data_9GLL # _entry.id 9GLL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9GLL pdb_00009gll 10.2210/pdb9gll/pdb WWPDB D_1292141256 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-05-07 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9GLL _pdbx_database_status.recvd_initial_deposition_date 2024-08-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'UFC1 Wild type' 2Z6O unspecified PDB 'UFC1 Y110A & F121A' 7NVJ unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email reuvenw@ekmd.huji.ac.il _pdbx_contact_author.name_first Reuven _pdbx_contact_author.name_last Wiener _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4219-550X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kumar, M.' 1 0000-0002-7083-5690 'Banerjee, S.' 2 0009-0002-9409-6797 'Wiener, R.' 3 0000-0002-4219-550X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 3912 _citation.page_last 3912 _citation.title 'UFC1 reveals the multifactorial and plastic nature of oxyanion holes in E2 conjugating enzymes.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-025-58826-y _citation.pdbx_database_id_PubMed 40280917 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kumar, M.' 1 ? primary 'Banerjee, S.' 2 ? primary 'Cohen-Kfir, E.' 3 ? primary 'Mitelberg, M.B.' 4 ? primary 'Tiwari, S.' 5 ? primary 'Isupov, M.N.' 6 0000-0001-6842-4289 primary 'Dessau, M.' 7 0000-0002-1954-3625 primary 'Wiener, R.' 8 0000-0002-4219-550X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ubiquitin-fold modifier-conjugating enzyme 1' 19652.598 1 ? T106L ? 'Threonine at 106th position is mutated to Leucine' 2 water nat water 18.015 152 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ufm1-conjugating enzyme 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKY EFDIEFDIPITYPTTAPEIAVPELDGKLAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGV IHHKEKCNQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKY EFDIEFDIPITYPTTAPEIAVPELDGKLAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGV IHHKEKCNQ ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 ALA n 1 5 ASP n 1 6 GLU n 1 7 ALA n 1 8 THR n 1 9 ARG n 1 10 ARG n 1 11 VAL n 1 12 VAL n 1 13 SER n 1 14 GLU n 1 15 ILE n 1 16 PRO n 1 17 VAL n 1 18 LEU n 1 19 LYS n 1 20 THR n 1 21 ASN n 1 22 ALA n 1 23 GLY n 1 24 PRO n 1 25 ARG n 1 26 ASP n 1 27 ARG n 1 28 GLU n 1 29 LEU n 1 30 TRP n 1 31 VAL n 1 32 GLN n 1 33 ARG n 1 34 LEU n 1 35 LYS n 1 36 GLU n 1 37 GLU n 1 38 TYR n 1 39 GLN n 1 40 SER n 1 41 LEU n 1 42 ILE n 1 43 ARG n 1 44 TYR n 1 45 VAL n 1 46 GLU n 1 47 ASN n 1 48 ASN n 1 49 LYS n 1 50 ASN n 1 51 ALA n 1 52 ASP n 1 53 ASN n 1 54 ASP n 1 55 TRP n 1 56 PHE n 1 57 ARG n 1 58 LEU n 1 59 GLU n 1 60 SER n 1 61 ASN n 1 62 LYS n 1 63 GLU n 1 64 GLY n 1 65 THR n 1 66 ARG n 1 67 TRP n 1 68 PHE n 1 69 GLY n 1 70 LYS n 1 71 CYS n 1 72 TRP n 1 73 TYR n 1 74 ILE n 1 75 HIS n 1 76 ASP n 1 77 LEU n 1 78 LEU n 1 79 LYS n 1 80 TYR n 1 81 GLU n 1 82 PHE n 1 83 ASP n 1 84 ILE n 1 85 GLU n 1 86 PHE n 1 87 ASP n 1 88 ILE n 1 89 PRO n 1 90 ILE n 1 91 THR n 1 92 TYR n 1 93 PRO n 1 94 THR n 1 95 THR n 1 96 ALA n 1 97 PRO n 1 98 GLU n 1 99 ILE n 1 100 ALA n 1 101 VAL n 1 102 PRO n 1 103 GLU n 1 104 LEU n 1 105 ASP n 1 106 GLY n 1 107 LYS n 1 108 LEU n 1 109 ALA n 1 110 LYS n 1 111 MET n 1 112 TYR n 1 113 ARG n 1 114 GLY n 1 115 GLY n 1 116 LYS n 1 117 ILE n 1 118 CYS n 1 119 LEU n 1 120 THR n 1 121 ASP n 1 122 HIS n 1 123 PHE n 1 124 LYS n 1 125 PRO n 1 126 LEU n 1 127 TRP n 1 128 ALA n 1 129 ARG n 1 130 ASN n 1 131 VAL n 1 132 PRO n 1 133 LYS n 1 134 PHE n 1 135 GLY n 1 136 LEU n 1 137 ALA n 1 138 HIS n 1 139 LEU n 1 140 MET n 1 141 ALA n 1 142 LEU n 1 143 GLY n 1 144 LEU n 1 145 GLY n 1 146 PRO n 1 147 TRP n 1 148 LEU n 1 149 ALA n 1 150 VAL n 1 151 GLU n 1 152 ILE n 1 153 PRO n 1 154 ASP n 1 155 LEU n 1 156 ILE n 1 157 GLN n 1 158 LYS n 1 159 GLY n 1 160 VAL n 1 161 ILE n 1 162 HIS n 1 163 HIS n 1 164 LYS n 1 165 GLU n 1 166 LYS n 1 167 CYS n 1 168 ASN n 1 169 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 169 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'UFC1, CGI-126, HSPC155' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? AAA . n A 1 2 SER 2 0 0 SER SER AAA . n A 1 3 MET 3 1 1 MET MET AAA . n A 1 4 ALA 4 2 2 ALA ALA AAA . n A 1 5 ASP 5 3 3 ASP ASP AAA . n A 1 6 GLU 6 4 4 GLU GLU AAA . n A 1 7 ALA 7 5 5 ALA ALA AAA . n A 1 8 THR 8 6 6 THR THR AAA . n A 1 9 ARG 9 7 7 ARG ARG AAA . n A 1 10 ARG 10 8 8 ARG ARG AAA . n A 1 11 VAL 11 9 9 VAL VAL AAA . n A 1 12 VAL 12 10 10 VAL VAL AAA . n A 1 13 SER 13 11 11 SER SER AAA . n A 1 14 GLU 14 12 12 GLU GLU AAA . n A 1 15 ILE 15 13 13 ILE ILE AAA . n A 1 16 PRO 16 14 14 PRO PRO AAA . n A 1 17 VAL 17 15 15 VAL VAL AAA . n A 1 18 LEU 18 16 16 LEU LEU AAA . n A 1 19 LYS 19 17 17 LYS LYS AAA . n A 1 20 THR 20 18 18 THR THR AAA . n A 1 21 ASN 21 19 19 ASN ASN AAA . n A 1 22 ALA 22 20 20 ALA ALA AAA . n A 1 23 GLY 23 21 21 GLY GLY AAA . n A 1 24 PRO 24 22 22 PRO PRO AAA . n A 1 25 ARG 25 23 23 ARG ARG AAA . n A 1 26 ASP 26 24 24 ASP ASP AAA . n A 1 27 ARG 27 25 25 ARG ARG AAA . n A 1 28 GLU 28 26 26 GLU GLU AAA . n A 1 29 LEU 29 27 27 LEU LEU AAA . n A 1 30 TRP 30 28 28 TRP TRP AAA . n A 1 31 VAL 31 29 29 VAL VAL AAA . n A 1 32 GLN 32 30 30 GLN GLN AAA . n A 1 33 ARG 33 31 31 ARG ARG AAA . n A 1 34 LEU 34 32 32 LEU LEU AAA . n A 1 35 LYS 35 33 33 LYS LYS AAA . n A 1 36 GLU 36 34 34 GLU GLU AAA . n A 1 37 GLU 37 35 35 GLU GLU AAA . n A 1 38 TYR 38 36 36 TYR TYR AAA . n A 1 39 GLN 39 37 37 GLN GLN AAA . n A 1 40 SER 40 38 38 SER SER AAA . n A 1 41 LEU 41 39 39 LEU LEU AAA . n A 1 42 ILE 42 40 40 ILE ILE AAA . n A 1 43 ARG 43 41 41 ARG ARG AAA . n A 1 44 TYR 44 42 42 TYR TYR AAA . n A 1 45 VAL 45 43 43 VAL VAL AAA . n A 1 46 GLU 46 44 44 GLU GLU AAA . n A 1 47 ASN 47 45 45 ASN ASN AAA . n A 1 48 ASN 48 46 46 ASN ASN AAA . n A 1 49 LYS 49 47 47 LYS LYS AAA . n A 1 50 ASN 50 48 48 ASN ASN AAA . n A 1 51 ALA 51 49 49 ALA ALA AAA . n A 1 52 ASP 52 50 50 ASP ASP AAA . n A 1 53 ASN 53 51 51 ASN ASN AAA . n A 1 54 ASP 54 52 52 ASP ASP AAA . n A 1 55 TRP 55 53 53 TRP TRP AAA . n A 1 56 PHE 56 54 54 PHE PHE AAA . n A 1 57 ARG 57 55 55 ARG ARG AAA . n A 1 58 LEU 58 56 56 LEU LEU AAA . n A 1 59 GLU 59 57 57 GLU GLU AAA . n A 1 60 SER 60 58 58 SER SER AAA . n A 1 61 ASN 61 59 59 ASN ASN AAA . n A 1 62 LYS 62 60 60 LYS LYS AAA . n A 1 63 GLU 63 61 61 GLU GLU AAA . n A 1 64 GLY 64 62 62 GLY GLY AAA . n A 1 65 THR 65 63 63 THR THR AAA . n A 1 66 ARG 66 64 64 ARG ARG AAA . n A 1 67 TRP 67 65 65 TRP TRP AAA . n A 1 68 PHE 68 66 66 PHE PHE AAA . n A 1 69 GLY 69 67 67 GLY GLY AAA . n A 1 70 LYS 70 68 68 LYS LYS AAA . n A 1 71 CYS 71 69 69 CYS CYS AAA . n A 1 72 TRP 72 70 70 TRP TRP AAA . n A 1 73 TYR 73 71 71 TYR TYR AAA . n A 1 74 ILE 74 72 72 ILE ILE AAA . n A 1 75 HIS 75 73 73 HIS HIS AAA . n A 1 76 ASP 76 74 74 ASP ASP AAA . n A 1 77 LEU 77 75 75 LEU LEU AAA . n A 1 78 LEU 78 76 76 LEU LEU AAA . n A 1 79 LYS 79 77 77 LYS LYS AAA . n A 1 80 TYR 80 78 78 TYR TYR AAA . n A 1 81 GLU 81 79 79 GLU GLU AAA . n A 1 82 PHE 82 80 80 PHE PHE AAA . n A 1 83 ASP 83 81 81 ASP ASP AAA . n A 1 84 ILE 84 82 82 ILE ILE AAA . n A 1 85 GLU 85 83 83 GLU GLU AAA . n A 1 86 PHE 86 84 84 PHE PHE AAA . n A 1 87 ASP 87 85 85 ASP ASP AAA . n A 1 88 ILE 88 86 86 ILE ILE AAA . n A 1 89 PRO 89 87 87 PRO PRO AAA . n A 1 90 ILE 90 88 88 ILE ILE AAA . n A 1 91 THR 91 89 89 THR THR AAA . n A 1 92 TYR 92 90 90 TYR TYR AAA . n A 1 93 PRO 93 91 91 PRO PRO AAA . n A 1 94 THR 94 92 92 THR THR AAA . n A 1 95 THR 95 93 93 THR THR AAA . n A 1 96 ALA 96 94 94 ALA ALA AAA . n A 1 97 PRO 97 95 95 PRO PRO AAA . n A 1 98 GLU 98 96 96 GLU GLU AAA . n A 1 99 ILE 99 97 97 ILE ILE AAA . n A 1 100 ALA 100 98 98 ALA ALA AAA . n A 1 101 VAL 101 99 99 VAL VAL AAA . n A 1 102 PRO 102 100 100 PRO PRO AAA . n A 1 103 GLU 103 101 101 GLU GLU AAA . n A 1 104 LEU 104 102 102 LEU LEU AAA . n A 1 105 ASP 105 103 103 ASP ASP AAA . n A 1 106 GLY 106 104 104 GLY GLY AAA . n A 1 107 LYS 107 105 105 LYS LYS AAA . n A 1 108 LEU 108 106 106 LEU LEU AAA . n A 1 109 ALA 109 107 107 ALA ALA AAA . n A 1 110 LYS 110 108 108 LYS LYS AAA . n A 1 111 MET 111 109 109 MET MET AAA . n A 1 112 TYR 112 110 110 TYR TYR AAA . n A 1 113 ARG 113 111 111 ARG ARG AAA . n A 1 114 GLY 114 112 112 GLY GLY AAA . n A 1 115 GLY 115 113 113 GLY GLY AAA . n A 1 116 LYS 116 114 114 LYS LYS AAA . n A 1 117 ILE 117 115 115 ILE ILE AAA . n A 1 118 CYS 118 116 116 CYS CYS AAA . n A 1 119 LEU 119 117 117 LEU LEU AAA . n A 1 120 THR 120 118 118 THR THR AAA . n A 1 121 ASP 121 119 119 ASP ASP AAA . n A 1 122 HIS 122 120 120 HIS HIS AAA . n A 1 123 PHE 123 121 121 PHE PHE AAA . n A 1 124 LYS 124 122 122 LYS LYS AAA . n A 1 125 PRO 125 123 123 PRO PRO AAA . n A 1 126 LEU 126 124 124 LEU LEU AAA . n A 1 127 TRP 127 125 125 TRP TRP AAA . n A 1 128 ALA 128 126 126 ALA ALA AAA . n A 1 129 ARG 129 127 127 ARG ARG AAA . n A 1 130 ASN 130 128 128 ASN ASN AAA . n A 1 131 VAL 131 129 129 VAL VAL AAA . n A 1 132 PRO 132 130 130 PRO PRO AAA . n A 1 133 LYS 133 131 131 LYS LYS AAA . n A 1 134 PHE 134 132 132 PHE PHE AAA . n A 1 135 GLY 135 133 133 GLY GLY AAA . n A 1 136 LEU 136 134 134 LEU LEU AAA . n A 1 137 ALA 137 135 135 ALA ALA AAA . n A 1 138 HIS 138 136 136 HIS HIS AAA . n A 1 139 LEU 139 137 137 LEU LEU AAA . n A 1 140 MET 140 138 138 MET MET AAA . n A 1 141 ALA 141 139 139 ALA ALA AAA . n A 1 142 LEU 142 140 140 LEU LEU AAA . n A 1 143 GLY 143 141 141 GLY GLY AAA . n A 1 144 LEU 144 142 142 LEU LEU AAA . n A 1 145 GLY 145 143 143 GLY GLY AAA . n A 1 146 PRO 146 144 144 PRO PRO AAA . n A 1 147 TRP 147 145 145 TRP TRP AAA . n A 1 148 LEU 148 146 146 LEU LEU AAA . n A 1 149 ALA 149 147 147 ALA ALA AAA . n A 1 150 VAL 150 148 148 VAL VAL AAA . n A 1 151 GLU 151 149 149 GLU GLU AAA . n A 1 152 ILE 152 150 150 ILE ILE AAA . n A 1 153 PRO 153 151 151 PRO PRO AAA . n A 1 154 ASP 154 152 152 ASP ASP AAA . n A 1 155 LEU 155 153 153 LEU LEU AAA . n A 1 156 ILE 156 154 154 ILE ILE AAA . n A 1 157 GLN 157 155 155 GLN GLN AAA . n A 1 158 LYS 158 156 156 LYS LYS AAA . n A 1 159 GLY 159 157 157 GLY GLY AAA . n A 1 160 VAL 160 158 158 VAL VAL AAA . n A 1 161 ILE 161 159 159 ILE ILE AAA . n A 1 162 HIS 162 160 160 HIS HIS AAA . n A 1 163 HIS 163 161 161 HIS HIS AAA . n A 1 164 LYS 164 162 162 LYS LYS AAA . n A 1 165 GLU 165 163 163 GLU GLU AAA . n A 1 166 LYS 166 164 164 LYS LYS AAA . n A 1 167 CYS 167 165 165 CYS CYS AAA . n A 1 168 ASN 168 166 ? ? ? AAA . n A 1 169 GLN 169 167 ? ? ? AAA . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 133 HOH HOH AAA . B 2 HOH 2 202 70 HOH HOH AAA . B 2 HOH 3 203 110 HOH HOH AAA . B 2 HOH 4 204 131 HOH HOH AAA . B 2 HOH 5 205 55 HOH HOH AAA . B 2 HOH 6 206 78 HOH HOH AAA . B 2 HOH 7 207 23 HOH HOH AAA . B 2 HOH 8 208 69 HOH HOH AAA . B 2 HOH 9 209 143 HOH HOH AAA . B 2 HOH 10 210 18 HOH HOH AAA . B 2 HOH 11 211 48 HOH HOH AAA . B 2 HOH 12 212 44 HOH HOH AAA . B 2 HOH 13 213 67 HOH HOH AAA . B 2 HOH 14 214 30 HOH HOH AAA . B 2 HOH 15 215 71 HOH HOH AAA . B 2 HOH 16 216 86 HOH HOH AAA . B 2 HOH 17 217 7 HOH HOH AAA . B 2 HOH 18 218 92 HOH HOH AAA . B 2 HOH 19 219 15 HOH HOH AAA . B 2 HOH 20 220 95 HOH HOH AAA . B 2 HOH 21 221 99 HOH HOH AAA . B 2 HOH 22 222 139 HOH HOH AAA . B 2 HOH 23 223 77 HOH HOH AAA . B 2 HOH 24 224 59 HOH HOH AAA . B 2 HOH 25 225 31 HOH HOH AAA . B 2 HOH 26 226 94 HOH HOH AAA . B 2 HOH 27 227 66 HOH HOH AAA . B 2 HOH 28 228 38 HOH HOH AAA . B 2 HOH 29 229 85 HOH HOH AAA . B 2 HOH 30 230 115 HOH HOH AAA . B 2 HOH 31 231 98 HOH HOH AAA . B 2 HOH 32 232 21 HOH HOH AAA . B 2 HOH 33 233 124 HOH HOH AAA . B 2 HOH 34 234 29 HOH HOH AAA . B 2 HOH 35 235 100 HOH HOH AAA . B 2 HOH 36 236 102 HOH HOH AAA . B 2 HOH 37 237 116 HOH HOH AAA . B 2 HOH 38 238 36 HOH HOH AAA . B 2 HOH 39 239 81 HOH HOH AAA . B 2 HOH 40 240 17 HOH HOH AAA . B 2 HOH 41 241 138 HOH HOH AAA . B 2 HOH 42 242 123 HOH HOH AAA . B 2 HOH 43 243 135 HOH HOH AAA . B 2 HOH 44 244 8 HOH HOH AAA . B 2 HOH 45 245 9 HOH HOH AAA . B 2 HOH 46 246 34 HOH HOH AAA . B 2 HOH 47 247 13 HOH HOH AAA . B 2 HOH 48 248 65 HOH HOH AAA . B 2 HOH 49 249 64 HOH HOH AAA . B 2 HOH 50 250 4 HOH HOH AAA . B 2 HOH 51 251 127 HOH HOH AAA . B 2 HOH 52 252 11 HOH HOH AAA . B 2 HOH 53 253 88 HOH HOH AAA . B 2 HOH 54 254 61 HOH HOH AAA . B 2 HOH 55 255 87 HOH HOH AAA . B 2 HOH 56 256 6 HOH HOH AAA . B 2 HOH 57 257 118 HOH HOH AAA . B 2 HOH 58 258 12 HOH HOH AAA . B 2 HOH 59 259 144 HOH HOH AAA . B 2 HOH 60 260 46 HOH HOH AAA . B 2 HOH 61 261 83 HOH HOH AAA . B 2 HOH 62 262 76 HOH HOH AAA . B 2 HOH 63 263 146 HOH HOH AAA . B 2 HOH 64 264 130 HOH HOH AAA . B 2 HOH 65 265 42 HOH HOH AAA . B 2 HOH 66 266 112 HOH HOH AAA . B 2 HOH 67 267 24 HOH HOH AAA . B 2 HOH 68 268 27 HOH HOH AAA . B 2 HOH 69 269 84 HOH HOH AAA . B 2 HOH 70 270 53 HOH HOH AAA . B 2 HOH 71 271 96 HOH HOH AAA . B 2 HOH 72 272 68 HOH HOH AAA . B 2 HOH 73 273 43 HOH HOH AAA . B 2 HOH 74 274 33 HOH HOH AAA . B 2 HOH 75 275 28 HOH HOH AAA . B 2 HOH 76 276 90 HOH HOH AAA . B 2 HOH 77 277 129 HOH HOH AAA . B 2 HOH 78 278 89 HOH HOH AAA . B 2 HOH 79 279 75 HOH HOH AAA . B 2 HOH 80 280 80 HOH HOH AAA . B 2 HOH 81 281 41 HOH HOH AAA . B 2 HOH 82 282 3 HOH HOH AAA . B 2 HOH 83 283 39 HOH HOH AAA . B 2 HOH 84 284 141 HOH HOH AAA . B 2 HOH 85 285 25 HOH HOH AAA . B 2 HOH 86 286 101 HOH HOH AAA . B 2 HOH 87 287 105 HOH HOH AAA . B 2 HOH 88 288 16 HOH HOH AAA . B 2 HOH 89 289 10 HOH HOH AAA . B 2 HOH 90 290 37 HOH HOH AAA . B 2 HOH 91 291 22 HOH HOH AAA . B 2 HOH 92 292 20 HOH HOH AAA . B 2 HOH 93 293 114 HOH HOH AAA . B 2 HOH 94 294 50 HOH HOH AAA . B 2 HOH 95 295 1 HOH HOH AAA . B 2 HOH 96 296 113 HOH HOH AAA . B 2 HOH 97 297 2 HOH HOH AAA . B 2 HOH 98 298 40 HOH HOH AAA . B 2 HOH 99 299 45 HOH HOH AAA . B 2 HOH 100 300 14 HOH HOH AAA . B 2 HOH 101 301 97 HOH HOH AAA . B 2 HOH 102 302 104 HOH HOH AAA . B 2 HOH 103 303 111 HOH HOH AAA . B 2 HOH 104 304 63 HOH HOH AAA . B 2 HOH 105 305 103 HOH HOH AAA . B 2 HOH 106 306 91 HOH HOH AAA . B 2 HOH 107 307 74 HOH HOH AAA . B 2 HOH 108 308 5 HOH HOH AAA . B 2 HOH 109 309 57 HOH HOH AAA . B 2 HOH 110 310 108 HOH HOH AAA . B 2 HOH 111 311 49 HOH HOH AAA . B 2 HOH 112 312 73 HOH HOH AAA . B 2 HOH 113 313 79 HOH HOH AAA . B 2 HOH 114 314 60 HOH HOH AAA . B 2 HOH 115 315 56 HOH HOH AAA . B 2 HOH 116 316 107 HOH HOH AAA . B 2 HOH 117 317 140 HOH HOH AAA . B 2 HOH 118 318 32 HOH HOH AAA . B 2 HOH 119 319 26 HOH HOH AAA . B 2 HOH 120 320 58 HOH HOH AAA . B 2 HOH 121 321 35 HOH HOH AAA . B 2 HOH 122 322 62 HOH HOH AAA . B 2 HOH 123 323 106 HOH HOH AAA . B 2 HOH 124 324 142 HOH HOH AAA . B 2 HOH 125 325 122 HOH HOH AAA . B 2 HOH 126 326 120 HOH HOH AAA . B 2 HOH 127 327 19 HOH HOH AAA . B 2 HOH 128 328 52 HOH HOH AAA . B 2 HOH 129 329 125 HOH HOH AAA . B 2 HOH 130 330 149 HOH HOH AAA . B 2 HOH 131 331 47 HOH HOH AAA . B 2 HOH 132 332 121 HOH HOH AAA . B 2 HOH 133 333 109 HOH HOH AAA . B 2 HOH 134 334 137 HOH HOH AAA . B 2 HOH 135 335 82 HOH HOH AAA . B 2 HOH 136 336 119 HOH HOH AAA . B 2 HOH 137 337 150 HOH HOH AAA . B 2 HOH 138 338 117 HOH HOH AAA . B 2 HOH 139 339 54 HOH HOH AAA . B 2 HOH 140 340 136 HOH HOH AAA . B 2 HOH 141 341 147 HOH HOH AAA . B 2 HOH 142 342 51 HOH HOH AAA . B 2 HOH 143 343 132 HOH HOH AAA . B 2 HOH 144 344 126 HOH HOH AAA . B 2 HOH 145 345 145 HOH HOH AAA . B 2 HOH 146 346 148 HOH HOH AAA . B 2 HOH 147 347 128 HOH HOH AAA . B 2 HOH 148 348 134 HOH HOH AAA . B 2 HOH 149 349 152 HOH HOH AAA . B 2 HOH 150 350 151 HOH HOH AAA . B 2 HOH 151 351 93 HOH HOH AAA . B 2 HOH 152 352 153 HOH HOH AAA . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 AAA ARG 25 ? NE ? A ARG 27 NE 2 1 Y 1 AAA ARG 25 ? CZ ? A ARG 27 CZ 3 1 Y 1 AAA ARG 25 ? NH1 ? A ARG 27 NH1 4 1 Y 1 AAA ARG 25 ? NH2 ? A ARG 27 NH2 5 1 Y 1 AAA LYS 162 ? CG ? A LYS 164 CG 6 1 Y 1 AAA LYS 162 ? CD ? A LYS 164 CD 7 1 Y 1 AAA LYS 162 ? CE ? A LYS 164 CE 8 1 Y 1 AAA LYS 162 ? NZ ? A LYS 164 NZ 9 1 Y 1 AAA LYS 164 ? CG ? A LYS 166 CG 10 1 Y 1 AAA LYS 164 ? CD ? A LYS 166 CD 11 1 Y 1 AAA LYS 164 ? CE ? A LYS 166 CE 12 1 Y 1 AAA LYS 164 ? NZ ? A LYS 166 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9GLL _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.200 _cell.length_a_esd ? _cell.length_b 47.200 _cell.length_b_esd ? _cell.length_c 142.800 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9GLL _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9GLL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.02 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.4M Sodium potassium monobasic monohydrate/Potassium phosphate dibasic pH 9.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 298 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-12-20 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54187 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type RIGAKU _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54187 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 11.53 _reflns.entry_id 9GLL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.65 _reflns.d_resolution_low 44.82 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20255 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.58 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.61 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.06703 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.65 _reflns_shell.d_res_low 1.709 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.61 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1959 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.9 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.594 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.664 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.49 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.423 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -0.423 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.845 _refine.B_iso_max ? _refine.B_iso_mean 13.882 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.945 _refine.correlation_coeff_Fo_to_Fc_free 0.926 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9GLL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.650 _refine.ls_d_res_low 44.815 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 20252 _refine.ls_number_reflns_R_free 1031 _refine.ls_number_reflns_R_work 19221 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.577 _refine.ls_percent_reflns_R_free 5.091 _refine.ls_R_factor_all 0.204 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2310 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2030 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.119 _refine.pdbx_overall_ESU_R_Free 0.111 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.569 _refine.overall_SU_ML 0.084 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1352 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 152 _refine_hist.number_atoms_total 1504 _refine_hist.d_res_high 1.650 _refine_hist.d_res_low 44.815 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.013 1469 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 1373 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.680 1.646 2003 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.429 1.584 3174 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.789 5.000 180 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.205 22.024 84 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.132 15.000 253 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.691 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.086 0.200 182 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1687 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 351 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.207 0.200 292 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.184 0.200 1202 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.171 0.200 696 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.079 0.200 615 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.156 0.200 93 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.121 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.295 0.200 25 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.254 0.200 70 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.342 0.200 23 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 1.325 1.266 702 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.245 1.261 701 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.058 1.885 888 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.063 1.889 889 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.085 1.493 767 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.074 1.493 767 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 3.235 2.137 1114 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.238 2.138 1115 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.331 23.907 6130 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 4.991 23.363 5998 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.650 1.693 . . 71 1389 98.5820 . . . . 0.286 . . . . . . . . . . . 0.290 'X-RAY DIFFRACTION' 1.693 1.739 . . 62 1330 98.5836 . . . . 0.259 . . . . . . . . . . . 0.259 'X-RAY DIFFRACTION' 1.739 1.789 . . 85 1299 99.2115 . . . . 0.245 . . . . . . . . . . . 0.256 'X-RAY DIFFRACTION' 1.789 1.844 . . 72 1269 99.4070 . . . . 0.232 . . . . . . . . . . . 0.313 'X-RAY DIFFRACTION' 1.844 1.905 . . 73 1235 99.4677 . . . . 0.226 . . . . . . . . . . . 0.226 'X-RAY DIFFRACTION' 1.905 1.972 . . 61 1218 99.7660 . . . . 0.220 . . . . . . . . . . . 0.259 'X-RAY DIFFRACTION' 1.972 2.046 . . 64 1160 99.8369 . . . . 0.209 . . . . . . . . . . . 0.278 'X-RAY DIFFRACTION' 2.046 2.129 . . 68 1113 99.9154 . . . . 0.189 . . . . . . . . . . . 0.251 'X-RAY DIFFRACTION' 2.129 2.224 . . 62 1091 100.0000 . . . . 0.172 . . . . . . . . . . . 0.196 'X-RAY DIFFRACTION' 2.224 2.332 . . 61 1022 100.0000 . . . . 0.187 . . . . . . . . . . . 0.222 'X-RAY DIFFRACTION' 2.332 2.458 . . 56 998 100.0000 . . . . 0.180 . . . . . . . . . . . 0.180 'X-RAY DIFFRACTION' 2.458 2.606 . . 41 949 100.0000 . . . . 0.181 . . . . . . . . . . . 0.230 'X-RAY DIFFRACTION' 2.606 2.786 . . 44 915 99.8958 . . . . 0.198 . . . . . . . . . . . 0.274 'X-RAY DIFFRACTION' 2.786 3.008 . . 36 834 100.0000 . . . . 0.207 . . . . . . . . . . . 0.231 'X-RAY DIFFRACTION' 3.008 3.293 . . 37 776 100.0000 . . . . 0.205 . . . . . . . . . . . 0.225 'X-RAY DIFFRACTION' 3.293 3.680 . . 37 714 99.7344 . . . . 0.195 . . . . . . . . . . . 0.215 'X-RAY DIFFRACTION' 3.680 4.244 . . 33 642 99.7046 . . . . 0.168 . . . . . . . . . . . 0.223 'X-RAY DIFFRACTION' 4.244 5.186 . . 36 538 99.8261 . . . . 0.166 . . . . . . . . . . . 0.172 'X-RAY DIFFRACTION' 5.186 7.286 . . 16 445 99.3534 . . . . 0.201 . . . . . . . . . . . 0.238 'X-RAY DIFFRACTION' 7.286 44.815 . . 16 284 98.6842 . . . . 0.222 . . . . . . . . . . . 0.194 # _struct.entry_id 9GLL _struct.title 'Crystal Structure of UFC1 T106L' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9GLL _struct_keywords.text 'UFM1 conjugating enzyme1, UBC core domain containing protein, Brain development, Infantile encephalopathy, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UFC1_HUMAN _struct_ref.pdbx_db_accession Q9Y3C8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEF DIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQ HKEKCNQ ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9GLL _struct_ref_seq.pdbx_strand_id AAA _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 169 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y3C8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 167 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 167 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9GLL GLY AAA 1 ? UNP Q9Y3C8 ? ? 'expression tag' -1 1 1 9GLL SER AAA 2 ? UNP Q9Y3C8 ? ? 'expression tag' 0 2 1 9GLL LEU AAA 108 ? UNP Q9Y3C8 THR 106 'engineered mutation' 106 3 1 9GLL HIS AAA 162 ? UNP Q9Y3C8 GLN 160 conflict 160 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? SER A 13 ? SER AAA 0 SER AAA 11 1 ? 12 HELX_P HELX_P2 AA2 ASP A 26 ? ALA A 51 ? ASP AAA 24 ALA AAA 49 1 ? 26 HELX_P HELX_P3 AA3 VAL A 101 ? ASP A 105 ? VAL AAA 99 ASP AAA 103 5 ? 5 HELX_P HELX_P4 AA4 HIS A 122 ? VAL A 131 ? HIS AAA 120 VAL AAA 129 1 ? 10 HELX_P HELX_P5 AA5 GLY A 135 ? GLY A 143 ? GLY AAA 133 GLY AAA 141 1 ? 9 HELX_P HELX_P6 AA6 GLY A 143 ? LYS A 158 ? GLY AAA 141 LYS AAA 156 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 118 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 167 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id AAA _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 116 _struct_conn.ptnr2_auth_asym_id AAA _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 165 _struct_conn.ptnr2_symmetry 4_454 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.088 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 118 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 167 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id AAA _pdbx_modification_feature.auth_seq_id 116 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id AAA _pdbx_modification_feature.modified_residue_auth_seq_id 165 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 4_454 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 92 A . ? TYR 90 AAA PRO 93 A ? PRO 91 AAA 1 0.23 2 VAL 131 A . ? VAL 129 AAA PRO 132 A ? PRO 130 AAA 1 -3.93 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 56 ? SER A 60 ? PHE AAA 54 SER AAA 58 AA1 2 ARG A 66 ? HIS A 75 ? ARG AAA 64 HIS AAA 73 AA1 3 LEU A 78 ? ASP A 87 ? LEU AAA 76 ASP AAA 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 59 ? N GLU AAA 57 O PHE A 68 ? O PHE AAA 66 AA1 2 3 N TYR A 73 ? N TYR AAA 71 O TYR A 80 ? O TYR AAA 78 # _pdbx_entry_details.entry_id 9GLL _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 AAA _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 222 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 AAA _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 328 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.97 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 AAA _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 61 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 A _pdbx_validate_rmsd_bond.auth_atom_id_2 OE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 AAA _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 61 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 A _pdbx_validate_rmsd_bond.bond_value 1.363 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation 0.111 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS AAA 17 ? ? -132.93 -43.82 2 1 ARG AAA 25 ? ? 58.30 -126.56 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 AAA HOH 257 ? B HOH . 2 1 AAA HOH 297 ? B HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA GLY -1 ? A GLY 1 2 1 Y 1 AAA ASN 166 ? A ASN 168 3 1 Y 1 AAA GLN 167 ? A GLN 169 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Israel Science Foundation' _pdbx_audit_support.country Israel _pdbx_audit_support.grant_number 491/2021 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2Z6O _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9GLL _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.021186 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021186 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007003 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.184 # loop_ #