data_9G1T # _entry.id 9G1T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9G1T pdb_00009g1t 10.2210/pdb9g1t/pdb WWPDB D_1292140134 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-02-26 ? 2 'Structure model' 1 1 2025-03-05 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9G1T _pdbx_database_status.recvd_initial_deposition_date 2024-07-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email honnappa.srinivas@novartis.com _pdbx_contact_author.name_first Honnappa _pdbx_contact_author.name_last Srinivas _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5171-4236 # _audit_author.name 'Srinivas, H.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 68 _citation.language ? _citation.page_first 4721 _citation.page_last 4742 _citation.title 'Discovery of GJG057, a Potent and Highly Selective Inhibitor of Leukotriene C4 Synthase.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.4c02897 _citation.pdbx_database_id_PubMed 39960261 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Thoma, G.' 1 0000-0003-0467-331X primary 'Miltz, W.' 2 ? primary 'Waelchli, R.' 3 ? primary 'Orain, D.' 4 ? primary 'Spanka, C.' 5 0000-0003-0365-204X primary 'Decoret, O.' 6 ? primary 'Wolf, R.M.' 7 ? primary 'Hurley, B.' 8 0000-0002-2436-8390 primary 'Cheung, A.K.' 9 0000-0002-2210-6362 primary 'Sandham, D.A.' 10 0000-0003-4523-9931 primary 'Honda, A.' 11 ? primary 'Tichkule, R.' 12 ? primary 'Chen, X.' 13 0000-0002-0930-0750 primary 'Patel, T.' 14 ? primary 'Labbe-Giguere, N.' 15 ? primary 'Tan, K.L.' 16 0000-0001-8243-1223 primary 'Springer, C.' 17 ? primary 'Manchester, J.' 18 ? primary 'Culshaw, A.J.' 19 ? primary 'Hunt, P.' 20 ? primary 'Srinivas, H.' 21 ? primary 'Penno, C.A.' 22 ? primary 'Ferrand, S.' 23 ? primary 'Numao, S.' 24 0000-0002-6204-7117 primary 'Schopfer, U.' 25 ? primary 'Jager, P.' 26 ? primary 'Wack, N.' 27 ? primary 'Hasler, F.' 28 ? primary 'Urban, B.' 29 ? primary 'Sindelar, M.' 30 ? primary 'Loetscher, P.' 31 ? primary 'Kiffe, M.' 32 ? primary 'Ren, X.' 33 ? primary 'Nicklin, P.' 34 ? primary 'White, K.' 35 ? primary 'Subramanian, K.' 36 ? primary 'Liu, H.' 37 ? primary 'Growcott, E.J.' 38 ? primary 'Rohn, T.A.' 39 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Leukotriene C4 synthase' 17468.596 1 4.4.1.20,2.5.1.- ? ? ? 2 non-polymer syn 'PALMITIC ACID' 256.424 1 ? ? ? ? 3 non-polymer syn 'PALMITOLEIC ACID' 254.408 1 ? ? ? ? 4 non-polymer syn '1-(4-chloranyl-3-fluoranyl-phenyl)-9-[(~{E})-3-phenylprop-2-enoyl]-1,9-diazaspiro[5.5]undecan-2-one' 426.911 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LTC4 synthase,Glutathione S-transferase LTC4,Leukotriene-C(4) synthase,Leukotriene-C4 synthase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHGKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIF FHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHGKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIF FHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PALMITIC ACID' PLM 3 'PALMITOLEIC ACID' PAM 4 '1-(4-chloranyl-3-fluoranyl-phenyl)-9-[(~{E})-3-phenylprop-2-enoyl]-1,9-diazaspiro[5.5]undecan-2-one' A1IH0 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLY n 1 9 LYS n 1 10 ASP n 1 11 GLU n 1 12 VAL n 1 13 ALA n 1 14 LEU n 1 15 LEU n 1 16 ALA n 1 17 ALA n 1 18 VAL n 1 19 THR n 1 20 LEU n 1 21 LEU n 1 22 GLY n 1 23 VAL n 1 24 LEU n 1 25 LEU n 1 26 GLN n 1 27 ALA n 1 28 TYR n 1 29 PHE n 1 30 SER n 1 31 LEU n 1 32 GLN n 1 33 VAL n 1 34 ILE n 1 35 SER n 1 36 ALA n 1 37 ARG n 1 38 ARG n 1 39 ALA n 1 40 PHE n 1 41 ARG n 1 42 VAL n 1 43 SER n 1 44 PRO n 1 45 PRO n 1 46 LEU n 1 47 THR n 1 48 THR n 1 49 GLY n 1 50 PRO n 1 51 PRO n 1 52 GLU n 1 53 PHE n 1 54 GLU n 1 55 ARG n 1 56 VAL n 1 57 TYR n 1 58 ARG n 1 59 ALA n 1 60 GLN n 1 61 VAL n 1 62 ASN n 1 63 CYS n 1 64 SER n 1 65 GLU n 1 66 TYR n 1 67 PHE n 1 68 PRO n 1 69 LEU n 1 70 PHE n 1 71 LEU n 1 72 ALA n 1 73 THR n 1 74 LEU n 1 75 TRP n 1 76 VAL n 1 77 ALA n 1 78 GLY n 1 79 ILE n 1 80 PHE n 1 81 PHE n 1 82 HIS n 1 83 GLU n 1 84 GLY n 1 85 ALA n 1 86 ALA n 1 87 ALA n 1 88 LEU n 1 89 CYS n 1 90 GLY n 1 91 LEU n 1 92 VAL n 1 93 TYR n 1 94 LEU n 1 95 PHE n 1 96 ALA n 1 97 ARG n 1 98 LEU n 1 99 ARG n 1 100 TYR n 1 101 PHE n 1 102 GLN n 1 103 GLY n 1 104 TYR n 1 105 ALA n 1 106 ARG n 1 107 SER n 1 108 ALA n 1 109 GLN n 1 110 LEU n 1 111 ARG n 1 112 LEU n 1 113 ALA n 1 114 PRO n 1 115 LEU n 1 116 TYR n 1 117 ALA n 1 118 SER n 1 119 ALA n 1 120 ARG n 1 121 ALA n 1 122 LEU n 1 123 TRP n 1 124 LEU n 1 125 LEU n 1 126 VAL n 1 127 ALA n 1 128 LEU n 1 129 ALA n 1 130 ALA n 1 131 LEU n 1 132 GLY n 1 133 LEU n 1 134 LEU n 1 135 ALA n 1 136 HIS n 1 137 PHE n 1 138 LEU n 1 139 PRO n 1 140 ALA n 1 141 ALA n 1 142 LEU n 1 143 ARG n 1 144 ALA n 1 145 ALA n 1 146 LEU n 1 147 LEU n 1 148 GLY n 1 149 ARG n 1 150 LEU n 1 151 ARG n 1 152 THR n 1 153 LEU n 1 154 LEU n 1 155 PRO n 1 156 TRP n 1 157 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 157 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LTC4S _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name Pichia _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4919 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1IH0 non-polymer . '1-(4-chloranyl-3-fluoranyl-phenyl)-9-[(~{E})-3-phenylprop-2-enoyl]-1,9-diazaspiro[5.5]undecan-2-one' ? 'C24 H24 Cl F N2 O2' 426.911 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PAM non-polymer . 'PALMITOLEIC ACID' ? 'C16 H30 O2' 254.408 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PLM non-polymer . 'PALMITIC ACID' ? 'C16 H32 O2' 256.424 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -6 ? ? ? A . n A 1 2 HIS 2 -5 ? ? ? A . n A 1 3 HIS 3 -4 ? ? ? A . n A 1 4 HIS 4 -3 ? ? ? A . n A 1 5 HIS 5 -2 ? ? ? A . n A 1 6 HIS 6 -1 ? ? ? A . n A 1 7 HIS 7 0 ? ? ? A . n A 1 8 GLY 8 1 1 GLY GLY A . n A 1 9 LYS 9 2 2 LYS LYS A . n A 1 10 ASP 10 3 3 ASP ASP A . n A 1 11 GLU 11 4 4 GLU GLU A . n A 1 12 VAL 12 5 5 VAL VAL A . n A 1 13 ALA 13 6 6 ALA ALA A . n A 1 14 LEU 14 7 7 LEU LEU A . n A 1 15 LEU 15 8 8 LEU LEU A . n A 1 16 ALA 16 9 9 ALA ALA A . n A 1 17 ALA 17 10 10 ALA ALA A . n A 1 18 VAL 18 11 11 VAL VAL A . n A 1 19 THR 19 12 12 THR THR A . n A 1 20 LEU 20 13 13 LEU LEU A . n A 1 21 LEU 21 14 14 LEU LEU A . n A 1 22 GLY 22 15 15 GLY GLY A . n A 1 23 VAL 23 16 16 VAL VAL A . n A 1 24 LEU 24 17 17 LEU LEU A . n A 1 25 LEU 25 18 18 LEU LEU A . n A 1 26 GLN 26 19 19 GLN GLN A . n A 1 27 ALA 27 20 20 ALA ALA A . n A 1 28 TYR 28 21 21 TYR TYR A . n A 1 29 PHE 29 22 22 PHE PHE A . n A 1 30 SER 30 23 23 SER SER A . n A 1 31 LEU 31 24 24 LEU LEU A . n A 1 32 GLN 32 25 25 GLN GLN A . n A 1 33 VAL 33 26 26 VAL VAL A . n A 1 34 ILE 34 27 27 ILE ILE A . n A 1 35 SER 35 28 28 SER SER A . n A 1 36 ALA 36 29 29 ALA ALA A . n A 1 37 ARG 37 30 30 ARG ARG A . n A 1 38 ARG 38 31 31 ARG ARG A . n A 1 39 ALA 39 32 32 ALA ALA A . n A 1 40 PHE 40 33 33 PHE PHE A . n A 1 41 ARG 41 34 34 ARG ARG A . n A 1 42 VAL 42 35 35 VAL VAL A . n A 1 43 SER 43 36 36 SER SER A . n A 1 44 PRO 44 37 37 PRO PRO A . n A 1 45 PRO 45 38 38 PRO PRO A . n A 1 46 LEU 46 39 39 LEU LEU A . n A 1 47 THR 47 40 40 THR THR A . n A 1 48 THR 48 41 41 THR THR A . n A 1 49 GLY 49 42 42 GLY GLY A . n A 1 50 PRO 50 43 43 PRO PRO A . n A 1 51 PRO 51 44 44 PRO PRO A . n A 1 52 GLU 52 45 45 GLU GLU A . n A 1 53 PHE 53 46 46 PHE PHE A . n A 1 54 GLU 54 47 47 GLU GLU A . n A 1 55 ARG 55 48 48 ARG ARG A . n A 1 56 VAL 56 49 49 VAL VAL A . n A 1 57 TYR 57 50 50 TYR TYR A . n A 1 58 ARG 58 51 51 ARG ARG A . n A 1 59 ALA 59 52 52 ALA ALA A . n A 1 60 GLN 60 53 53 GLN GLN A . n A 1 61 VAL 61 54 54 VAL VAL A . n A 1 62 ASN 62 55 55 ASN ASN A . n A 1 63 CYS 63 56 56 CYS CYS A . n A 1 64 SER 64 57 57 SER SER A . n A 1 65 GLU 65 58 58 GLU GLU A . n A 1 66 TYR 66 59 59 TYR TYR A . n A 1 67 PHE 67 60 60 PHE PHE A . n A 1 68 PRO 68 61 61 PRO PRO A . n A 1 69 LEU 69 62 62 LEU LEU A . n A 1 70 PHE 70 63 63 PHE PHE A . n A 1 71 LEU 71 64 64 LEU LEU A . n A 1 72 ALA 72 65 65 ALA ALA A . n A 1 73 THR 73 66 66 THR THR A . n A 1 74 LEU 74 67 67 LEU LEU A . n A 1 75 TRP 75 68 68 TRP TRP A . n A 1 76 VAL 76 69 69 VAL VAL A . n A 1 77 ALA 77 70 70 ALA ALA A . n A 1 78 GLY 78 71 71 GLY GLY A . n A 1 79 ILE 79 72 72 ILE ILE A . n A 1 80 PHE 80 73 73 PHE PHE A . n A 1 81 PHE 81 74 74 PHE PHE A . n A 1 82 HIS 82 75 75 HIS HIS A . n A 1 83 GLU 83 76 76 GLU GLU A . n A 1 84 GLY 84 77 77 GLY GLY A . n A 1 85 ALA 85 78 78 ALA ALA A . n A 1 86 ALA 86 79 79 ALA ALA A . n A 1 87 ALA 87 80 80 ALA ALA A . n A 1 88 LEU 88 81 81 LEU LEU A . n A 1 89 CYS 89 82 82 CYS CYS A . n A 1 90 GLY 90 83 83 GLY GLY A . n A 1 91 LEU 91 84 84 LEU LEU A . n A 1 92 VAL 92 85 85 VAL VAL A . n A 1 93 TYR 93 86 86 TYR TYR A . n A 1 94 LEU 94 87 87 LEU LEU A . n A 1 95 PHE 95 88 88 PHE PHE A . n A 1 96 ALA 96 89 89 ALA ALA A . n A 1 97 ARG 97 90 90 ARG ARG A . n A 1 98 LEU 98 91 91 LEU LEU A . n A 1 99 ARG 99 92 92 ARG ARG A . n A 1 100 TYR 100 93 93 TYR TYR A . n A 1 101 PHE 101 94 94 PHE PHE A . n A 1 102 GLN 102 95 95 GLN GLN A . n A 1 103 GLY 103 96 96 GLY GLY A . n A 1 104 TYR 104 97 97 TYR TYR A . n A 1 105 ALA 105 98 98 ALA ALA A . n A 1 106 ARG 106 99 99 ARG ARG A . n A 1 107 SER 107 100 100 SER SER A . n A 1 108 ALA 108 101 101 ALA ALA A . n A 1 109 GLN 109 102 102 GLN GLN A . n A 1 110 LEU 110 103 103 LEU LEU A . n A 1 111 ARG 111 104 104 ARG ARG A . n A 1 112 LEU 112 105 105 LEU LEU A . n A 1 113 ALA 113 106 106 ALA ALA A . n A 1 114 PRO 114 107 107 PRO PRO A . n A 1 115 LEU 115 108 108 LEU LEU A . n A 1 116 TYR 116 109 109 TYR TYR A . n A 1 117 ALA 117 110 110 ALA ALA A . n A 1 118 SER 118 111 111 SER SER A . n A 1 119 ALA 119 112 112 ALA ALA A . n A 1 120 ARG 120 113 113 ARG ARG A . n A 1 121 ALA 121 114 114 ALA ALA A . n A 1 122 LEU 122 115 115 LEU LEU A . n A 1 123 TRP 123 116 116 TRP TRP A . n A 1 124 LEU 124 117 117 LEU LEU A . n A 1 125 LEU 125 118 118 LEU LEU A . n A 1 126 VAL 126 119 119 VAL VAL A . n A 1 127 ALA 127 120 120 ALA ALA A . n A 1 128 LEU 128 121 121 LEU LEU A . n A 1 129 ALA 129 122 122 ALA ALA A . n A 1 130 ALA 130 123 123 ALA ALA A . n A 1 131 LEU 131 124 124 LEU LEU A . n A 1 132 GLY 132 125 125 GLY GLY A . n A 1 133 LEU 133 126 126 LEU LEU A . n A 1 134 LEU 134 127 127 LEU LEU A . n A 1 135 ALA 135 128 128 ALA ALA A . n A 1 136 HIS 136 129 129 HIS HIS A . n A 1 137 PHE 137 130 130 PHE PHE A . n A 1 138 LEU 138 131 131 LEU LEU A . n A 1 139 PRO 139 132 132 PRO PRO A . n A 1 140 ALA 140 133 133 ALA ALA A . n A 1 141 ALA 141 134 134 ALA ALA A . n A 1 142 LEU 142 135 135 LEU LEU A . n A 1 143 ARG 143 136 136 ARG ARG A . n A 1 144 ALA 144 137 137 ALA ALA A . n A 1 145 ALA 145 138 138 ALA ALA A . n A 1 146 LEU 146 139 139 LEU LEU A . n A 1 147 LEU 147 140 140 LEU LEU A . n A 1 148 GLY 148 141 141 GLY GLY A . n A 1 149 ARG 149 142 142 ARG ARG A . n A 1 150 LEU 150 143 143 LEU LEU A . n A 1 151 ARG 151 144 ? ? ? A . n A 1 152 THR 152 145 ? ? ? A . n A 1 153 LEU 153 146 ? ? ? A . n A 1 154 LEU 154 147 ? ? ? A . n A 1 155 PRO 155 148 ? ? ? A . n A 1 156 TRP 156 149 ? ? ? A . n A 1 157 ALA 157 150 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1IH0 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1IH0 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PLM 1 201 909 PLM PLM A . C 3 PAM 1 202 1002 PAM PAM A . D 4 A1IH0 1 203 1 A1IH0 LI1 A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 121 ? CD2 ? A LEU 128 CD2 2 1 Y 1 A ARG 142 ? CG ? A ARG 149 CG 3 1 Y 1 A ARG 142 ? CD ? A ARG 149 CD 4 1 Y 1 A ARG 142 ? NE ? A ARG 149 NE 5 1 Y 1 A ARG 142 ? CZ ? A ARG 149 CZ 6 1 Y 1 A ARG 142 ? NH1 ? A ARG 149 NH1 7 1 Y 1 A ARG 142 ? NH2 ? A ARG 149 NH2 8 1 N 1 A PLM 201 ? C1 ? B PLM 1 C1 9 1 N 1 A PLM 201 ? O1 ? B PLM 1 O1 10 1 N 1 A PLM 201 ? O2 ? B PLM 1 O2 11 1 N 1 A PLM 201 ? C2 ? B PLM 1 C2 12 1 N 1 A PLM 201 ? C3 ? B PLM 1 C3 13 1 N 1 A PLM 201 ? C4 ? B PLM 1 C4 14 1 N 1 A PLM 201 ? C5 ? B PLM 1 C5 15 1 N 1 A PAM 202 ? C1 ? C PAM 1 C1 16 1 N 1 A PAM 202 ? O1 ? C PAM 1 O1 17 1 N 1 A PAM 202 ? O2 ? C PAM 1 O2 18 1 N 1 A PAM 202 ? C2 ? C PAM 1 C2 19 1 N 1 A PAM 202 ? C3 ? C PAM 1 C3 20 1 N 1 A PAM 202 ? C4 ? C PAM 1 C4 21 1 N 1 A PAM 202 ? C5 ? C PAM 1 C5 22 1 N 1 A PAM 202 ? C6 ? C PAM 1 C6 23 1 N 1 A PAM 202 ? C7 ? C PAM 1 C7 24 1 N 1 A PAM 202 ? C8 ? C PAM 1 C8 25 1 N 1 A PAM 202 ? C9 ? C PAM 1 C9 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.5 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9G1T _cell.details ? _cell.formula_units_Z ? _cell.length_a 170.352 _cell.length_a_esd ? _cell.length_b 170.352 _cell.length_b_esd ? _cell.length_c 170.352 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 48 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9G1T _symmetry.cell_setting ? _symmetry.Int_Tables_number 196 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'F 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9G1T _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.90 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 79.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '10 % PEG8000, LITHIUM SULPHATE 0.5M' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 294 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-11-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9G1T _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.0 _reflns.d_resolution_low 28.8 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8328 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 32.61 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.058 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.057 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 3.00 3.08 ? ? ? ? ? ? 611 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.727 ? ? 1 1 0.638 ? ? ? ? 2.662 ? ? ? ? ? ? ? ? ? 3.08 3.16 ? ? ? ? ? ? 599 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2.063 ? ? 2 1 0.68 ? ? ? ? 2.014 ? ? ? ? ? ? ? ? ? 3.16 3.25 ? ? ? ? ? ? 578 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.538 ? ? 3 1 0.828 ? ? ? ? 1.501 ? ? ? ? ? ? ? ? ? 3.25 3.35 ? ? ? ? ? ? 554 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.934 ? ? 4 1 0.906 ? ? ? ? 0.911 ? ? ? ? ? ? ? ? ? 3.35 3.46 ? ? ? ? ? ? 555 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.709 ? ? 5 1 0.936 ? ? ? ? 0.69 ? ? ? ? ? ? ? ? ? 3.46 3.59 ? ? ? ? ? ? 528 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.454 ? ? 6 1 0.965 ? ? ? ? 0.442 ? ? ? ? ? ? ? ? ? 3.59 3.72 ? ? ? ? ? ? 505 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.276 ? ? 7 1 0.991 ? ? ? ? 0.269 ? ? ? ? ? ? ? ? ? 3.72 3.87 ? ? ? ? ? ? 487 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.178 ? ? 8 1 0.996 ? ? ? ? 0.173 ? ? ? ? ? ? ? ? ? 3.87 4.05 ? ? ? ? ? ? 465 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.117 ? ? 9 1 0.998 ? ? ? ? 0.114 ? ? ? ? ? ? ? ? ? 4.05 4.24 ? ? ? ? ? ? 450 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.076 ? ? 10 1 0.999 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? ? 4.24 4.47 ? ? ? ? ? ? 446 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.052 ? ? 11 1 1.0 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? ? 4.47 4.74 ? ? ? ? ? ? 401 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.045 ? ? 12 1 1.0 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? ? 4.74 5.07 ? ? ? ? ? ? 381 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.046 ? ? 13 1 1.0 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? ? 5.07 5.48 ? ? ? ? ? ? 368 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.045 ? ? 14 1 1.0 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? ? 5.48 6.0 ? ? ? ? ? ? 321 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.047 ? ? 15 1 0.999 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? ? 6.00 6.71 ? ? ? ? ? ? 302 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.045 ? ? 16 1 0.999 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? ? 6.71 7.75 ? ? ? ? ? ? 270 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.035 ? ? 17 1 1.0 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? ? 7.75 9.49 ? ? ? ? ? ? 231 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.03 ? ? 18 1 1.0 ? ? ? ? 0.03 ? ? ? ? ? ? ? ? ? 9.49 13.42 ? ? ? ? ? ? 179 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.029 ? ? 19 1 1.0 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? ? 13.42 14 ? ? ? ? ? ? 97 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.03 ? ? 20 1 1.0 ? ? ? ? 0.029 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.B_iso_max ? _refine.B_iso_mean 155.92 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.9426 _refine.correlation_coeff_Fo_to_Fc_free 0.9422 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9G1T _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.00 _refine.ls_d_res_low 19.89 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8264 _refine.ls_number_reflns_R_free 414 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.49 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2115 _refine.ls_R_factor_R_free 0.2428 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2098 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.278 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.268 _refine.pdbx_overall_SU_R_Blow_DPI 0.350 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.371 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9G1T _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.999 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 19.89 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1169 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1121 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 48 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 ? 1214 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 1.09 ? 1641 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 400 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 12 ? t_trig_c_planes 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 183 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1214 ? t_it 20.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.71 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 24.56 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 141 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1436 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.00 _refine_ls_shell.d_res_low 3.35 _refine_ls_shell.number_reflns_all 2295 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 116 _refine_ls_shell.number_reflns_R_work 2179 _refine_ls_shell.percent_reflns_obs 99.49 _refine_ls_shell.percent_reflns_R_free 5.05 _refine_ls_shell.R_factor_all 0.2887 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2881 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.2996 # _struct.entry_id 9G1T _struct.title 'Human LTC4 synthase in complex with compound 5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9G1T _struct_keywords.text 'LTC4S, Inhibitor, LYASE' _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LTC4S_HUMAN _struct_ref.pdbx_db_accession Q16873 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAAL CGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9G1T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 157 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16873 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 150 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9G1T MET A 1 ? UNP Q16873 ? ? 'initiating methionine' -6 1 1 9G1T HIS A 2 ? UNP Q16873 ? ? 'expression tag' -5 2 1 9G1T HIS A 3 ? UNP Q16873 ? ? 'expression tag' -4 3 1 9G1T HIS A 4 ? UNP Q16873 ? ? 'expression tag' -3 4 1 9G1T HIS A 5 ? UNP Q16873 ? ? 'expression tag' -2 5 1 9G1T HIS A 6 ? UNP Q16873 ? ? 'expression tag' -1 6 1 9G1T HIS A 7 ? UNP Q16873 ? ? 'expression tag' 0 7 1 9G1T GLY A 8 ? UNP Q16873 ? ? 'expression tag' 1 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9070 ? 1 MORE -71 ? 1 'SSA (A^2)' 19330 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ;NOTE: THERE IS 1 MOLECULES OF LTC4S-INHIBITOR COMPLEX IN ASYMMETRIC UNIT. BIOLOGICAL UNIT OF TRIMER CAN BE GENERATED BY DISPLAYING SYMMETRY EQUIVALENT MOLECULES. ; # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_636 z+1,x-2,y+1 0.0000000000 0.0000000000 1.0000000000 170.3520000000 1.0000000000 0.0000000000 0.0000000000 -340.7040000000 0.0000000000 1.0000000000 0.0000000000 170.3520000000 3 'crystal symmetry operation' 9_744 y+2,z-1,x-1 0.0000000000 1.0000000000 0.0000000000 340.7040000000 0.0000000000 0.0000000000 1.0000000000 -170.3520000000 1.0000000000 0.0000000000 0.0000000000 -170.3520000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 9 ? GLU A 11 ? LYS A 2 GLU A 4 5 ? 3 HELX_P HELX_P2 AA2 VAL A 12 ? ALA A 39 ? VAL A 5 ALA A 32 1 ? 28 HELX_P HELX_P3 AA3 GLU A 52 ? PHE A 81 ? GLU A 45 PHE A 74 1 ? 30 HELX_P HELX_P4 AA4 HIS A 82 ? ALA A 105 ? HIS A 75 ALA A 98 1 ? 24 HELX_P HELX_P5 AA5 ARG A 111 ? LEU A 146 ? ARG A 104 LEU A 139 1 ? 36 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 44 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 37 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 45 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 38 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 9.63 # _pdbx_entry_details.entry_id 9G1T _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 38 ? ? -89.91 36.08 2 1 PRO A 44 ? ? -65.79 6.18 3 1 ARG A 99 ? ? -105.42 -91.50 4 1 ARG A 142 ? ? -138.33 -43.95 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 355.7880 _pdbx_refine_tls.origin_y 16.3504 _pdbx_refine_tls.origin_z 199.1590 _pdbx_refine_tls.T[1][1] -0.3688 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.4560 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.1091 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] -0.4261 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.2253 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.4443 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 4.9972 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 1.8102 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 2.0207 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 7.9393 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 3.4394 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 7.1118 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.5199 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.7450 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.5987 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 1.1797 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.7068 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.9302 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 1.5251 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -1.2911 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.1869 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -6 ? A MET 1 2 1 Y 1 A HIS -5 ? A HIS 2 3 1 Y 1 A HIS -4 ? A HIS 3 4 1 Y 1 A HIS -3 ? A HIS 4 5 1 Y 1 A HIS -2 ? A HIS 5 6 1 Y 1 A HIS -1 ? A HIS 6 7 1 Y 1 A HIS 0 ? A HIS 7 8 1 Y 1 A ARG 144 ? A ARG 151 9 1 Y 1 A THR 145 ? A THR 152 10 1 Y 1 A LEU 146 ? A LEU 153 11 1 Y 1 A LEU 147 ? A LEU 154 12 1 Y 1 A PRO 148 ? A PRO 155 13 1 Y 1 A TRP 149 ? A TRP 156 14 1 Y 1 A ALA 150 ? A ALA 157 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1IH0 C1 C N N 1 A1IH0 C2 C N N 2 A1IH0 C11 C N N 3 A1IH0 C13 C Y N 4 A1IH0 C14 C N N 5 A1IH0 C16 C N N 6 A1IH0 C17 C N N 7 A1IH0 C18 C Y N 8 A1IH0 C19 C Y N 9 A1IH0 C20 C Y N 10 A1IH0 C21 C Y N 11 A1IH0 C22 C Y N 12 A1IH0 C23 C Y N 13 A1IH0 C24 C Y N 14 A1IH0 C25 C Y N 15 A1IH0 C26 C Y N 16 A1IH0 C27 C Y N 17 A1IH0 C28 C Y N 18 A1IH0 N3 N N N 19 A1IH0 C4 C N N 20 A1IH0 C5 C N N 21 A1IH0 C6 C N N 22 A1IH0 N7 N N N 23 A1IH0 C8 C N N 24 A1IH0 C9 C N N 25 A1IH0 C10 C N N 26 A1IH0 O12 O N N 27 A1IH0 O15 O N N 28 A1IH0 CL29 CL N N 29 A1IH0 F30 F N N 30 A1IH0 H1 H N N 31 A1IH0 H2 H N N 32 A1IH0 H3 H N N 33 A1IH0 H4 H N N 34 A1IH0 H5 H N N 35 A1IH0 H6 H N N 36 A1IH0 H7 H N N 37 A1IH0 H8 H N N 38 A1IH0 H9 H N N 39 A1IH0 H10 H N N 40 A1IH0 H11 H N N 41 A1IH0 H12 H N N 42 A1IH0 H13 H N N 43 A1IH0 H14 H N N 44 A1IH0 H15 H N N 45 A1IH0 H16 H N N 46 A1IH0 H17 H N N 47 A1IH0 H18 H N N 48 A1IH0 H19 H N N 49 A1IH0 H20 H N N 50 A1IH0 H21 H N N 51 A1IH0 H22 H N N 52 A1IH0 H23 H N N 53 A1IH0 H24 H N N 54 ALA N N N N 55 ALA CA C N S 56 ALA C C N N 57 ALA O O N N 58 ALA CB C N N 59 ALA OXT O N N 60 ALA H H N N 61 ALA H2 H N N 62 ALA HA H N N 63 ALA HB1 H N N 64 ALA HB2 H N N 65 ALA HB3 H N N 66 ALA HXT H N N 67 ARG N N N N 68 ARG CA C N S 69 ARG C C N N 70 ARG O O N N 71 ARG CB C N N 72 ARG CG C N N 73 ARG CD C N N 74 ARG NE N N N 75 ARG CZ C N N 76 ARG NH1 N N N 77 ARG NH2 N N N 78 ARG OXT O N N 79 ARG H H N N 80 ARG H2 H N N 81 ARG HA H N N 82 ARG HB2 H N N 83 ARG HB3 H N N 84 ARG HG2 H N N 85 ARG HG3 H N N 86 ARG HD2 H N N 87 ARG HD3 H N N 88 ARG HE H N N 89 ARG HH11 H N N 90 ARG HH12 H N N 91 ARG HH21 H N N 92 ARG HH22 H N N 93 ARG HXT H N N 94 ASN N N N N 95 ASN CA C N S 96 ASN C C N N 97 ASN O O N N 98 ASN CB C N N 99 ASN CG C N N 100 ASN OD1 O N N 101 ASN ND2 N N N 102 ASN OXT O N N 103 ASN H H N N 104 ASN H2 H N N 105 ASN HA H N N 106 ASN HB2 H N N 107 ASN HB3 H N N 108 ASN HD21 H N N 109 ASN HD22 H N N 110 ASN HXT H N N 111 ASP N N N N 112 ASP CA C N S 113 ASP C C N N 114 ASP O O N N 115 ASP CB C N N 116 ASP CG C N N 117 ASP OD1 O N N 118 ASP OD2 O N N 119 ASP OXT O N N 120 ASP H H N N 121 ASP H2 H N N 122 ASP HA H N N 123 ASP HB2 H N N 124 ASP HB3 H N N 125 ASP HD2 H N N 126 ASP HXT H N N 127 CYS N N N N 128 CYS CA C N R 129 CYS C C N N 130 CYS O O N N 131 CYS CB C N N 132 CYS SG S N N 133 CYS OXT O N N 134 CYS H H N N 135 CYS H2 H N N 136 CYS HA H N N 137 CYS HB2 H N N 138 CYS HB3 H N N 139 CYS HG H N N 140 CYS HXT H N N 141 GLN N N N N 142 GLN CA C N S 143 GLN C C N N 144 GLN O O N N 145 GLN CB C N N 146 GLN CG C N N 147 GLN CD C N N 148 GLN OE1 O N N 149 GLN NE2 N N N 150 GLN OXT O N N 151 GLN H H N N 152 GLN H2 H N N 153 GLN HA H N N 154 GLN HB2 H N N 155 GLN HB3 H N N 156 GLN HG2 H N N 157 GLN HG3 H N N 158 GLN HE21 H N N 159 GLN HE22 H N N 160 GLN HXT H N N 161 GLU N N N N 162 GLU CA C N S 163 GLU C C N N 164 GLU O O N N 165 GLU CB C N N 166 GLU CG C N N 167 GLU CD C N N 168 GLU OE1 O N N 169 GLU OE2 O N N 170 GLU OXT O N N 171 GLU H H N N 172 GLU H2 H N N 173 GLU HA H N N 174 GLU HB2 H N N 175 GLU HB3 H N N 176 GLU HG2 H N N 177 GLU HG3 H N N 178 GLU HE2 H N N 179 GLU HXT H N N 180 GLY N N N N 181 GLY CA C N N 182 GLY C C N N 183 GLY O O N N 184 GLY OXT O N N 185 GLY H H N N 186 GLY H2 H N N 187 GLY HA2 H N N 188 GLY HA3 H N N 189 GLY HXT H N N 190 HIS N N N N 191 HIS CA C N S 192 HIS C C N N 193 HIS O O N N 194 HIS CB C N N 195 HIS CG C Y N 196 HIS ND1 N Y N 197 HIS CD2 C Y N 198 HIS CE1 C Y N 199 HIS NE2 N Y N 200 HIS OXT O N N 201 HIS H H N N 202 HIS H2 H N N 203 HIS HA H N N 204 HIS HB2 H N N 205 HIS HB3 H N N 206 HIS HD1 H N N 207 HIS HD2 H N N 208 HIS HE1 H N N 209 HIS HE2 H N N 210 HIS HXT H N N 211 ILE N N N N 212 ILE CA C N S 213 ILE C C N N 214 ILE O O N N 215 ILE CB C N S 216 ILE CG1 C N N 217 ILE CG2 C N N 218 ILE CD1 C N N 219 ILE OXT O N N 220 ILE H H N N 221 ILE H2 H N N 222 ILE HA H N N 223 ILE HB H N N 224 ILE HG12 H N N 225 ILE HG13 H N N 226 ILE HG21 H N N 227 ILE HG22 H N N 228 ILE HG23 H N N 229 ILE HD11 H N N 230 ILE HD12 H N N 231 ILE HD13 H N N 232 ILE HXT H N N 233 LEU N N N N 234 LEU CA C N S 235 LEU C C N N 236 LEU O O N N 237 LEU CB C N N 238 LEU CG C N N 239 LEU CD1 C N N 240 LEU CD2 C N N 241 LEU OXT O N N 242 LEU H H N N 243 LEU H2 H N N 244 LEU HA H N N 245 LEU HB2 H N N 246 LEU HB3 H N N 247 LEU HG H N N 248 LEU HD11 H N N 249 LEU HD12 H N N 250 LEU HD13 H N N 251 LEU HD21 H N N 252 LEU HD22 H N N 253 LEU HD23 H N N 254 LEU HXT H N N 255 LYS N N N N 256 LYS CA C N S 257 LYS C C N N 258 LYS O O N N 259 LYS CB C N N 260 LYS CG C N N 261 LYS CD C N N 262 LYS CE C N N 263 LYS NZ N N N 264 LYS OXT O N N 265 LYS H H N N 266 LYS H2 H N N 267 LYS HA H N N 268 LYS HB2 H N N 269 LYS HB3 H N N 270 LYS HG2 H N N 271 LYS HG3 H N N 272 LYS HD2 H N N 273 LYS HD3 H N N 274 LYS HE2 H N N 275 LYS HE3 H N N 276 LYS HZ1 H N N 277 LYS HZ2 H N N 278 LYS HZ3 H N N 279 LYS HXT H N N 280 MET N N N N 281 MET CA C N S 282 MET C C N N 283 MET O O N N 284 MET CB C N N 285 MET CG C N N 286 MET SD S N N 287 MET CE C N N 288 MET OXT O N N 289 MET H H N N 290 MET H2 H N N 291 MET HA H N N 292 MET HB2 H N N 293 MET HB3 H N N 294 MET HG2 H N N 295 MET HG3 H N N 296 MET HE1 H N N 297 MET HE2 H N N 298 MET HE3 H N N 299 MET HXT H N N 300 PAM C1 C N N 301 PAM O1 O N N 302 PAM O2 O N N 303 PAM C2 C N N 304 PAM C3 C N N 305 PAM C4 C N N 306 PAM C5 C N N 307 PAM C6 C N N 308 PAM C7 C N N 309 PAM C8 C N N 310 PAM C9 C N N 311 PAM C10 C N N 312 PAM C11 C N N 313 PAM C12 C N N 314 PAM C13 C N N 315 PAM C14 C N N 316 PAM C15 C N N 317 PAM C16 C N N 318 PAM HO1 H N N 319 PAM H21 H N N 320 PAM H22 H N N 321 PAM H31 H N N 322 PAM H32 H N N 323 PAM H41 H N N 324 PAM H42 H N N 325 PAM H51 H N N 326 PAM H52 H N N 327 PAM H61 H N N 328 PAM H62 H N N 329 PAM H71 H N N 330 PAM H72 H N N 331 PAM H81 H N N 332 PAM H82 H N N 333 PAM H9 H N N 334 PAM H10 H N N 335 PAM H111 H N N 336 PAM H112 H N N 337 PAM H121 H N N 338 PAM H122 H N N 339 PAM H131 H N N 340 PAM H132 H N N 341 PAM H141 H N N 342 PAM H142 H N N 343 PAM H151 H N N 344 PAM H152 H N N 345 PAM H161 H N N 346 PAM H162 H N N 347 PAM H163 H N N 348 PHE N N N N 349 PHE CA C N S 350 PHE C C N N 351 PHE O O N N 352 PHE CB C N N 353 PHE CG C Y N 354 PHE CD1 C Y N 355 PHE CD2 C Y N 356 PHE CE1 C Y N 357 PHE CE2 C Y N 358 PHE CZ C Y N 359 PHE OXT O N N 360 PHE H H N N 361 PHE H2 H N N 362 PHE HA H N N 363 PHE HB2 H N N 364 PHE HB3 H N N 365 PHE HD1 H N N 366 PHE HD2 H N N 367 PHE HE1 H N N 368 PHE HE2 H N N 369 PHE HZ H N N 370 PHE HXT H N N 371 PLM C1 C N N 372 PLM O1 O N N 373 PLM O2 O N N 374 PLM C2 C N N 375 PLM C3 C N N 376 PLM C4 C N N 377 PLM C5 C N N 378 PLM C6 C N N 379 PLM C7 C N N 380 PLM C8 C N N 381 PLM C9 C N N 382 PLM CA C N N 383 PLM CB C N N 384 PLM CC C N N 385 PLM CD C N N 386 PLM CE C N N 387 PLM CF C N N 388 PLM CG C N N 389 PLM H H N N 390 PLM H21 H N N 391 PLM H22 H N N 392 PLM H31 H N N 393 PLM H32 H N N 394 PLM H41 H N N 395 PLM H42 H N N 396 PLM H51 H N N 397 PLM H52 H N N 398 PLM H61 H N N 399 PLM H62 H N N 400 PLM H71 H N N 401 PLM H72 H N N 402 PLM H81 H N N 403 PLM H82 H N N 404 PLM H91 H N N 405 PLM H92 H N N 406 PLM HA1 H N N 407 PLM HA2 H N N 408 PLM HB1 H N N 409 PLM HB2 H N N 410 PLM HC1 H N N 411 PLM HC2 H N N 412 PLM HD1 H N N 413 PLM HD2 H N N 414 PLM HE1 H N N 415 PLM HE2 H N N 416 PLM HF1 H N N 417 PLM HF2 H N N 418 PLM HG1 H N N 419 PLM HG2 H N N 420 PLM HG3 H N N 421 PRO N N N N 422 PRO CA C N S 423 PRO C C N N 424 PRO O O N N 425 PRO CB C N N 426 PRO CG C N N 427 PRO CD C N N 428 PRO OXT O N N 429 PRO H H N N 430 PRO HA H N N 431 PRO HB2 H N N 432 PRO HB3 H N N 433 PRO HG2 H N N 434 PRO HG3 H N N 435 PRO HD2 H N N 436 PRO HD3 H N N 437 PRO HXT H N N 438 SER N N N N 439 SER CA C N S 440 SER C C N N 441 SER O O N N 442 SER CB C N N 443 SER OG O N N 444 SER OXT O N N 445 SER H H N N 446 SER H2 H N N 447 SER HA H N N 448 SER HB2 H N N 449 SER HB3 H N N 450 SER HG H N N 451 SER HXT H N N 452 THR N N N N 453 THR CA C N S 454 THR C C N N 455 THR O O N N 456 THR CB C N R 457 THR OG1 O N N 458 THR CG2 C N N 459 THR OXT O N N 460 THR H H N N 461 THR H2 H N N 462 THR HA H N N 463 THR HB H N N 464 THR HG1 H N N 465 THR HG21 H N N 466 THR HG22 H N N 467 THR HG23 H N N 468 THR HXT H N N 469 TRP N N N N 470 TRP CA C N S 471 TRP C C N N 472 TRP O O N N 473 TRP CB C N N 474 TRP CG C Y N 475 TRP CD1 C Y N 476 TRP CD2 C Y N 477 TRP NE1 N Y N 478 TRP CE2 C Y N 479 TRP CE3 C Y N 480 TRP CZ2 C Y N 481 TRP CZ3 C Y N 482 TRP CH2 C Y N 483 TRP OXT O N N 484 TRP H H N N 485 TRP H2 H N N 486 TRP HA H N N 487 TRP HB2 H N N 488 TRP HB3 H N N 489 TRP HD1 H N N 490 TRP HE1 H N N 491 TRP HE3 H N N 492 TRP HZ2 H N N 493 TRP HZ3 H N N 494 TRP HH2 H N N 495 TRP HXT H N N 496 TYR N N N N 497 TYR CA C N S 498 TYR C C N N 499 TYR O O N N 500 TYR CB C N N 501 TYR CG C Y N 502 TYR CD1 C Y N 503 TYR CD2 C Y N 504 TYR CE1 C Y N 505 TYR CE2 C Y N 506 TYR CZ C Y N 507 TYR OH O N N 508 TYR OXT O N N 509 TYR H H N N 510 TYR H2 H N N 511 TYR HA H N N 512 TYR HB2 H N N 513 TYR HB3 H N N 514 TYR HD1 H N N 515 TYR HD2 H N N 516 TYR HE1 H N N 517 TYR HE2 H N N 518 TYR HH H N N 519 TYR HXT H N N 520 VAL N N N N 521 VAL CA C N S 522 VAL C C N N 523 VAL O O N N 524 VAL CB C N N 525 VAL CG1 C N N 526 VAL CG2 C N N 527 VAL OXT O N N 528 VAL H H N N 529 VAL H2 H N N 530 VAL HA H N N 531 VAL HB H N N 532 VAL HG11 H N N 533 VAL HG12 H N N 534 VAL HG13 H N N 535 VAL HG21 H N N 536 VAL HG22 H N N 537 VAL HG23 H N N 538 VAL HXT H N N 539 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1IH0 C20 C21 doub Y N 1 A1IH0 C20 C19 sing Y N 2 A1IH0 C21 C22 sing Y N 3 A1IH0 C19 C18 doub Y N 4 A1IH0 C22 C23 doub Y N 5 A1IH0 C18 C23 sing Y N 6 A1IH0 C18 C17 sing N N 7 A1IH0 C4 C5 sing N N 8 A1IH0 C4 N3 sing N N 9 A1IH0 C16 C17 doub N E 10 A1IH0 C16 C14 sing N N 11 A1IH0 C5 C6 sing N N 12 A1IH0 F30 C27 sing N N 13 A1IH0 C11 C10 sing N N 14 A1IH0 C11 C6 sing N N 15 A1IH0 C28 C27 doub Y N 16 A1IH0 C28 C13 sing Y N 17 A1IH0 N3 C14 sing N N 18 A1IH0 N3 C2 sing N N 19 A1IH0 C10 C9 sing N N 20 A1IH0 C6 N7 sing N N 21 A1IH0 C6 C1 sing N N 22 A1IH0 C27 C26 sing Y N 23 A1IH0 C14 O15 doub N N 24 A1IH0 C9 C8 sing N N 25 A1IH0 N7 C8 sing N N 26 A1IH0 N7 C13 sing N N 27 A1IH0 C8 O12 doub N N 28 A1IH0 C13 C24 doub Y N 29 A1IH0 C2 C1 sing N N 30 A1IH0 C26 CL29 sing N N 31 A1IH0 C26 C25 doub Y N 32 A1IH0 C24 C25 sing Y N 33 A1IH0 C1 H1 sing N N 34 A1IH0 C1 H2 sing N N 35 A1IH0 C2 H3 sing N N 36 A1IH0 C2 H4 sing N N 37 A1IH0 C11 H5 sing N N 38 A1IH0 C11 H6 sing N N 39 A1IH0 C16 H7 sing N N 40 A1IH0 C17 H8 sing N N 41 A1IH0 C19 H9 sing N N 42 A1IH0 C20 H10 sing N N 43 A1IH0 C21 H11 sing N N 44 A1IH0 C22 H12 sing N N 45 A1IH0 C23 H13 sing N N 46 A1IH0 C24 H14 sing N N 47 A1IH0 C25 H15 sing N N 48 A1IH0 C28 H16 sing N N 49 A1IH0 C4 H17 sing N N 50 A1IH0 C4 H18 sing N N 51 A1IH0 C5 H19 sing N N 52 A1IH0 C5 H20 sing N N 53 A1IH0 C9 H21 sing N N 54 A1IH0 C9 H22 sing N N 55 A1IH0 C10 H23 sing N N 56 A1IH0 C10 H24 sing N N 57 ALA N CA sing N N 58 ALA N H sing N N 59 ALA N H2 sing N N 60 ALA CA C sing N N 61 ALA CA CB sing N N 62 ALA CA HA sing N N 63 ALA C O doub N N 64 ALA C OXT sing N N 65 ALA CB HB1 sing N N 66 ALA CB HB2 sing N N 67 ALA CB HB3 sing N N 68 ALA OXT HXT sing N N 69 ARG N CA sing N N 70 ARG N H sing N N 71 ARG N H2 sing N N 72 ARG CA C sing N N 73 ARG CA CB sing N N 74 ARG CA HA sing N N 75 ARG C O doub N N 76 ARG C OXT sing N N 77 ARG CB CG sing N N 78 ARG CB HB2 sing N N 79 ARG CB HB3 sing N N 80 ARG CG CD sing N N 81 ARG CG HG2 sing N N 82 ARG CG HG3 sing N N 83 ARG CD NE sing N N 84 ARG CD HD2 sing N N 85 ARG CD HD3 sing N N 86 ARG NE CZ sing N N 87 ARG NE HE sing N N 88 ARG CZ NH1 sing N N 89 ARG CZ NH2 doub N N 90 ARG NH1 HH11 sing N N 91 ARG NH1 HH12 sing N N 92 ARG NH2 HH21 sing N N 93 ARG NH2 HH22 sing N N 94 ARG OXT HXT sing N N 95 ASN N CA sing N N 96 ASN N H sing N N 97 ASN N H2 sing N N 98 ASN CA C sing N N 99 ASN CA CB sing N N 100 ASN CA HA sing N N 101 ASN C O doub N N 102 ASN C OXT sing N N 103 ASN CB CG sing N N 104 ASN CB HB2 sing N N 105 ASN CB HB3 sing N N 106 ASN CG OD1 doub N N 107 ASN CG ND2 sing N N 108 ASN ND2 HD21 sing N N 109 ASN ND2 HD22 sing N N 110 ASN OXT HXT sing N N 111 ASP N CA sing N N 112 ASP N H sing N N 113 ASP N H2 sing N N 114 ASP CA C sing N N 115 ASP CA CB sing N N 116 ASP CA HA sing N N 117 ASP C O doub N N 118 ASP C OXT sing N N 119 ASP CB CG sing N N 120 ASP CB HB2 sing N N 121 ASP CB HB3 sing N N 122 ASP CG OD1 doub N N 123 ASP CG OD2 sing N N 124 ASP OD2 HD2 sing N N 125 ASP OXT HXT sing N N 126 CYS N CA sing N N 127 CYS N H sing N N 128 CYS N H2 sing N N 129 CYS CA C sing N N 130 CYS CA CB sing N N 131 CYS CA HA sing N N 132 CYS C O doub N N 133 CYS C OXT sing N N 134 CYS CB SG sing N N 135 CYS CB HB2 sing N N 136 CYS CB HB3 sing N N 137 CYS SG HG sing N N 138 CYS OXT HXT sing N N 139 GLN N CA sing N N 140 GLN N H sing N N 141 GLN N H2 sing N N 142 GLN CA C sing N N 143 GLN CA CB sing N N 144 GLN CA HA sing N N 145 GLN C O doub N N 146 GLN C OXT sing N N 147 GLN CB CG sing N N 148 GLN CB HB2 sing N N 149 GLN CB HB3 sing N N 150 GLN CG CD sing N N 151 GLN CG HG2 sing N N 152 GLN CG HG3 sing N N 153 GLN CD OE1 doub N N 154 GLN CD NE2 sing N N 155 GLN NE2 HE21 sing N N 156 GLN NE2 HE22 sing N N 157 GLN OXT HXT sing N N 158 GLU N CA sing N N 159 GLU N H sing N N 160 GLU N H2 sing N N 161 GLU CA C sing N N 162 GLU CA CB sing N N 163 GLU CA HA sing N N 164 GLU C O doub N N 165 GLU C OXT sing N N 166 GLU CB CG sing N N 167 GLU CB HB2 sing N N 168 GLU CB HB3 sing N N 169 GLU CG CD sing N N 170 GLU CG HG2 sing N N 171 GLU CG HG3 sing N N 172 GLU CD OE1 doub N N 173 GLU CD OE2 sing N N 174 GLU OE2 HE2 sing N N 175 GLU OXT HXT sing N N 176 GLY N CA sing N N 177 GLY N H sing N N 178 GLY N H2 sing N N 179 GLY CA C sing N N 180 GLY CA HA2 sing N N 181 GLY CA HA3 sing N N 182 GLY C O doub N N 183 GLY C OXT sing N N 184 GLY OXT HXT sing N N 185 HIS N CA sing N N 186 HIS N H sing N N 187 HIS N H2 sing N N 188 HIS CA C sing N N 189 HIS CA CB sing N N 190 HIS CA HA sing N N 191 HIS C O doub N N 192 HIS C OXT sing N N 193 HIS CB CG sing N N 194 HIS CB HB2 sing N N 195 HIS CB HB3 sing N N 196 HIS CG ND1 sing Y N 197 HIS CG CD2 doub Y N 198 HIS ND1 CE1 doub Y N 199 HIS ND1 HD1 sing N N 200 HIS CD2 NE2 sing Y N 201 HIS CD2 HD2 sing N N 202 HIS CE1 NE2 sing Y N 203 HIS CE1 HE1 sing N N 204 HIS NE2 HE2 sing N N 205 HIS OXT HXT sing N N 206 ILE N CA sing N N 207 ILE N H sing N N 208 ILE N H2 sing N N 209 ILE CA C sing N N 210 ILE CA CB sing N N 211 ILE CA HA sing N N 212 ILE C O doub N N 213 ILE C OXT sing N N 214 ILE CB CG1 sing N N 215 ILE CB CG2 sing N N 216 ILE CB HB sing N N 217 ILE CG1 CD1 sing N N 218 ILE CG1 HG12 sing N N 219 ILE CG1 HG13 sing N N 220 ILE CG2 HG21 sing N N 221 ILE CG2 HG22 sing N N 222 ILE CG2 HG23 sing N N 223 ILE CD1 HD11 sing N N 224 ILE CD1 HD12 sing N N 225 ILE CD1 HD13 sing N N 226 ILE OXT HXT sing N N 227 LEU N CA sing N N 228 LEU N H sing N N 229 LEU N H2 sing N N 230 LEU CA C sing N N 231 LEU CA CB sing N N 232 LEU CA HA sing N N 233 LEU C O doub N N 234 LEU C OXT sing N N 235 LEU CB CG sing N N 236 LEU CB HB2 sing N N 237 LEU CB HB3 sing N N 238 LEU CG CD1 sing N N 239 LEU CG CD2 sing N N 240 LEU CG HG sing N N 241 LEU CD1 HD11 sing N N 242 LEU CD1 HD12 sing N N 243 LEU CD1 HD13 sing N N 244 LEU CD2 HD21 sing N N 245 LEU CD2 HD22 sing N N 246 LEU CD2 HD23 sing N N 247 LEU OXT HXT sing N N 248 LYS N CA sing N N 249 LYS N H sing N N 250 LYS N H2 sing N N 251 LYS CA C sing N N 252 LYS CA CB sing N N 253 LYS CA HA sing N N 254 LYS C O doub N N 255 LYS C OXT sing N N 256 LYS CB CG sing N N 257 LYS CB HB2 sing N N 258 LYS CB HB3 sing N N 259 LYS CG CD sing N N 260 LYS CG HG2 sing N N 261 LYS CG HG3 sing N N 262 LYS CD CE sing N N 263 LYS CD HD2 sing N N 264 LYS CD HD3 sing N N 265 LYS CE NZ sing N N 266 LYS CE HE2 sing N N 267 LYS CE HE3 sing N N 268 LYS NZ HZ1 sing N N 269 LYS NZ HZ2 sing N N 270 LYS NZ HZ3 sing N N 271 LYS OXT HXT sing N N 272 MET N CA sing N N 273 MET N H sing N N 274 MET N H2 sing N N 275 MET CA C sing N N 276 MET CA CB sing N N 277 MET CA HA sing N N 278 MET C O doub N N 279 MET C OXT sing N N 280 MET CB CG sing N N 281 MET CB HB2 sing N N 282 MET CB HB3 sing N N 283 MET CG SD sing N N 284 MET CG HG2 sing N N 285 MET CG HG3 sing N N 286 MET SD CE sing N N 287 MET CE HE1 sing N N 288 MET CE HE2 sing N N 289 MET CE HE3 sing N N 290 MET OXT HXT sing N N 291 PAM C1 O1 sing N N 292 PAM C1 O2 doub N N 293 PAM C1 C2 sing N N 294 PAM O1 HO1 sing N N 295 PAM C2 C3 sing N N 296 PAM C2 H21 sing N N 297 PAM C2 H22 sing N N 298 PAM C3 C4 sing N N 299 PAM C3 H31 sing N N 300 PAM C3 H32 sing N N 301 PAM C4 C5 sing N N 302 PAM C4 H41 sing N N 303 PAM C4 H42 sing N N 304 PAM C5 C6 sing N N 305 PAM C5 H51 sing N N 306 PAM C5 H52 sing N N 307 PAM C6 C7 sing N N 308 PAM C6 H61 sing N N 309 PAM C6 H62 sing N N 310 PAM C7 C8 sing N N 311 PAM C7 H71 sing N N 312 PAM C7 H72 sing N N 313 PAM C8 C9 sing N N 314 PAM C8 H81 sing N N 315 PAM C8 H82 sing N N 316 PAM C9 C10 doub N Z 317 PAM C9 H9 sing N N 318 PAM C10 C11 sing N N 319 PAM C10 H10 sing N N 320 PAM C11 C12 sing N N 321 PAM C11 H111 sing N N 322 PAM C11 H112 sing N N 323 PAM C12 C13 sing N N 324 PAM C12 H121 sing N N 325 PAM C12 H122 sing N N 326 PAM C13 C14 sing N N 327 PAM C13 H131 sing N N 328 PAM C13 H132 sing N N 329 PAM C14 C15 sing N N 330 PAM C14 H141 sing N N 331 PAM C14 H142 sing N N 332 PAM C15 C16 sing N N 333 PAM C15 H151 sing N N 334 PAM C15 H152 sing N N 335 PAM C16 H161 sing N N 336 PAM C16 H162 sing N N 337 PAM C16 H163 sing N N 338 PHE N CA sing N N 339 PHE N H sing N N 340 PHE N H2 sing N N 341 PHE CA C sing N N 342 PHE CA CB sing N N 343 PHE CA HA sing N N 344 PHE C O doub N N 345 PHE C OXT sing N N 346 PHE CB CG sing N N 347 PHE CB HB2 sing N N 348 PHE CB HB3 sing N N 349 PHE CG CD1 doub Y N 350 PHE CG CD2 sing Y N 351 PHE CD1 CE1 sing Y N 352 PHE CD1 HD1 sing N N 353 PHE CD2 CE2 doub Y N 354 PHE CD2 HD2 sing N N 355 PHE CE1 CZ doub Y N 356 PHE CE1 HE1 sing N N 357 PHE CE2 CZ sing Y N 358 PHE CE2 HE2 sing N N 359 PHE CZ HZ sing N N 360 PHE OXT HXT sing N N 361 PLM C1 O1 sing N N 362 PLM C1 O2 doub N N 363 PLM C1 C2 sing N N 364 PLM O1 H sing N N 365 PLM C2 C3 sing N N 366 PLM C2 H21 sing N N 367 PLM C2 H22 sing N N 368 PLM C3 C4 sing N N 369 PLM C3 H31 sing N N 370 PLM C3 H32 sing N N 371 PLM C4 C5 sing N N 372 PLM C4 H41 sing N N 373 PLM C4 H42 sing N N 374 PLM C5 C6 sing N N 375 PLM C5 H51 sing N N 376 PLM C5 H52 sing N N 377 PLM C6 C7 sing N N 378 PLM C6 H61 sing N N 379 PLM C6 H62 sing N N 380 PLM C7 C8 sing N N 381 PLM C7 H71 sing N N 382 PLM C7 H72 sing N N 383 PLM C8 C9 sing N N 384 PLM C8 H81 sing N N 385 PLM C8 H82 sing N N 386 PLM C9 CA sing N N 387 PLM C9 H91 sing N N 388 PLM C9 H92 sing N N 389 PLM CA CB sing N N 390 PLM CA HA1 sing N N 391 PLM CA HA2 sing N N 392 PLM CB CC sing N N 393 PLM CB HB1 sing N N 394 PLM CB HB2 sing N N 395 PLM CC CD sing N N 396 PLM CC HC1 sing N N 397 PLM CC HC2 sing N N 398 PLM CD CE sing N N 399 PLM CD HD1 sing N N 400 PLM CD HD2 sing N N 401 PLM CE CF sing N N 402 PLM CE HE1 sing N N 403 PLM CE HE2 sing N N 404 PLM CF CG sing N N 405 PLM CF HF1 sing N N 406 PLM CF HF2 sing N N 407 PLM CG HG1 sing N N 408 PLM CG HG2 sing N N 409 PLM CG HG3 sing N N 410 PRO N CA sing N N 411 PRO N CD sing N N 412 PRO N H sing N N 413 PRO CA C sing N N 414 PRO CA CB sing N N 415 PRO CA HA sing N N 416 PRO C O doub N N 417 PRO C OXT sing N N 418 PRO CB CG sing N N 419 PRO CB HB2 sing N N 420 PRO CB HB3 sing N N 421 PRO CG CD sing N N 422 PRO CG HG2 sing N N 423 PRO CG HG3 sing N N 424 PRO CD HD2 sing N N 425 PRO CD HD3 sing N N 426 PRO OXT HXT sing N N 427 SER N CA sing N N 428 SER N H sing N N 429 SER N H2 sing N N 430 SER CA C sing N N 431 SER CA CB sing N N 432 SER CA HA sing N N 433 SER C O doub N N 434 SER C OXT sing N N 435 SER CB OG sing N N 436 SER CB HB2 sing N N 437 SER CB HB3 sing N N 438 SER OG HG sing N N 439 SER OXT HXT sing N N 440 THR N CA sing N N 441 THR N H sing N N 442 THR N H2 sing N N 443 THR CA C sing N N 444 THR CA CB sing N N 445 THR CA HA sing N N 446 THR C O doub N N 447 THR C OXT sing N N 448 THR CB OG1 sing N N 449 THR CB CG2 sing N N 450 THR CB HB sing N N 451 THR OG1 HG1 sing N N 452 THR CG2 HG21 sing N N 453 THR CG2 HG22 sing N N 454 THR CG2 HG23 sing N N 455 THR OXT HXT sing N N 456 TRP N CA sing N N 457 TRP N H sing N N 458 TRP N H2 sing N N 459 TRP CA C sing N N 460 TRP CA CB sing N N 461 TRP CA HA sing N N 462 TRP C O doub N N 463 TRP C OXT sing N N 464 TRP CB CG sing N N 465 TRP CB HB2 sing N N 466 TRP CB HB3 sing N N 467 TRP CG CD1 doub Y N 468 TRP CG CD2 sing Y N 469 TRP CD1 NE1 sing Y N 470 TRP CD1 HD1 sing N N 471 TRP CD2 CE2 doub Y N 472 TRP CD2 CE3 sing Y N 473 TRP NE1 CE2 sing Y N 474 TRP NE1 HE1 sing N N 475 TRP CE2 CZ2 sing Y N 476 TRP CE3 CZ3 doub Y N 477 TRP CE3 HE3 sing N N 478 TRP CZ2 CH2 doub Y N 479 TRP CZ2 HZ2 sing N N 480 TRP CZ3 CH2 sing Y N 481 TRP CZ3 HZ3 sing N N 482 TRP CH2 HH2 sing N N 483 TRP OXT HXT sing N N 484 TYR N CA sing N N 485 TYR N H sing N N 486 TYR N H2 sing N N 487 TYR CA C sing N N 488 TYR CA CB sing N N 489 TYR CA HA sing N N 490 TYR C O doub N N 491 TYR C OXT sing N N 492 TYR CB CG sing N N 493 TYR CB HB2 sing N N 494 TYR CB HB3 sing N N 495 TYR CG CD1 doub Y N 496 TYR CG CD2 sing Y N 497 TYR CD1 CE1 sing Y N 498 TYR CD1 HD1 sing N N 499 TYR CD2 CE2 doub Y N 500 TYR CD2 HD2 sing N N 501 TYR CE1 CZ doub Y N 502 TYR CE1 HE1 sing N N 503 TYR CE2 CZ sing Y N 504 TYR CE2 HE2 sing N N 505 TYR CZ OH sing N N 506 TYR OH HH sing N N 507 TYR OXT HXT sing N N 508 VAL N CA sing N N 509 VAL N H sing N N 510 VAL N H2 sing N N 511 VAL CA C sing N N 512 VAL CA CB sing N N 513 VAL CA HA sing N N 514 VAL C O doub N N 515 VAL C OXT sing N N 516 VAL CB CG1 sing N N 517 VAL CB CG2 sing N N 518 VAL CB HB sing N N 519 VAL CG1 HG11 sing N N 520 VAL CG1 HG12 sing N N 521 VAL CG1 HG13 sing N N 522 VAL CG2 HG21 sing N N 523 VAL CG2 HG22 sing N N 524 VAL CG2 HG23 sing N N 525 VAL OXT HXT sing N N 526 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country Switzerland _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2UUH _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9G1T _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.005870 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005870 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005870 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL F N O S # loop_ # loop_ #