data_9FW5 # _entry.id 9FW5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9FW5 pdb_00009fw5 10.2210/pdb9fw5/pdb WWPDB D_1292139838 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-07-09 ? 2 'Structure model' 1 1 2025-12-10 ? 3 'Structure model' 1 2 2025-12-17 ? 4 'Structure model' 1 3 2026-01-07 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.pdbx_database_id_PubMed' 10 3 'Structure model' '_citation.title' 11 4 'Structure model' '_citation.journal_volume' 12 4 'Structure model' '_citation.page_first' 13 4 'Structure model' '_citation.page_last' 14 4 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9FW5 _pdbx_database_status.recvd_initial_deposition_date 2024-06-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email gustav.oberdorfer@tugraz.at _pdbx_contact_author.name_first Gustav _pdbx_contact_author.name_last Oberdorfer _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6144-9114 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bijelic, A.' 1 0000-0002-8781-153X 'Braun, M.' 2 0000-0001-6473-3463 'Stoll, D.' 3 0009-0007-9431-915X 'Tripp, A.' 4 0000-0001-5217-2400 'Chakatok, M.' 5 0009-0002-7346-0350 'Oberdorfer, G.' 6 0000-0002-6144-9114 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 649 _citation.language ? _citation.page_first 237 _citation.page_last 245 _citation.title 'Computational enzyme design by catalytic motif scaffolding.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-025-09747-9 _citation.pdbx_database_id_PubMed 41339546 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Braun, M.' 1 ? primary 'Tripp, A.' 2 ? primary 'Chakatok, M.' 3 ? primary 'Kaltenbrunner, S.' 4 ? primary 'Fischer, C.' 5 ? primary 'Stoll, D.' 6 ? primary 'Bijelic, A.' 7 ? primary 'Elaily, W.' 8 ? primary 'Totaro, M.G.' 9 ? primary 'Moser, M.' 10 ? primary 'Hoch, S.Y.' 11 ? primary 'Lechner, H.' 12 ? primary 'Rossi, F.' 13 ? primary 'Aleotti, M.' 14 ? primary 'Hall, M.' 15 ? primary 'Oberdorfer, G.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Retroaldolase 17 (RAD17)' 22704.236 1 ? ? ? 'de novo enzyme' 2 non-polymer syn 'NONAETHYLENE GLYCOL' 414.488 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTPEEEARAAVDSFPEALRQRAWDLNVKSAEKLAKYGIEKVTELALKLLKEIFEKYVEGKITREDLPEVVKKILVLLSLV KATAIYSKEGLEKILELLKEIAKELRERGETLLAEAIDYLIEALEKLHKGDADGYLTLLTIALYLYFKHIVENGARDPEL AAAVRPLVEGGYEAVARYYFEVFAPKLEEGTEEAVKLFEE ; _entity_poly.pdbx_seq_one_letter_code_can ;MTPEEEARAAVDSFPEALRQRAWDLNVKSAEKLAKYGIEKVTELALKLLKEIFEKYVEGKITREDLPEVVKKILVLLSLV KATAIYSKEGLEKILELLKEIAKELRERGETLLAEAIDYLIEALEKLHKGDADGYLTLLTIALYLYFKHIVENGARDPEL AAAVRPLVEGGYEAVARYYFEVFAPKLEEGTEEAVKLFEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'NONAETHYLENE GLYCOL' _pdbx_entity_nonpoly.comp_id 2PE # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 PRO n 1 4 GLU n 1 5 GLU n 1 6 GLU n 1 7 ALA n 1 8 ARG n 1 9 ALA n 1 10 ALA n 1 11 VAL n 1 12 ASP n 1 13 SER n 1 14 PHE n 1 15 PRO n 1 16 GLU n 1 17 ALA n 1 18 LEU n 1 19 ARG n 1 20 GLN n 1 21 ARG n 1 22 ALA n 1 23 TRP n 1 24 ASP n 1 25 LEU n 1 26 ASN n 1 27 VAL n 1 28 LYS n 1 29 SER n 1 30 ALA n 1 31 GLU n 1 32 LYS n 1 33 LEU n 1 34 ALA n 1 35 LYS n 1 36 TYR n 1 37 GLY n 1 38 ILE n 1 39 GLU n 1 40 LYS n 1 41 VAL n 1 42 THR n 1 43 GLU n 1 44 LEU n 1 45 ALA n 1 46 LEU n 1 47 LYS n 1 48 LEU n 1 49 LEU n 1 50 LYS n 1 51 GLU n 1 52 ILE n 1 53 PHE n 1 54 GLU n 1 55 LYS n 1 56 TYR n 1 57 VAL n 1 58 GLU n 1 59 GLY n 1 60 LYS n 1 61 ILE n 1 62 THR n 1 63 ARG n 1 64 GLU n 1 65 ASP n 1 66 LEU n 1 67 PRO n 1 68 GLU n 1 69 VAL n 1 70 VAL n 1 71 LYS n 1 72 LYS n 1 73 ILE n 1 74 LEU n 1 75 VAL n 1 76 LEU n 1 77 LEU n 1 78 SER n 1 79 LEU n 1 80 VAL n 1 81 LYS n 1 82 ALA n 1 83 THR n 1 84 ALA n 1 85 ILE n 1 86 TYR n 1 87 SER n 1 88 LYS n 1 89 GLU n 1 90 GLY n 1 91 LEU n 1 92 GLU n 1 93 LYS n 1 94 ILE n 1 95 LEU n 1 96 GLU n 1 97 LEU n 1 98 LEU n 1 99 LYS n 1 100 GLU n 1 101 ILE n 1 102 ALA n 1 103 LYS n 1 104 GLU n 1 105 LEU n 1 106 ARG n 1 107 GLU n 1 108 ARG n 1 109 GLY n 1 110 GLU n 1 111 THR n 1 112 LEU n 1 113 LEU n 1 114 ALA n 1 115 GLU n 1 116 ALA n 1 117 ILE n 1 118 ASP n 1 119 TYR n 1 120 LEU n 1 121 ILE n 1 122 GLU n 1 123 ALA n 1 124 LEU n 1 125 GLU n 1 126 LYS n 1 127 LEU n 1 128 HIS n 1 129 LYS n 1 130 GLY n 1 131 ASP n 1 132 ALA n 1 133 ASP n 1 134 GLY n 1 135 TYR n 1 136 LEU n 1 137 THR n 1 138 LEU n 1 139 LEU n 1 140 THR n 1 141 ILE n 1 142 ALA n 1 143 LEU n 1 144 TYR n 1 145 LEU n 1 146 TYR n 1 147 PHE n 1 148 LYS n 1 149 HIS n 1 150 ILE n 1 151 VAL n 1 152 GLU n 1 153 ASN n 1 154 GLY n 1 155 ALA n 1 156 ARG n 1 157 ASP n 1 158 PRO n 1 159 GLU n 1 160 LEU n 1 161 ALA n 1 162 ALA n 1 163 ALA n 1 164 VAL n 1 165 ARG n 1 166 PRO n 1 167 LEU n 1 168 VAL n 1 169 GLU n 1 170 GLY n 1 171 GLY n 1 172 TYR n 1 173 GLU n 1 174 ALA n 1 175 VAL n 1 176 ALA n 1 177 ARG n 1 178 TYR n 1 179 TYR n 1 180 PHE n 1 181 GLU n 1 182 VAL n 1 183 PHE n 1 184 ALA n 1 185 PRO n 1 186 LYS n 1 187 LEU n 1 188 GLU n 1 189 GLU n 1 190 GLY n 1 191 THR n 1 192 GLU n 1 193 GLU n 1 194 ALA n 1 195 VAL n 1 196 LYS n 1 197 LEU n 1 198 PHE n 1 199 GLU n 1 200 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 200 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2PE non-polymer . 'NONAETHYLENE GLYCOL' ? 'C18 H38 O10' 414.488 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 TYR 135 135 135 TYR TYR A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 TYR 144 144 144 TYR TYR A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 HIS 149 149 149 HIS HIS A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 VAL 164 164 164 VAL VAL A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 TYR 179 179 179 TYR TYR A . n A 1 180 PHE 180 180 180 PHE PHE A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 PHE 183 183 183 PHE PHE A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 PHE 198 198 198 PHE PHE A . n A 1 199 GLU 199 199 ? ? ? A . n A 1 200 GLU 200 200 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id 2PE _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 301 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id 2PE _pdbx_nonpoly_scheme.auth_mon_id 2PE _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLN 20 ? CG ? A GLN 20 CG 2 1 Y 1 A GLN 20 ? CD ? A GLN 20 CD 3 1 Y 1 A GLN 20 ? OE1 ? A GLN 20 OE1 4 1 Y 1 A GLN 20 ? NE2 ? A GLN 20 NE2 5 1 Y 1 A LYS 28 ? CG ? A LYS 28 CG 6 1 Y 1 A LYS 28 ? CD ? A LYS 28 CD 7 1 Y 1 A LYS 28 ? CE ? A LYS 28 CE 8 1 Y 1 A LYS 28 ? NZ ? A LYS 28 NZ 9 1 Y 1 A LYS 32 ? CG ? A LYS 32 CG 10 1 Y 1 A LYS 32 ? CD ? A LYS 32 CD 11 1 Y 1 A LYS 32 ? CE ? A LYS 32 CE 12 1 Y 1 A LYS 32 ? NZ ? A LYS 32 NZ 13 1 Y 1 A LYS 35 ? CG ? A LYS 35 CG 14 1 Y 1 A LYS 35 ? CD ? A LYS 35 CD 15 1 Y 1 A LYS 35 ? CE ? A LYS 35 CE 16 1 Y 1 A LYS 35 ? NZ ? A LYS 35 NZ 17 1 Y 1 A LYS 40 ? CG ? A LYS 40 CG 18 1 Y 1 A LYS 40 ? CD ? A LYS 40 CD 19 1 Y 1 A LYS 40 ? CE ? A LYS 40 CE 20 1 Y 1 A LYS 40 ? NZ ? A LYS 40 NZ 21 1 Y 1 A GLU 43 ? CG ? A GLU 43 CG 22 1 Y 1 A GLU 43 ? CD ? A GLU 43 CD 23 1 Y 1 A GLU 43 ? OE1 ? A GLU 43 OE1 24 1 Y 1 A GLU 43 ? OE2 ? A GLU 43 OE2 25 1 Y 1 A LYS 47 ? CG ? A LYS 47 CG 26 1 Y 1 A LYS 47 ? CD ? A LYS 47 CD 27 1 Y 1 A LYS 47 ? CE ? A LYS 47 CE 28 1 Y 1 A LYS 47 ? NZ ? A LYS 47 NZ 29 1 Y 1 A LYS 55 ? CG ? A LYS 55 CG 30 1 Y 1 A LYS 55 ? CD ? A LYS 55 CD 31 1 Y 1 A LYS 55 ? CE ? A LYS 55 CE 32 1 Y 1 A LYS 55 ? NZ ? A LYS 55 NZ 33 1 Y 1 A LYS 60 ? CG ? A LYS 60 CG 34 1 Y 1 A LYS 60 ? CD ? A LYS 60 CD 35 1 Y 1 A LYS 60 ? CE ? A LYS 60 CE 36 1 Y 1 A LYS 60 ? NZ ? A LYS 60 NZ 37 1 Y 1 A THR 62 ? OG1 ? A THR 62 OG1 38 1 Y 1 A THR 62 ? CG2 ? A THR 62 CG2 39 1 Y 1 A ARG 63 ? CG ? A ARG 63 CG 40 1 Y 1 A ARG 63 ? CD ? A ARG 63 CD 41 1 Y 1 A ARG 63 ? NE ? A ARG 63 NE 42 1 Y 1 A ARG 63 ? CZ ? A ARG 63 CZ 43 1 Y 1 A ARG 63 ? NH1 ? A ARG 63 NH1 44 1 Y 1 A ARG 63 ? NH2 ? A ARG 63 NH2 45 1 Y 1 A GLU 64 ? CG ? A GLU 64 CG 46 1 Y 1 A GLU 64 ? CD ? A GLU 64 CD 47 1 Y 1 A GLU 64 ? OE1 ? A GLU 64 OE1 48 1 Y 1 A GLU 64 ? OE2 ? A GLU 64 OE2 49 1 Y 1 A ASP 65 ? CG ? A ASP 65 CG 50 1 Y 1 A ASP 65 ? OD1 ? A ASP 65 OD1 51 1 Y 1 A ASP 65 ? OD2 ? A ASP 65 OD2 52 1 Y 1 A LEU 66 ? CG ? A LEU 66 CG 53 1 Y 1 A LEU 66 ? CD1 ? A LEU 66 CD1 54 1 Y 1 A LEU 66 ? CD2 ? A LEU 66 CD2 55 1 Y 1 A GLU 68 ? CG ? A GLU 68 CG 56 1 Y 1 A GLU 68 ? CD ? A GLU 68 CD 57 1 Y 1 A GLU 68 ? OE1 ? A GLU 68 OE1 58 1 Y 1 A GLU 68 ? OE2 ? A GLU 68 OE2 59 1 Y 1 A LYS 71 ? CG ? A LYS 71 CG 60 1 Y 1 A LYS 71 ? CD ? A LYS 71 CD 61 1 Y 1 A LYS 71 ? CE ? A LYS 71 CE 62 1 Y 1 A LYS 71 ? NZ ? A LYS 71 NZ 63 1 Y 1 A LYS 72 ? CG ? A LYS 72 CG 64 1 Y 1 A LYS 72 ? CD ? A LYS 72 CD 65 1 Y 1 A LYS 72 ? CE ? A LYS 72 CE 66 1 Y 1 A LYS 72 ? NZ ? A LYS 72 NZ 67 1 Y 1 A LYS 93 ? CG ? A LYS 93 CG 68 1 Y 1 A LYS 93 ? CD ? A LYS 93 CD 69 1 Y 1 A LYS 93 ? CE ? A LYS 93 CE 70 1 Y 1 A LYS 93 ? NZ ? A LYS 93 NZ 71 1 Y 1 A GLU 96 ? CG ? A GLU 96 CG 72 1 Y 1 A GLU 96 ? CD ? A GLU 96 CD 73 1 Y 1 A GLU 96 ? OE1 ? A GLU 96 OE1 74 1 Y 1 A GLU 96 ? OE2 ? A GLU 96 OE2 75 1 Y 1 A LYS 129 ? CG ? A LYS 129 CG 76 1 Y 1 A LYS 129 ? CD ? A LYS 129 CD 77 1 Y 1 A LYS 129 ? CE ? A LYS 129 CE 78 1 Y 1 A LYS 129 ? NZ ? A LYS 129 NZ 79 1 Y 1 A GLU 169 ? CG ? A GLU 169 CG 80 1 Y 1 A GLU 169 ? CD ? A GLU 169 CD 81 1 Y 1 A GLU 169 ? OE1 ? A GLU 169 OE1 82 1 Y 1 A GLU 169 ? OE2 ? A GLU 169 OE2 83 1 Y 1 A GLU 181 ? CG ? A GLU 181 CG 84 1 Y 1 A GLU 181 ? CD ? A GLU 181 CD 85 1 Y 1 A GLU 181 ? OE1 ? A GLU 181 OE1 86 1 Y 1 A GLU 181 ? OE2 ? A GLU 181 OE2 87 1 Y 1 A GLU 188 ? CG ? A GLU 188 CG 88 1 Y 1 A GLU 188 ? CD ? A GLU 188 CD 89 1 Y 1 A GLU 188 ? OE1 ? A GLU 188 OE1 90 1 Y 1 A GLU 188 ? OE2 ? A GLU 188 OE2 91 1 Y 1 A GLU 192 ? CG ? A GLU 192 CG 92 1 Y 1 A GLU 192 ? CD ? A GLU 192 CD 93 1 Y 1 A GLU 192 ? OE1 ? A GLU 192 OE1 94 1 Y 1 A GLU 192 ? OE2 ? A GLU 192 OE2 95 1 Y 1 A LYS 196 ? CG ? A LYS 196 CG 96 1 Y 1 A LYS 196 ? CD ? A LYS 196 CD 97 1 Y 1 A LYS 196 ? CE ? A LYS 196 CE 98 1 Y 1 A LYS 196 ? NZ ? A LYS 196 NZ 99 1 N 1 A 2PE 301 ? C23 ? B 2PE 1 C23 100 1 N 1 A 2PE 301 ? C24 ? B 2PE 1 C24 101 1 N 1 A 2PE 301 ? O25 ? B 2PE 1 O25 102 1 N 1 A 2PE 301 ? C26 ? B 2PE 1 C26 103 1 N 1 A 2PE 301 ? C27 ? B 2PE 1 C27 104 1 N 1 A 2PE 301 ? O28 ? B 2PE 1 O28 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.21_5207: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9FW5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 107.108 _cell.length_a_esd ? _cell.length_b 107.108 _cell.length_b_esd ? _cell.length_c 52.415 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9FW5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 80 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9FW5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.85 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.1 M DL-Malic acid' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-04-11 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9677 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9677 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 25.73 _reflns.entry_id 9FW5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.9 _reflns.d_resolution_low 53.554 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6735 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.55 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.89 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.111 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.9 _reflns_shell.d_res_low 3.004 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 645 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.525 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9FW5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.90 _refine.ls_d_res_low 53.55 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6728 _refine.ls_number_reflns_R_free 305 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.59 _refine.ls_percent_reflns_R_free 4.53 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2396 _refine.ls_R_factor_R_free 0.2752 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2379 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.23 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.28 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.90 _refine_hist.d_res_low 53.55 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1499 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1477 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 1523 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.415 ? 2068 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 20.371 ? 545 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.079 ? 249 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 ? 260 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.90 3.65 . . 130 3209 100.00 . . . . 0.2833 . . . . . . . . . . . 0.3357 'X-RAY DIFFRACTION' 3.65 53.55 . . 175 3214 100.00 . . . . 0.2063 . . . . . . . . . . . 0.2427 # _struct.entry_id 9FW5 _struct.title 'Retroaldolase 17 (RAD17)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9FW5 _struct_keywords.text 'Retroaldolase, de novo enzyme, RFdiffusion, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9FW5 _struct_ref.pdbx_db_accession 9FW5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9FW5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 200 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9FW5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 200 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 910 ? 1 MORE -2 ? 1 'SSA (A^2)' 9210 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 2 ? SER A 13 ? THR A 2 SER A 13 1 ? 12 HELX_P HELX_P2 AA2 PRO A 15 ? LYS A 35 ? PRO A 15 LYS A 35 1 ? 21 HELX_P HELX_P3 AA3 GLY A 37 ? GLU A 58 ? GLY A 37 GLU A 58 1 ? 22 HELX_P HELX_P4 AA4 THR A 62 ? GLU A 64 ? THR A 62 GLU A 64 5 ? 3 HELX_P HELX_P5 AA5 ASP A 65 ? SER A 87 ? ASP A 65 SER A 87 1 ? 23 HELX_P HELX_P6 AA6 SER A 87 ? ARG A 108 ? SER A 87 ARG A 108 1 ? 22 HELX_P HELX_P7 AA7 GLU A 110 ? LYS A 129 ? GLU A 110 LYS A 129 1 ? 20 HELX_P HELX_P8 AA8 ASP A 131 ? ASN A 153 ? ASP A 131 ASN A 153 1 ? 23 HELX_P HELX_P9 AA9 GLY A 154 ? ARG A 156 ? GLY A 154 ARG A 156 5 ? 3 HELX_P HELX_P10 AB1 ASP A 157 ? GLY A 170 ? ASP A 157 GLY A 170 1 ? 14 HELX_P HELX_P11 AB2 GLY A 170 ? VAL A 182 ? GLY A 170 VAL A 182 1 ? 13 HELX_P HELX_P12 AB3 VAL A 182 ? PHE A 198 ? VAL A 182 PHE A 198 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9FW5 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 107 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NH2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 165 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_545 _pdbx_validate_symm_contact.dist 2.01 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 157 ? ? -165.69 81.79 2 1 VAL A 182 ? ? -121.76 -52.58 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x,z+3/4 3 y+1/2,-x,z+3/4 4 -x,-y,z 5 x+1/2,y+1/2,z+1/2 6 -y+1,x+1/2,z+5/4 7 y+1,-x+1/2,z+5/4 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 6.1601 -28.1398 -18.6902 0.2741 ? 0.0205 ? 0.1288 ? 0.3469 ? 0.1816 ? 0.6215 ? 1.5873 ? -0.6495 ? 0.2457 ? 1.3174 ? 0.3300 ? 0.3833 ? -0.3481 ? -0.3064 ? 0.2174 ? 0.0531 ? 0.0506 ? -1.0422 ? -0.3393 ? 0.3571 ? 0.0898 ? 2 'X-RAY DIFFRACTION' ? refined -16.1841 -20.4324 -12.9771 0.9081 ? 0.0369 ? 0.4325 ? 0.8682 ? -0.0089 ? 1.4368 ? 0.2450 ? 0.0453 ? -0.1524 ? 0.2722 ? -0.1735 ? 0.8215 ? 0.4470 ? -0.5725 ? 0.2607 ? 0.8986 ? 0.0498 ? 0.5316 ? -0.4353 ? -0.1480 ? -0.0507 ? 3 'X-RAY DIFFRACTION' ? refined -1.4455 -32.7862 -15.3582 0.2603 ? 0.0552 ? -0.0497 ? 0.3693 ? 0.1749 ? 0.8033 ? 1.4141 ? -0.4395 ? 0.9806 ? 0.1640 ? -0.3586 ? 0.8473 ? -0.3206 ? -0.6217 ? -0.2184 ? 0.5514 ? -0.0342 ? -0.3693 ? -0.2197 ? -0.0300 ? -1.1657 ? 4 'X-RAY DIFFRACTION' ? refined -1.7682 -24.4411 -27.0980 0.1545 ? 0.0198 ? 0.0631 ? 0.2042 ? 0.3944 ? 0.7233 ? 0.2720 ? -0.2162 ? 0.3107 ? 1.6221 ? 0.3774 ? 0.7592 ? -0.1769 ? 0.4911 ? 0.4724 ? -0.5054 ? 0.1128 ? -0.9298 ? -0.3148 ? 0.5129 ? -0.6264 ? 5 'X-RAY DIFFRACTION' ? refined 5.8047 -20.5502 -10.2510 1.0913 ? 0.0060 ? -0.0803 ? 0.6276 ? -0.3084 ? 1.3749 ? 4.4404 ? 0.5960 ? -0.5270 ? 1.8538 ? -2.0541 ? 3.0681 ? 0.0019 ? -1.0199 ? 0.2755 ? 0.0617 ? -0.5140 ? 0.0352 ? -0.4394 ? -0.3739 ? 0.0153 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 2 through 57 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 58 through 64 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 65 through 107 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 108 through 181 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 182 through 198 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 199 ? A GLU 199 3 1 Y 1 A GLU 200 ? A GLU 200 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 2PE O1 O N N 1 2PE C2 C N N 2 2PE C3 C N N 3 2PE O4 O N N 4 2PE C5 C N N 5 2PE C6 C N N 6 2PE O7 O N N 7 2PE C8 C N N 8 2PE C9 C N N 9 2PE O10 O N N 10 2PE C11 C N N 11 2PE C12 C N N 12 2PE O13 O N N 13 2PE C14 C N N 14 2PE C15 C N N 15 2PE O16 O N N 16 2PE C17 C N N 17 2PE C18 C N N 18 2PE O19 O N N 19 2PE C20 C N N 20 2PE C21 C N N 21 2PE O22 O N N 22 2PE C23 C N N 23 2PE C24 C N N 24 2PE O25 O N N 25 2PE C26 C N N 26 2PE C27 C N N 27 2PE O28 O N N 28 2PE HO1 H N N 29 2PE H21 H N N 30 2PE H22 H N N 31 2PE H31 H N N 32 2PE H32 H N N 33 2PE H51 H N N 34 2PE H52 H N N 35 2PE H61 H N N 36 2PE H62 H N N 37 2PE H81 H N N 38 2PE H82 H N N 39 2PE H91 H N N 40 2PE H92 H N N 41 2PE H111 H N N 42 2PE H112 H N N 43 2PE H121 H N N 44 2PE H122 H N N 45 2PE H141 H N N 46 2PE H142 H N N 47 2PE H151 H N N 48 2PE H152 H N N 49 2PE H171 H N N 50 2PE H172 H N N 51 2PE H181 H N N 52 2PE H182 H N N 53 2PE H201 H N N 54 2PE H202 H N N 55 2PE H211 H N N 56 2PE H212 H N N 57 2PE H231 H N N 58 2PE H232 H N N 59 2PE H241 H N N 60 2PE H242 H N N 61 2PE H261 H N N 62 2PE H262 H N N 63 2PE H271 H N N 64 2PE H272 H N N 65 2PE HO2 H N N 66 ALA N N N N 67 ALA CA C N S 68 ALA C C N N 69 ALA O O N N 70 ALA CB C N N 71 ALA OXT O N N 72 ALA H H N N 73 ALA H2 H N N 74 ALA HA H N N 75 ALA HB1 H N N 76 ALA HB2 H N N 77 ALA HB3 H N N 78 ALA HXT H N N 79 ARG N N N N 80 ARG CA C N S 81 ARG C C N N 82 ARG O O N N 83 ARG CB C N N 84 ARG CG C N N 85 ARG CD C N N 86 ARG NE N N N 87 ARG CZ C N N 88 ARG NH1 N N N 89 ARG NH2 N N N 90 ARG OXT O N N 91 ARG H H N N 92 ARG H2 H N N 93 ARG HA H N N 94 ARG HB2 H N N 95 ARG HB3 H N N 96 ARG HG2 H N N 97 ARG HG3 H N N 98 ARG HD2 H N N 99 ARG HD3 H N N 100 ARG HE H N N 101 ARG HH11 H N N 102 ARG HH12 H N N 103 ARG HH21 H N N 104 ARG HH22 H N N 105 ARG HXT H N N 106 ASN N N N N 107 ASN CA C N S 108 ASN C C N N 109 ASN O O N N 110 ASN CB C N N 111 ASN CG C N N 112 ASN OD1 O N N 113 ASN ND2 N N N 114 ASN OXT O N N 115 ASN H H N N 116 ASN H2 H N N 117 ASN HA H N N 118 ASN HB2 H N N 119 ASN HB3 H N N 120 ASN HD21 H N N 121 ASN HD22 H N N 122 ASN HXT H N N 123 ASP N N N N 124 ASP CA C N S 125 ASP C C N N 126 ASP O O N N 127 ASP CB C N N 128 ASP CG C N N 129 ASP OD1 O N N 130 ASP OD2 O N N 131 ASP OXT O N N 132 ASP H H N N 133 ASP H2 H N N 134 ASP HA H N N 135 ASP HB2 H N N 136 ASP HB3 H N N 137 ASP HD2 H N N 138 ASP HXT H N N 139 GLN N N N N 140 GLN CA C N S 141 GLN C C N N 142 GLN O O N N 143 GLN CB C N N 144 GLN CG C N N 145 GLN CD C N N 146 GLN OE1 O N N 147 GLN NE2 N N N 148 GLN OXT O N N 149 GLN H H N N 150 GLN H2 H N N 151 GLN HA H N N 152 GLN HB2 H N N 153 GLN HB3 H N N 154 GLN HG2 H N N 155 GLN HG3 H N N 156 GLN HE21 H N N 157 GLN HE22 H N N 158 GLN HXT H N N 159 GLU N N N N 160 GLU CA C N S 161 GLU C C N N 162 GLU O O N N 163 GLU CB C N N 164 GLU CG C N N 165 GLU CD C N N 166 GLU OE1 O N N 167 GLU OE2 O N N 168 GLU OXT O N N 169 GLU H H N N 170 GLU H2 H N N 171 GLU HA H N N 172 GLU HB2 H N N 173 GLU HB3 H N N 174 GLU HG2 H N N 175 GLU HG3 H N N 176 GLU HE2 H N N 177 GLU HXT H N N 178 GLY N N N N 179 GLY CA C N N 180 GLY C C N N 181 GLY O O N N 182 GLY OXT O N N 183 GLY H H N N 184 GLY H2 H N N 185 GLY HA2 H N N 186 GLY HA3 H N N 187 GLY HXT H N N 188 HIS N N N N 189 HIS CA C N S 190 HIS C C N N 191 HIS O O N N 192 HIS CB C N N 193 HIS CG C Y N 194 HIS ND1 N Y N 195 HIS CD2 C Y N 196 HIS CE1 C Y N 197 HIS NE2 N Y N 198 HIS OXT O N N 199 HIS H H N N 200 HIS H2 H N N 201 HIS HA H N N 202 HIS HB2 H N N 203 HIS HB3 H N N 204 HIS HD1 H N N 205 HIS HD2 H N N 206 HIS HE1 H N N 207 HIS HE2 H N N 208 HIS HXT H N N 209 ILE N N N N 210 ILE CA C N S 211 ILE C C N N 212 ILE O O N N 213 ILE CB C N S 214 ILE CG1 C N N 215 ILE CG2 C N N 216 ILE CD1 C N N 217 ILE OXT O N N 218 ILE H H N N 219 ILE H2 H N N 220 ILE HA H N N 221 ILE HB H N N 222 ILE HG12 H N N 223 ILE HG13 H N N 224 ILE HG21 H N N 225 ILE HG22 H N N 226 ILE HG23 H N N 227 ILE HD11 H N N 228 ILE HD12 H N N 229 ILE HD13 H N N 230 ILE HXT H N N 231 LEU N N N N 232 LEU CA C N S 233 LEU C C N N 234 LEU O O N N 235 LEU CB C N N 236 LEU CG C N N 237 LEU CD1 C N N 238 LEU CD2 C N N 239 LEU OXT O N N 240 LEU H H N N 241 LEU H2 H N N 242 LEU HA H N N 243 LEU HB2 H N N 244 LEU HB3 H N N 245 LEU HG H N N 246 LEU HD11 H N N 247 LEU HD12 H N N 248 LEU HD13 H N N 249 LEU HD21 H N N 250 LEU HD22 H N N 251 LEU HD23 H N N 252 LEU HXT H N N 253 LYS N N N N 254 LYS CA C N S 255 LYS C C N N 256 LYS O O N N 257 LYS CB C N N 258 LYS CG C N N 259 LYS CD C N N 260 LYS CE C N N 261 LYS NZ N N N 262 LYS OXT O N N 263 LYS H H N N 264 LYS H2 H N N 265 LYS HA H N N 266 LYS HB2 H N N 267 LYS HB3 H N N 268 LYS HG2 H N N 269 LYS HG3 H N N 270 LYS HD2 H N N 271 LYS HD3 H N N 272 LYS HE2 H N N 273 LYS HE3 H N N 274 LYS HZ1 H N N 275 LYS HZ2 H N N 276 LYS HZ3 H N N 277 LYS HXT H N N 278 MET N N N N 279 MET CA C N S 280 MET C C N N 281 MET O O N N 282 MET CB C N N 283 MET CG C N N 284 MET SD S N N 285 MET CE C N N 286 MET OXT O N N 287 MET H H N N 288 MET H2 H N N 289 MET HA H N N 290 MET HB2 H N N 291 MET HB3 H N N 292 MET HG2 H N N 293 MET HG3 H N N 294 MET HE1 H N N 295 MET HE2 H N N 296 MET HE3 H N N 297 MET HXT H N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TRP N N N N 370 TRP CA C N S 371 TRP C C N N 372 TRP O O N N 373 TRP CB C N N 374 TRP CG C Y N 375 TRP CD1 C Y N 376 TRP CD2 C Y N 377 TRP NE1 N Y N 378 TRP CE2 C Y N 379 TRP CE3 C Y N 380 TRP CZ2 C Y N 381 TRP CZ3 C Y N 382 TRP CH2 C Y N 383 TRP OXT O N N 384 TRP H H N N 385 TRP H2 H N N 386 TRP HA H N N 387 TRP HB2 H N N 388 TRP HB3 H N N 389 TRP HD1 H N N 390 TRP HE1 H N N 391 TRP HE3 H N N 392 TRP HZ2 H N N 393 TRP HZ3 H N N 394 TRP HH2 H N N 395 TRP HXT H N N 396 TYR N N N N 397 TYR CA C N S 398 TYR C C N N 399 TYR O O N N 400 TYR CB C N N 401 TYR CG C Y N 402 TYR CD1 C Y N 403 TYR CD2 C Y N 404 TYR CE1 C Y N 405 TYR CE2 C Y N 406 TYR CZ C Y N 407 TYR OH O N N 408 TYR OXT O N N 409 TYR H H N N 410 TYR H2 H N N 411 TYR HA H N N 412 TYR HB2 H N N 413 TYR HB3 H N N 414 TYR HD1 H N N 415 TYR HD2 H N N 416 TYR HE1 H N N 417 TYR HE2 H N N 418 TYR HH H N N 419 TYR HXT H N N 420 VAL N N N N 421 VAL CA C N S 422 VAL C C N N 423 VAL O O N N 424 VAL CB C N N 425 VAL CG1 C N N 426 VAL CG2 C N N 427 VAL OXT O N N 428 VAL H H N N 429 VAL H2 H N N 430 VAL HA H N N 431 VAL HB H N N 432 VAL HG11 H N N 433 VAL HG12 H N N 434 VAL HG13 H N N 435 VAL HG21 H N N 436 VAL HG22 H N N 437 VAL HG23 H N N 438 VAL HXT H N N 439 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 2PE O1 C2 sing N N 1 2PE O1 HO1 sing N N 2 2PE C2 C3 sing N N 3 2PE C2 H21 sing N N 4 2PE C2 H22 sing N N 5 2PE C3 O4 sing N N 6 2PE C3 H31 sing N N 7 2PE C3 H32 sing N N 8 2PE O4 C5 sing N N 9 2PE C5 C6 sing N N 10 2PE C5 H51 sing N N 11 2PE C5 H52 sing N N 12 2PE C6 O7 sing N N 13 2PE C6 H61 sing N N 14 2PE C6 H62 sing N N 15 2PE O7 C8 sing N N 16 2PE C8 C9 sing N N 17 2PE C8 H81 sing N N 18 2PE C8 H82 sing N N 19 2PE C9 O10 sing N N 20 2PE C9 H91 sing N N 21 2PE C9 H92 sing N N 22 2PE O10 C11 sing N N 23 2PE C11 C12 sing N N 24 2PE C11 H111 sing N N 25 2PE C11 H112 sing N N 26 2PE C12 O13 sing N N 27 2PE C12 H121 sing N N 28 2PE C12 H122 sing N N 29 2PE O13 C14 sing N N 30 2PE C14 C15 sing N N 31 2PE C14 H141 sing N N 32 2PE C14 H142 sing N N 33 2PE C15 O16 sing N N 34 2PE C15 H151 sing N N 35 2PE C15 H152 sing N N 36 2PE O16 C17 sing N N 37 2PE C17 C18 sing N N 38 2PE C17 H171 sing N N 39 2PE C17 H172 sing N N 40 2PE C18 O19 sing N N 41 2PE C18 H181 sing N N 42 2PE C18 H182 sing N N 43 2PE O19 C20 sing N N 44 2PE C20 C21 sing N N 45 2PE C20 H201 sing N N 46 2PE C20 H202 sing N N 47 2PE C21 O22 sing N N 48 2PE C21 H211 sing N N 49 2PE C21 H212 sing N N 50 2PE O22 C23 sing N N 51 2PE C23 C24 sing N N 52 2PE C23 H231 sing N N 53 2PE C23 H232 sing N N 54 2PE C24 O25 sing N N 55 2PE C24 H241 sing N N 56 2PE C24 H242 sing N N 57 2PE O25 C26 sing N N 58 2PE C26 C27 sing N N 59 2PE C26 H261 sing N N 60 2PE C26 H262 sing N N 61 2PE C27 O28 sing N N 62 2PE C27 H271 sing N N 63 2PE C27 H272 sing N N 64 2PE O28 HO2 sing N N 65 ALA N CA sing N N 66 ALA N H sing N N 67 ALA N H2 sing N N 68 ALA CA C sing N N 69 ALA CA CB sing N N 70 ALA CA HA sing N N 71 ALA C O doub N N 72 ALA C OXT sing N N 73 ALA CB HB1 sing N N 74 ALA CB HB2 sing N N 75 ALA CB HB3 sing N N 76 ALA OXT HXT sing N N 77 ARG N CA sing N N 78 ARG N H sing N N 79 ARG N H2 sing N N 80 ARG CA C sing N N 81 ARG CA CB sing N N 82 ARG CA HA sing N N 83 ARG C O doub N N 84 ARG C OXT sing N N 85 ARG CB CG sing N N 86 ARG CB HB2 sing N N 87 ARG CB HB3 sing N N 88 ARG CG CD sing N N 89 ARG CG HG2 sing N N 90 ARG CG HG3 sing N N 91 ARG CD NE sing N N 92 ARG CD HD2 sing N N 93 ARG CD HD3 sing N N 94 ARG NE CZ sing N N 95 ARG NE HE sing N N 96 ARG CZ NH1 sing N N 97 ARG CZ NH2 doub N N 98 ARG NH1 HH11 sing N N 99 ARG NH1 HH12 sing N N 100 ARG NH2 HH21 sing N N 101 ARG NH2 HH22 sing N N 102 ARG OXT HXT sing N N 103 ASN N CA sing N N 104 ASN N H sing N N 105 ASN N H2 sing N N 106 ASN CA C sing N N 107 ASN CA CB sing N N 108 ASN CA HA sing N N 109 ASN C O doub N N 110 ASN C OXT sing N N 111 ASN CB CG sing N N 112 ASN CB HB2 sing N N 113 ASN CB HB3 sing N N 114 ASN CG OD1 doub N N 115 ASN CG ND2 sing N N 116 ASN ND2 HD21 sing N N 117 ASN ND2 HD22 sing N N 118 ASN OXT HXT sing N N 119 ASP N CA sing N N 120 ASP N H sing N N 121 ASP N H2 sing N N 122 ASP CA C sing N N 123 ASP CA CB sing N N 124 ASP CA HA sing N N 125 ASP C O doub N N 126 ASP C OXT sing N N 127 ASP CB CG sing N N 128 ASP CB HB2 sing N N 129 ASP CB HB3 sing N N 130 ASP CG OD1 doub N N 131 ASP CG OD2 sing N N 132 ASP OD2 HD2 sing N N 133 ASP OXT HXT sing N N 134 GLN N CA sing N N 135 GLN N H sing N N 136 GLN N H2 sing N N 137 GLN CA C sing N N 138 GLN CA CB sing N N 139 GLN CA HA sing N N 140 GLN C O doub N N 141 GLN C OXT sing N N 142 GLN CB CG sing N N 143 GLN CB HB2 sing N N 144 GLN CB HB3 sing N N 145 GLN CG CD sing N N 146 GLN CG HG2 sing N N 147 GLN CG HG3 sing N N 148 GLN CD OE1 doub N N 149 GLN CD NE2 sing N N 150 GLN NE2 HE21 sing N N 151 GLN NE2 HE22 sing N N 152 GLN OXT HXT sing N N 153 GLU N CA sing N N 154 GLU N H sing N N 155 GLU N H2 sing N N 156 GLU CA C sing N N 157 GLU CA CB sing N N 158 GLU CA HA sing N N 159 GLU C O doub N N 160 GLU C OXT sing N N 161 GLU CB CG sing N N 162 GLU CB HB2 sing N N 163 GLU CB HB3 sing N N 164 GLU CG CD sing N N 165 GLU CG HG2 sing N N 166 GLU CG HG3 sing N N 167 GLU CD OE1 doub N N 168 GLU CD OE2 sing N N 169 GLU OE2 HE2 sing N N 170 GLU OXT HXT sing N N 171 GLY N CA sing N N 172 GLY N H sing N N 173 GLY N H2 sing N N 174 GLY CA C sing N N 175 GLY CA HA2 sing N N 176 GLY CA HA3 sing N N 177 GLY C O doub N N 178 GLY C OXT sing N N 179 GLY OXT HXT sing N N 180 HIS N CA sing N N 181 HIS N H sing N N 182 HIS N H2 sing N N 183 HIS CA C sing N N 184 HIS CA CB sing N N 185 HIS CA HA sing N N 186 HIS C O doub N N 187 HIS C OXT sing N N 188 HIS CB CG sing N N 189 HIS CB HB2 sing N N 190 HIS CB HB3 sing N N 191 HIS CG ND1 sing Y N 192 HIS CG CD2 doub Y N 193 HIS ND1 CE1 doub Y N 194 HIS ND1 HD1 sing N N 195 HIS CD2 NE2 sing Y N 196 HIS CD2 HD2 sing N N 197 HIS CE1 NE2 sing Y N 198 HIS CE1 HE1 sing N N 199 HIS NE2 HE2 sing N N 200 HIS OXT HXT sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LEU N CA sing N N 223 LEU N H sing N N 224 LEU N H2 sing N N 225 LEU CA C sing N N 226 LEU CA CB sing N N 227 LEU CA HA sing N N 228 LEU C O doub N N 229 LEU C OXT sing N N 230 LEU CB CG sing N N 231 LEU CB HB2 sing N N 232 LEU CB HB3 sing N N 233 LEU CG CD1 sing N N 234 LEU CG CD2 sing N N 235 LEU CG HG sing N N 236 LEU CD1 HD11 sing N N 237 LEU CD1 HD12 sing N N 238 LEU CD1 HD13 sing N N 239 LEU CD2 HD21 sing N N 240 LEU CD2 HD22 sing N N 241 LEU CD2 HD23 sing N N 242 LEU OXT HXT sing N N 243 LYS N CA sing N N 244 LYS N H sing N N 245 LYS N H2 sing N N 246 LYS CA C sing N N 247 LYS CA CB sing N N 248 LYS CA HA sing N N 249 LYS C O doub N N 250 LYS C OXT sing N N 251 LYS CB CG sing N N 252 LYS CB HB2 sing N N 253 LYS CB HB3 sing N N 254 LYS CG CD sing N N 255 LYS CG HG2 sing N N 256 LYS CG HG3 sing N N 257 LYS CD CE sing N N 258 LYS CD HD2 sing N N 259 LYS CD HD3 sing N N 260 LYS CE NZ sing N N 261 LYS CE HE2 sing N N 262 LYS CE HE3 sing N N 263 LYS NZ HZ1 sing N N 264 LYS NZ HZ2 sing N N 265 LYS NZ HZ3 sing N N 266 LYS OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 SER N CA sing N N 327 SER N H sing N N 328 SER N H2 sing N N 329 SER CA C sing N N 330 SER CA CB sing N N 331 SER CA HA sing N N 332 SER C O doub N N 333 SER C OXT sing N N 334 SER CB OG sing N N 335 SER CB HB2 sing N N 336 SER CB HB3 sing N N 337 SER OG HG sing N N 338 SER OXT HXT sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TRP N CA sing N N 356 TRP N H sing N N 357 TRP N H2 sing N N 358 TRP CA C sing N N 359 TRP CA CB sing N N 360 TRP CA HA sing N N 361 TRP C O doub N N 362 TRP C OXT sing N N 363 TRP CB CG sing N N 364 TRP CB HB2 sing N N 365 TRP CB HB3 sing N N 366 TRP CG CD1 doub Y N 367 TRP CG CD2 sing Y N 368 TRP CD1 NE1 sing Y N 369 TRP CD1 HD1 sing N N 370 TRP CD2 CE2 doub Y N 371 TRP CD2 CE3 sing Y N 372 TRP NE1 CE2 sing Y N 373 TRP NE1 HE1 sing N N 374 TRP CE2 CZ2 sing Y N 375 TRP CE3 CZ3 doub Y N 376 TRP CE3 HE3 sing N N 377 TRP CZ2 CH2 doub Y N 378 TRP CZ2 HZ2 sing N N 379 TRP CZ3 CH2 sing Y N 380 TRP CZ3 HZ3 sing N N 381 TRP CH2 HH2 sing N N 382 TRP OXT HXT sing N N 383 TYR N CA sing N N 384 TYR N H sing N N 385 TYR N H2 sing N N 386 TYR CA C sing N N 387 TYR CA CB sing N N 388 TYR CA HA sing N N 389 TYR C O doub N N 390 TYR C OXT sing N N 391 TYR CB CG sing N N 392 TYR CB HB2 sing N N 393 TYR CB HB3 sing N N 394 TYR CG CD1 doub Y N 395 TYR CG CD2 sing Y N 396 TYR CD1 CE1 sing Y N 397 TYR CD1 HD1 sing N N 398 TYR CD2 CE2 doub Y N 399 TYR CD2 HD2 sing N N 400 TYR CE1 CZ doub Y N 401 TYR CE1 HE1 sing N N 402 TYR CE2 CZ sing Y N 403 TYR CE2 HE2 sing N N 404 TYR CZ OH sing N N 405 TYR OH HH sing N N 406 TYR OXT HXT sing N N 407 VAL N CA sing N N 408 VAL N H sing N N 409 VAL N H2 sing N N 410 VAL CA C sing N N 411 VAL CA CB sing N N 412 VAL CA HA sing N N 413 VAL C O doub N N 414 VAL C OXT sing N N 415 VAL CB CG1 sing N N 416 VAL CB CG2 sing N N 417 VAL CB HB sing N N 418 VAL CG1 HG11 sing N N 419 VAL CG1 HG12 sing N N 420 VAL CG1 HG13 sing N N 421 VAL CG2 HG21 sing N N 422 VAL CG2 HG22 sing N N 423 VAL CG2 HG23 sing N N 424 VAL OXT HXT sing N N 425 # _pdbx_audit_support.funding_organization 'Austrian Science Fund' _pdbx_audit_support.country Austria _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 41' _space_group.name_Hall 'I 4bw' _space_group.IT_number 80 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9FW5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.009336 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009336 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019079 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #