHE CB CG sing N N 303 PHE CB HB2 sing N N 304 PHE CB HB3 sing N N 305 PHE CG CD1 doub Y N 306 PHE CG CD2 sing Y N 307 PHE CD1 CE1 sing Y N 308 PHE CD1 HD1 sing N N 309 PHE CD2 CE2 doub Y N 310 PHE CD2 HD2 sing N N 311 PHE CE1 CZ doub Y N 312 PHE CE1 HE1 sing N N 313 PHE CE2 CZ sing Y N 314 PHE CE2 HE2 sing N N 315 PHE CZ HZ sing N N 316 PHE OXT HXT sing N N 317 PRO N CA sing N N 318 PRO N CD sing N N 319 PRO N H sing N N 320 PRO CA C sing N N 321 PRO CA CB sing N N 322 PRO CA HA sing N N 323 PRO C O doub N N 324 PRO C OXT sing N N 325 PRO CB CG sing N N 326 PRO CB HB2 sing N N 327 PRO CB HB3 sing N N 328 PRO CG CD sing N N 329 PRO CG HG2 sing N N 330 PRO CG HG3 sing N N 331 PRO CD HD2 sing N N 332 PRO CD HD3 sing N N 333 PRO OXT HXT sing N N 334 SER N CA sing N N 335 SER N H sing N N 336 SER N H2 sing N N 337 SER CA C sing N N 338 SER CA CB sing N N 339 SER CA HA sing N N 340 SER C O doub N N 341 SER C OXT sing N N 342 SER CB OG sing N N 343 SER CB HB2 sing N N 344 SER CB HB3 sing N N 345 SER OG HG sing N N 346 SER OXT HXT sing N N 347 SO4 S O1 doub N N 348 SO4 S O2 doub N N 349 SO4 S O3 sing N N 350 SO4 S O4 sing N N 351 THR N CA sing N N 352 THR N H sing N N 353 THR N H2 sing N N 354 THR CA C sing N N 355 THR CA CB sing N N 356 THR CA HA sing N N 357 THR C O doub N N 358 THR C OXT sing N N 359 THR CB OG1 sing N N 360 THR CB CG2 sing N N 361 THR CB HB sing N N 362 THR OG1 HG1 sing N N 363 THR CG2 HG21 sing N N 364 THR CG2 HG22 sing N N 365 THR CG2 HG23 sing N N 366 THR OXT HXT sing N N 367 TRP N CA sing N N 368 TRP N H sing N N 369 TRP N H2 sing N N 370 TRP CA C sing N N 371 TRP CA CB sing N N 372 TRP CA HA sing N N 373 TRP C O doub N N 374 TRP C OXT sing N N 375 TRP CB CG sing N N 376 TRP CB HB2 sing N N 377 TRP CB HB3 sing N N 378 TRP CG CD1 doub Y N 379 TRP CG CD2 sing Y N 380 TRP CD1 NE1 sing Y N 381 TRP CD1 HD1 sing N N 382 TRP CD2 CE2 doub Y N 383 TRP CD2 CE3 sing Y N 384 TRP NE1 CE2 sing Y N 385 TRP NE1 HE1 sing N N 386 TRP CE2 CZ2 sing Y N 387 TRP CE3 CZ3 doub Y N 388 TRP CE3 HE3 sing N N 389 TRP CZ2 CH2 doub Y N 390 TRP CZ2 HZ2 sing N N 391 TRP CZ3 CH2 sing Y N 392 TRP CZ3 HZ3 sing N N 393 TRP CH2 HH2 sing N N 394 TRP OXT HXT sing N N 395 TYR N CA sing N N 396 TYR N H sing N N 397 TYR N H2 sing N N 398 TYR CA C sing N N 399 TYR CA CB sing N N 400 TYR CA HA sing N N 401 TYR C O doub N N 402 TYR C OXT sing N N 403 TYR CB CG sing N N 404 TYR CB HB2 sing N N 405 TYR CB HB3 sing N N 406 TYR CG CD1 doub Y N 407 TYR CG CD2 sing Y N 408 TYR CD1 CE1 sing Y N 409 TYR CD1 HD1 sing N N 410 TYR CD2 CE2 doub Y N 411 TYR CD2 HD2 sing N N 412 TYR CE1 CZ doub Y N 413 TYR CE1 HE1 sing N N 414 TYR CE2 CZ sing Y N 415 TYR CE2 HE2 sing N N 416 TYR CZ OH sing N N 417 TYR OH HH sing N N 418 TYR OXT HXT sing N N 419 VAL N CA sing N N 420 VAL N H sing N N 421 VAL N H2 sing N N 422 VAL CA C sing N N 423 VAL CA CB sing N N 424 VAL CA HA sing N N 425 VAL C O doub N N 426 VAL C OXT sing N N 427 VAL CB CG1 sing N N 428 VAL CB CG2 sing N N 429 VAL CB HB sing N N 430 VAL CG1 HG11 sing N N 431 VAL CG1 HG12 sing N N 432 VAL CG1 HG13 sing N N 433 VAL CG2 HG21 sing N N 434 VAL CG2 HG22 sing N N 435 VAL CG2 HG23 sing N N 436 VAL OXT HXT sing N N 437 # _pdbx_audit_support.funding_organization 'Swiss National Science Foundation' _pdbx_audit_support.country Switzerland _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 8P5Y _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 41 2 2' _space_group.name_Hall 'I 4bw 2bw' _space_group.IT_number 98 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9FNR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017513 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017513 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005807 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? ? ? ? ? ? ? ? ? ? ? ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? NI ? ? 22.93579 4.97432 ? ? 2.39430 34.99046 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_