data_9GVZ
#
_entry.id 9GVZ
#
_audit_conform.dict_name mmcif_pdbx.dic
_audit_conform.dict_version 5.403
_audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic
#
loop_
_database_2.database_id
_database_2.database_code
_database_2.pdbx_database_accession
_database_2.pdbx_DOI
PDB 9GVZ pdb_00009gvz 10.2210/pdb9gvz/pdb
WWPDB D_1292139395 ? ?
#
loop_
_pdbx_audit_revision_history.ordinal
_pdbx_audit_revision_history.data_content_type
_pdbx_audit_revision_history.major_revision
_pdbx_audit_revision_history.minor_revision
_pdbx_audit_revision_history.revision_date
_pdbx_audit_revision_history.part_number
1 'Structure model' 1 0 2025-03-26 ?
2 'Structure model' 1 1 2025-04-02 ?
#
_pdbx_audit_revision_details.ordinal 1
_pdbx_audit_revision_details.revision_ordinal 1
_pdbx_audit_revision_details.data_content_type 'Structure model'
_pdbx_audit_revision_details.provider repository
_pdbx_audit_revision_details.type 'Initial release'
_pdbx_audit_revision_details.description ?
_pdbx_audit_revision_details.details ?
#
_pdbx_audit_revision_group.ordinal 1
_pdbx_audit_revision_group.revision_ordinal 2
_pdbx_audit_revision_group.data_content_type 'Structure model'
_pdbx_audit_revision_group.group 'Database references'
#
_pdbx_audit_revision_category.ordinal 1
_pdbx_audit_revision_category.revision_ordinal 2
_pdbx_audit_revision_category.data_content_type 'Structure model'
_pdbx_audit_revision_category.category citation
#
loop_
_pdbx_audit_revision_item.ordinal
_pdbx_audit_revision_item.revision_ordinal
_pdbx_audit_revision_item.data_content_type
_pdbx_audit_revision_item.item
1 2 'Structure model' '_citation.pdbx_database_id_PubMed'
2 2 'Structure model' '_citation.title'
#
_pdbx_database_status.status_code REL
_pdbx_database_status.status_code_sf REL
_pdbx_database_status.status_code_mr ?
_pdbx_database_status.entry_id 9GVZ
_pdbx_database_status.recvd_initial_deposition_date 2024-09-26
_pdbx_database_status.SG_entry N
_pdbx_database_status.deposit_site PDBE
_pdbx_database_status.process_site PDBE
_pdbx_database_status.status_code_cs ?
_pdbx_database_status.status_code_nmr_data ?
_pdbx_database_status.methods_development_category ?
_pdbx_database_status.pdb_format_compatible N
#
_pdbx_contact_author.id 2
_pdbx_contact_author.email pozzi4@unisi.it
_pdbx_contact_author.name_first Cecilia
_pdbx_contact_author.name_last Pozzi
_pdbx_contact_author.name_mi ?
_pdbx_contact_author.role 'principal investigator/group leader'
_pdbx_contact_author.identifier_ORCID 0000-0003-2574-3911
#
loop_
_audit_author.name
_audit_author.pdbx_ordinal
_audit_author.identifier_ORCID
'Tassone, G.' 1 0000-0002-2575-5528
'Pozzi, C.' 2 0000-0003-2574-3911
#
_citation.abstract ?
_citation.abstract_id_CAS ?
_citation.book_id_ISBN ?
_citation.book_publisher ?
_citation.book_publisher_city ?
_citation.book_title ?
_citation.coordinate_linkage ?
_citation.country US
_citation.database_id_Medline ?
_citation.details ?
_citation.id primary
_citation.journal_abbrev 'Acs Med.Chem.Lett.'
_citation.journal_id_ASTM ?
_citation.journal_id_CSD ?
_citation.journal_id_ISSN 1948-5875
_citation.journal_full ?
_citation.journal_issue ?
_citation.journal_volume 16
_citation.language ?
_citation.page_first 397
_citation.page_last 405
_citation.title
'Morita-Baylis-Hillman Adduct Chemistry as a Tool for the Design of Lysine-Targeted Covalent Ligands.'
_citation.year 2025
_citation.database_id_CSD ?
_citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.4c00479
_citation.pdbx_database_id_PubMed 40104796
_citation.pdbx_database_id_patent ?
_citation.unpublished_flag ?
#
loop_
_citation_author.citation_id
_citation_author.name
_citation_author.ordinal
_citation_author.identifier_ORCID
primary 'Paolino, M.' 1 ?
primary 'Tassone, G.' 2 ?
primary 'Governa, P.' 3 ?
primary 'Saletti, M.' 4 ?
primary 'Lami, M.' 5 ?
primary 'Carletti, R.' 6 ?
primary 'Sacchetta, F.' 7 ?
primary 'Pozzi, C.' 8 ?
primary 'Orlandini, M.' 9 ?
primary 'Manetti, F.' 10 ?
primary 'Olivucci, M.' 11 ?
primary 'Cappelli, A.' 12 ?
#
loop_
_entity.id
_entity.type
_entity.src_method
_entity.pdbx_description
_entity.formula_weight
_entity.pdbx_number_of_molecules
_entity.pdbx_ec
_entity.pdbx_mutation
_entity.pdbx_fragment
_entity.details
1 polymer man 'Cellular retinoic acid-binding protein 2' 15992.265 1 ?
'R111K, Y134F, T54V, R132Q, P39Y, R59Y' ? ?
2 non-polymer syn 'methyl (~{Z})-3-(4-ethynoxy-3,5-dimethoxy-phenyl)-2-methyl-prop-2-enoate' 290.311 1 ? ? ? ?
3 water nat water 18.015 2 ? ? ? ?
#
_entity_name_com.entity_id 1
_entity_name_com.name 'Cellular retinoic acid-binding protein II,CRABP-II'
#
_entity_poly.entity_id 1
_entity_poly.type 'polypeptide(L)'
_entity_poly.nstd_linkage no
_entity_poly.nstd_monomer no
_entity_poly.pdbx_seq_one_letter_code
;GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTV
DGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
;
_entity_poly.pdbx_seq_one_letter_code_can
;GSHMPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTV
DGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
;
_entity_poly.pdbx_strand_id A
_entity_poly.pdbx_target_identifier ?
#
loop_
_pdbx_entity_nonpoly.entity_id
_pdbx_entity_nonpoly.name
_pdbx_entity_nonpoly.comp_id
2 'methyl (~{Z})-3-(4-ethynoxy-3,5-dimethoxy-phenyl)-2-methyl-prop-2-enoate' A1IQ0
3 water HOH
#
loop_
_entity_poly_seq.entity_id
_entity_poly_seq.num
_entity_poly_seq.mon_id
_entity_poly_seq.hetero
1 1 GLY n
1 2 SER n
1 3 HIS n
1 4 MET n
1 5 PRO n
1 6 ASN n
1 7 PHE n
1 8 SER n
1 9 GLY n
1 10 ASN n
1 11 TRP n
1 12 LYS n
1 13 ILE n
1 14 ILE n
1 15 ARG n
1 16 SER n
1 17 GLU n
1 18 ASN n
1 19 PHE n
1 20 GLU n
1 21 GLU n
1 22 LEU n
1 23 LEU n
1 24 LYS n
1 25 VAL n
1 26 LEU n
1 27 GLY n
1 28 VAL n
1 29 ASN n
1 30 VAL n
1 31 MET n
1 32 LEU n
1 33 ARG n
1 34 LYS n
1 35 ILE n
1 36 ALA n
1 37 VAL n
1 38 ALA n
1 39 ALA n
1 40 ALA n
1 41 SER n
1 42 LYS n
1 43 TYR n
1 44 ALA n
1 45 VAL n
1 46 GLU n
1 47 ILE n
1 48 LYS n
1 49 GLN n
1 50 GLU n
1 51 GLY n
1 52 ASP n
1 53 THR n
1 54 PHE n
1 55 TYR n
1 56 ILE n
1 57 LYS n
1 58 VAL n
1 59 SER n
1 60 THR n
1 61 THR n
1 62 VAL n
1 63 TYR n
1 64 THR n
1 65 THR n
1 66 GLU n
1 67 ILE n
1 68 ASN n
1 69 PHE n
1 70 LYS n
1 71 VAL n
1 72 GLY n
1 73 GLU n
1 74 GLU n
1 75 PHE n
1 76 GLU n
1 77 GLU n
1 78 GLN n
1 79 THR n
1 80 VAL n
1 81 ASP n
1 82 GLY n
1 83 ARG n
1 84 PRO n
1 85 CYS n
1 86 LYS n
1 87 SER n
1 88 LEU n
1 89 VAL n
1 90 LYS n
1 91 TRP n
1 92 GLU n
1 93 SER n
1 94 GLU n
1 95 ASN n
1 96 LYS n
1 97 MET n
1 98 VAL n
1 99 CYS n
1 100 GLU n
1 101 GLN n
1 102 LYS n
1 103 LEU n
1 104 LEU n
1 105 LYS n
1 106 GLY n
1 107 GLU n
1 108 GLY n
1 109 PRO n
1 110 LYS n
1 111 THR n
1 112 SER n
1 113 TRP n
1 114 THR n
1 115 LYS n
1 116 GLU n
1 117 LEU n
1 118 THR n
1 119 ASN n
1 120 ASP n
1 121 GLY n
1 122 GLU n
1 123 LEU n
1 124 ILE n
1 125 LEU n
1 126 THR n
1 127 MET n
1 128 THR n
1 129 ALA n
1 130 ASP n
1 131 ASP n
1 132 VAL n
1 133 VAL n
1 134 CYS n
1 135 THR n
1 136 GLN n
1 137 VAL n
1 138 PHE n
1 139 VAL n
1 140 ARG n
1 141 GLU n
#
_entity_src_gen.entity_id 1
_entity_src_gen.pdbx_src_id 1
_entity_src_gen.pdbx_alt_source_flag sample
_entity_src_gen.pdbx_seq_type 'Biological sequence'
_entity_src_gen.pdbx_beg_seq_num 1
_entity_src_gen.pdbx_end_seq_num 141
_entity_src_gen.gene_src_common_name human
_entity_src_gen.gene_src_genus ?
_entity_src_gen.pdbx_gene_src_gene CRABP2
_entity_src_gen.gene_src_species ?
_entity_src_gen.gene_src_strain ?
_entity_src_gen.gene_src_tissue ?
_entity_src_gen.gene_src_tissue_fraction ?
_entity_src_gen.gene_src_details ?
_entity_src_gen.pdbx_gene_src_fragment ?
_entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens'
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606
_entity_src_gen.pdbx_gene_src_variant ?
_entity_src_gen.pdbx_gene_src_cell_line ?
_entity_src_gen.pdbx_gene_src_atcc ?
_entity_src_gen.pdbx_gene_src_organ ?
_entity_src_gen.pdbx_gene_src_organelle ?
_entity_src_gen.pdbx_gene_src_cell ?
_entity_src_gen.pdbx_gene_src_cellular_location ?
_entity_src_gen.host_org_common_name ?
_entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)'
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008
_entity_src_gen.host_org_genus ?
_entity_src_gen.pdbx_host_org_gene ?
_entity_src_gen.pdbx_host_org_organ ?
_entity_src_gen.host_org_species ?
_entity_src_gen.pdbx_host_org_tissue ?
_entity_src_gen.pdbx_host_org_tissue_fraction ?
_entity_src_gen.pdbx_host_org_strain ?
_entity_src_gen.pdbx_host_org_variant ?
_entity_src_gen.pdbx_host_org_cell_line ?
_entity_src_gen.pdbx_host_org_atcc ?
_entity_src_gen.pdbx_host_org_culture_collection ?
_entity_src_gen.pdbx_host_org_cell ?
_entity_src_gen.pdbx_host_org_organelle ?
_entity_src_gen.pdbx_host_org_cellular_location ?
_entity_src_gen.pdbx_host_org_vector_type PLASMID
_entity_src_gen.pdbx_host_org_vector ?
_entity_src_gen.host_org_details ?
_entity_src_gen.expression_system_id ?
_entity_src_gen.plasmid_name pET15b
_entity_src_gen.plasmid_details ?
_entity_src_gen.pdbx_description ?
#
loop_
_chem_comp.id
_chem_comp.type
_chem_comp.mon_nstd_flag
_chem_comp.name
_chem_comp.pdbx_synonyms
_chem_comp.formula
_chem_comp.formula_weight
A1IQ0 non-polymer . 'methyl (~{Z})-3-(4-ethynoxy-3,5-dimethoxy-phenyl)-2-methyl-prop-2-enoate' ? 'C16 H18 O5' 290.311
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129
GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162
HOH non-polymer . WATER ? 'H2 O' 18.015
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146
#
loop_
_pdbx_poly_seq_scheme.asym_id
_pdbx_poly_seq_scheme.entity_id
_pdbx_poly_seq_scheme.seq_id
_pdbx_poly_seq_scheme.mon_id
_pdbx_poly_seq_scheme.ndb_seq_num
_pdbx_poly_seq_scheme.pdb_seq_num
_pdbx_poly_seq_scheme.auth_seq_num
_pdbx_poly_seq_scheme.pdb_mon_id
_pdbx_poly_seq_scheme.auth_mon_id
_pdbx_poly_seq_scheme.pdb_strand_id
_pdbx_poly_seq_scheme.pdb_ins_code
_pdbx_poly_seq_scheme.hetero
A 1 1 GLY 1 -3 ? ? ? A . n
A 1 2 SER 2 -2 ? ? ? A . n
A 1 3 HIS 3 -1 ? ? ? A . n
A 1 4 MET 4 0 0 MET MET A . n
A 1 5 PRO 5 1 1 PRO PRO A . n
A 1 6 ASN 6 2 2 ASN ASN A . n
A 1 7 PHE 7 3 3 PHE PHE A . n
A 1 8 SER 8 4 4 SER SER A . n
A 1 9 GLY 9 5 5 GLY GLY A . n
A 1 10 ASN 10 6 6 ASN ASN A . n
A 1 11 TRP 11 7 7 TRP TRP A . n
A 1 12 LYS 12 8 8 LYS LYS A . n
A 1 13 ILE 13 9 9 ILE ILE A . n
A 1 14 ILE 14 10 10 ILE ILE A . n
A 1 15 ARG 15 11 11 ARG ARG A . n
A 1 16 SER 16 12 12 SER SER A . n
A 1 17 GLU 17 13 13 GLU GLU A . n
A 1 18 ASN 18 14 14 ASN ASN A . n
A 1 19 PHE 19 15 15 PHE PHE A . n
A 1 20 GLU 20 16 16 GLU GLU A . n
A 1 21 GLU 21 17 17 GLU GLU A . n
A 1 22 LEU 22 18 18 LEU LEU A . n
A 1 23 LEU 23 19 19 LEU LEU A . n
A 1 24 LYS 24 20 20 LYS LYS A . n
A 1 25 VAL 25 21 21 VAL VAL A . n
A 1 26 LEU 26 22 22 LEU LEU A . n
A 1 27 GLY 27 23 23 GLY GLY A . n
A 1 28 VAL 28 24 24 VAL VAL A . n
A 1 29 ASN 29 25 25 ASN ASN A . n
A 1 30 VAL 30 26 26 VAL VAL A . n
A 1 31 MET 31 27 27 MET MET A . n
A 1 32 LEU 32 28 28 LEU LEU A . n
A 1 33 ARG 33 29 29 ARG ARG A . n
A 1 34 LYS 34 30 30 LYS LYS A . n
A 1 35 ILE 35 31 31 ILE ILE A . n
A 1 36 ALA 36 32 32 ALA ALA A . n
A 1 37 VAL 37 33 33 VAL VAL A . n
A 1 38 ALA 38 34 34 ALA ALA A . n
A 1 39 ALA 39 35 35 ALA ALA A . n
A 1 40 ALA 40 36 36 ALA ALA A . n
A 1 41 SER 41 37 37 SER SER A . n
A 1 42 LYS 42 38 38 LYS LYS A . n
A 1 43 TYR 43 39 39 TYR TYR A . n
A 1 44 ALA 44 40 40 ALA ALA A . n
A 1 45 VAL 45 41 41 VAL VAL A . n
A 1 46 GLU 46 42 42 GLU GLU A . n
A 1 47 ILE 47 43 43 ILE ILE A . n
A 1 48 LYS 48 44 44 LYS LYS A . n
A 1 49 GLN 49 45 45 GLN GLN A . n
A 1 50 GLU 50 46 46 GLU GLU A . n
A 1 51 GLY 51 47 47 GLY GLY A . n
A 1 52 ASP 52 48 48 ASP ASP A . n
A 1 53 THR 53 49 49 THR THR A . n
A 1 54 PHE 54 50 50 PHE PHE A . n
A 1 55 TYR 55 51 51 TYR TYR A . n
A 1 56 ILE 56 52 52 ILE ILE A . n
A 1 57 LYS 57 53 53 LYS LYS A . n
A 1 58 VAL 58 54 54 VAL VAL A . n
A 1 59 SER 59 55 55 SER SER A . n
A 1 60 THR 60 56 56 THR THR A . n
A 1 61 THR 61 57 57 THR THR A . n
A 1 62 VAL 62 58 58 VAL VAL A . n
A 1 63 TYR 63 59 59 TYR TYR A . n
A 1 64 THR 64 60 60 THR THR A . n
A 1 65 THR 65 61 61 THR THR A . n
A 1 66 GLU 66 62 62 GLU GLU A . n
A 1 67 ILE 67 63 63 ILE ILE A . n
A 1 68 ASN 68 64 64 ASN ASN A . n
A 1 69 PHE 69 65 65 PHE PHE A . n
A 1 70 LYS 70 66 66 LYS LYS A . n
A 1 71 VAL 71 67 67 VAL VAL A . n
A 1 72 GLY 72 68 68 GLY GLY A . n
A 1 73 GLU 73 69 69 GLU GLU A . n
A 1 74 GLU 74 70 70 GLU GLU A . n
A 1 75 PHE 75 71 71 PHE PHE A . n
A 1 76 GLU 76 72 72 GLU GLU A . n
A 1 77 GLU 77 73 73 GLU GLU A . n
A 1 78 GLN 78 74 74 GLN GLN A . n
A 1 79 THR 79 75 75 THR THR A . n
A 1 80 VAL 80 76 76 VAL VAL A . n
A 1 81 ASP 81 77 77 ASP ASP A . n
A 1 82 GLY 82 78 78 GLY GLY A . n
A 1 83 ARG 83 79 79 ARG ARG A . n
A 1 84 PRO 84 80 80 PRO PRO A . n
A 1 85 CYS 85 81 81 CYS CYS A . n
A 1 86 LYS 86 82 82 LYS LYS A . n
A 1 87 SER 87 83 83 SER SER A . n
A 1 88 LEU 88 84 84 LEU LEU A . n
A 1 89 VAL 89 85 85 VAL VAL A . n
A 1 90 LYS 90 86 86 LYS LYS A . n
A 1 91 TRP 91 87 87 TRP TRP A . n
A 1 92 GLU 92 88 88 GLU GLU A . n
A 1 93 SER 93 89 89 SER SER A . n
A 1 94 GLU 94 90 90 GLU GLU A . n
A 1 95 ASN 95 91 91 ASN ASN A . n
A 1 96 LYS 96 92 92 LYS LYS A . n
A 1 97 MET 97 93 93 MET MET A . n
A 1 98 VAL 98 94 94 VAL VAL A . n
A 1 99 CYS 99 95 95 CYS CYS A . n
A 1 100 GLU 100 96 96 GLU GLU A . n
A 1 101 GLN 101 97 97 GLN GLN A . n
A 1 102 LYS 102 98 98 LYS LYS A . n
A 1 103 LEU 103 99 99 LEU LEU A . n
A 1 104 LEU 104 100 100 LEU LEU A . n
A 1 105 LYS 105 101 101 LYS LYS A . n
A 1 106 GLY 106 102 102 GLY GLY A . n
A 1 107 GLU 107 103 103 GLU GLU A . n
A 1 108 GLY 108 104 104 GLY GLY A . n
A 1 109 PRO 109 105 105 PRO PRO A . n
A 1 110 LYS 110 106 106 LYS LYS A . n
A 1 111 THR 111 107 107 THR THR A . n
A 1 112 SER 112 108 108 SER SER A . n
A 1 113 TRP 113 109 109 TRP TRP A . n
A 1 114 THR 114 110 110 THR THR A . n
A 1 115 LYS 115 111 111 LYS LYS A . n
A 1 116 GLU 116 112 112 GLU GLU A . n
A 1 117 LEU 117 113 113 LEU LEU A . n
A 1 118 THR 118 114 114 THR THR A . n
A 1 119 ASN 119 115 115 ASN ASN A . n
A 1 120 ASP 120 116 116 ASP ASP A . n
A 1 121 GLY 121 117 117 GLY GLY A . n
A 1 122 GLU 122 118 118 GLU GLU A . n
A 1 123 LEU 123 119 119 LEU LEU A . n
A 1 124 ILE 124 120 120 ILE ILE A . n
A 1 125 LEU 125 121 121 LEU LEU A . n
A 1 126 THR 126 122 122 THR THR A . n
A 1 127 MET 127 123 123 MET MET A . n
A 1 128 THR 128 124 124 THR THR A . n
A 1 129 ALA 129 125 125 ALA ALA A . n
A 1 130 ASP 130 126 126 ASP ASP A . n
A 1 131 ASP 131 127 127 ASP ASP A . n
A 1 132 VAL 132 128 128 VAL VAL A . n
A 1 133 VAL 133 129 129 VAL VAL A . n
A 1 134 CYS 134 130 130 CYS CYS A . n
A 1 135 THR 135 131 131 THR THR A . n
A 1 136 GLN 136 132 132 GLN GLN A . n
A 1 137 VAL 137 133 133 VAL VAL A . n
A 1 138 PHE 138 134 134 PHE PHE A . n
A 1 139 VAL 139 135 135 VAL VAL A . n
A 1 140 ARG 140 136 136 ARG ARG A . n
A 1 141 GLU 141 137 137 GLU GLU A . n
#
_pdbx_entity_instance_feature.ordinal 1
_pdbx_entity_instance_feature.comp_id A1IQ0
_pdbx_entity_instance_feature.asym_id ?
_pdbx_entity_instance_feature.seq_num ?
_pdbx_entity_instance_feature.auth_comp_id A1IQ0
_pdbx_entity_instance_feature.auth_asym_id ?
_pdbx_entity_instance_feature.auth_seq_num ?
_pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION'
_pdbx_entity_instance_feature.details ?
#
loop_
_pdbx_nonpoly_scheme.asym_id
_pdbx_nonpoly_scheme.entity_id
_pdbx_nonpoly_scheme.mon_id
_pdbx_nonpoly_scheme.ndb_seq_num
_pdbx_nonpoly_scheme.pdb_seq_num
_pdbx_nonpoly_scheme.auth_seq_num
_pdbx_nonpoly_scheme.pdb_mon_id
_pdbx_nonpoly_scheme.auth_mon_id
_pdbx_nonpoly_scheme.pdb_strand_id
_pdbx_nonpoly_scheme.pdb_ins_code
B 2 A1IQ0 1 201 202 A1IQ0 0PT A .
C 3 HOH 1 301 4 HOH HOH A .
C 3 HOH 2 302 6 HOH HOH A .
#
loop_
_pdbx_unobs_or_zero_occ_atoms.id
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num
_pdbx_unobs_or_zero_occ_atoms.polymer_flag
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id
_pdbx_unobs_or_zero_occ_atoms.label_alt_id
_pdbx_unobs_or_zero_occ_atoms.label_asym_id
_pdbx_unobs_or_zero_occ_atoms.label_comp_id
_pdbx_unobs_or_zero_occ_atoms.label_seq_id
_pdbx_unobs_or_zero_occ_atoms.label_atom_id
1 1 Y 1 A LYS 8 ? CG ? A LYS 12 CG
2 1 Y 1 A LYS 8 ? CD ? A LYS 12 CD
3 1 Y 1 A LYS 8 ? CE ? A LYS 12 CE
4 1 Y 1 A LYS 8 ? NZ ? A LYS 12 NZ
5 1 Y 1 A ARG 11 ? CD ? A ARG 15 CD
6 1 Y 1 A ARG 11 ? NE ? A ARG 15 NE
7 1 Y 1 A ARG 11 ? CZ ? A ARG 15 CZ
8 1 Y 1 A ARG 11 ? NH1 ? A ARG 15 NH1
9 1 Y 1 A ARG 11 ? NH2 ? A ARG 15 NH2
10 1 Y 1 A GLU 13 ? CG ? A GLU 17 CG
11 1 Y 1 A GLU 13 ? CD ? A GLU 17 CD
12 1 Y 1 A GLU 13 ? OE1 ? A GLU 17 OE1
13 1 Y 1 A GLU 13 ? OE2 ? A GLU 17 OE2
14 1 Y 1 A LYS 20 ? CE ? A LYS 24 CE
15 1 Y 1 A LYS 20 ? NZ ? A LYS 24 NZ
16 1 Y 1 A LYS 38 ? CG ? A LYS 42 CG
17 1 Y 1 A LYS 38 ? CD ? A LYS 42 CD
18 1 Y 1 A LYS 38 ? CE ? A LYS 42 CE
19 1 Y 1 A LYS 38 ? NZ ? A LYS 42 NZ
20 1 Y 1 A LYS 44 ? CG ? A LYS 48 CG
21 1 Y 1 A LYS 44 ? CD ? A LYS 48 CD
22 1 Y 1 A LYS 44 ? CE ? A LYS 48 CE
23 1 Y 1 A LYS 44 ? NZ ? A LYS 48 NZ
24 1 Y 1 A GLU 46 ? CG ? A GLU 50 CG
25 1 Y 1 A GLU 46 ? CD ? A GLU 50 CD
26 1 Y 1 A GLU 46 ? OE1 ? A GLU 50 OE1
27 1 Y 1 A GLU 46 ? OE2 ? A GLU 50 OE2
28 1 Y 1 A LYS 53 ? CE ? A LYS 57 CE
29 1 Y 1 A LYS 53 ? NZ ? A LYS 57 NZ
30 1 Y 1 A LYS 66 ? CD ? A LYS 70 CD
31 1 Y 1 A LYS 66 ? CE ? A LYS 70 CE
32 1 Y 1 A LYS 66 ? NZ ? A LYS 70 NZ
33 1 Y 1 A GLU 70 ? CD ? A GLU 74 CD
34 1 Y 1 A GLU 70 ? OE1 ? A GLU 74 OE1
35 1 Y 1 A GLU 70 ? OE2 ? A GLU 74 OE2
36 1 Y 1 A GLN 74 ? CD ? A GLN 78 CD
37 1 Y 1 A GLN 74 ? OE1 ? A GLN 78 OE1
38 1 Y 1 A GLN 74 ? NE2 ? A GLN 78 NE2
39 1 Y 1 A ARG 79 ? NE ? A ARG 83 NE
40 1 Y 1 A ARG 79 ? CZ ? A ARG 83 CZ
41 1 Y 1 A ARG 79 ? NH1 ? A ARG 83 NH1
42 1 Y 1 A ARG 79 ? NH2 ? A ARG 83 NH2
43 1 Y 1 A LYS 82 ? CD ? A LYS 86 CD
44 1 Y 1 A LYS 82 ? CE ? A LYS 86 CE
45 1 Y 1 A LYS 82 ? NZ ? A LYS 86 NZ
46 1 Y 1 A LYS 86 ? CD ? A LYS 90 CD
47 1 Y 1 A LYS 86 ? CE ? A LYS 90 CE
48 1 Y 1 A LYS 86 ? NZ ? A LYS 90 NZ
49 1 Y 1 A GLU 88 ? CD ? A GLU 92 CD
50 1 Y 1 A GLU 88 ? OE1 ? A GLU 92 OE1
51 1 Y 1 A GLU 88 ? OE2 ? A GLU 92 OE2
52 1 Y 1 A LYS 92 ? CD ? A LYS 96 CD
53 1 Y 1 A LYS 92 ? CE ? A LYS 96 CE
54 1 Y 1 A LYS 92 ? NZ ? A LYS 96 NZ
55 1 Y 1 A GLU 96 ? CG ? A GLU 100 CG
56 1 Y 1 A GLU 96 ? CD ? A GLU 100 CD
57 1 Y 1 A GLU 96 ? OE1 ? A GLU 100 OE1
58 1 Y 1 A GLU 96 ? OE2 ? A GLU 100 OE2
59 1 Y 1 A LYS 98 ? CG ? A LYS 102 CG
60 1 Y 1 A LYS 98 ? CD ? A LYS 102 CD
61 1 Y 1 A LYS 98 ? CE ? A LYS 102 CE
62 1 Y 1 A LYS 98 ? NZ ? A LYS 102 NZ
63 1 Y 1 A LYS 101 ? CG ? A LYS 105 CG
64 1 Y 1 A LYS 101 ? CD ? A LYS 105 CD
65 1 Y 1 A LYS 101 ? CE ? A LYS 105 CE
66 1 Y 1 A LYS 101 ? NZ ? A LYS 105 NZ
67 1 Y 1 A GLU 103 ? CG ? A GLU 107 CG
68 1 Y 1 A GLU 103 ? CD ? A GLU 107 CD
69 1 Y 1 A GLU 103 ? OE1 ? A GLU 107 OE1
70 1 Y 1 A GLU 103 ? OE2 ? A GLU 107 OE2
71 1 Y 1 A LYS 106 ? CD ? A LYS 110 CD
72 1 Y 1 A LYS 106 ? CE ? A LYS 110 CE
73 1 Y 1 A LYS 106 ? NZ ? A LYS 110 NZ
74 1 Y 1 A ASP 127 ? CG ? A ASP 131 CG
75 1 Y 1 A ASP 127 ? OD1 ? A ASP 131 OD1
76 1 Y 1 A ASP 127 ? OD2 ? A ASP 131 OD2
77 1 Y 1 A GLU 137 ? CG ? A GLU 141 CG
78 1 Y 1 A GLU 137 ? CD ? A GLU 141 CD
79 1 Y 1 A GLU 137 ? OE1 ? A GLU 141 OE1
80 1 Y 1 A GLU 137 ? OE2 ? A GLU 141 OE2
81 1 N 1 A A1IQ0 201 ? C1 ? B A1IQ0 1 C1
82 1 N 1 A A1IQ0 201 ? C2 ? B A1IQ0 1 C2
83 1 N 1 A A1IQ0 201 ? C3 ? B A1IQ0 1 C3
#
loop_
_software.citation_id
_software.classification
_software.compiler_name
_software.compiler_version
_software.contact_author
_software.contact_author_email
_software.date
_software.description
_software.dependencies
_software.hardware
_software.language
_software.location
_software.mods
_software.name
_software.os
_software.os_version
_software.type
_software.version
_software.pdbx_ordinal
? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3
? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4
#
_cell.angle_alpha 90.00
_cell.angle_alpha_esd ?
_cell.angle_beta 90.00
_cell.angle_beta_esd ?
_cell.angle_gamma 120.00
_cell.angle_gamma_esd ?
_cell.entry_id 9GVZ
_cell.details ?
_cell.formula_units_Z ?
_cell.length_a 57.554
_cell.length_a_esd ?
_cell.length_b 57.554
_cell.length_b_esd ?
_cell.length_c 101.742
_cell.length_c_esd ?
_cell.volume ?
_cell.volume_esd ?
_cell.Z_PDB 6
_cell.reciprocal_angle_alpha ?
_cell.reciprocal_angle_beta ?
_cell.reciprocal_angle_gamma ?
_cell.reciprocal_angle_alpha_esd ?
_cell.reciprocal_angle_beta_esd ?
_cell.reciprocal_angle_gamma_esd ?
_cell.reciprocal_length_a ?
_cell.reciprocal_length_b ?
_cell.reciprocal_length_c ?
_cell.reciprocal_length_a_esd ?
_cell.reciprocal_length_b_esd ?
_cell.reciprocal_length_c_esd ?
_cell.pdbx_unique_axis ?
_cell.pdbx_esd_method ?
#
_symmetry.entry_id 9GVZ
_symmetry.cell_setting ?
_symmetry.Int_Tables_number 152
_symmetry.space_group_name_Hall ?
_symmetry.space_group_name_H-M 'P 31 2 1'
_symmetry.pdbx_full_space_group_name_H-M ?
#
_exptl.absorpt_coefficient_mu ?
_exptl.absorpt_correction_T_max ?
_exptl.absorpt_correction_T_min ?
_exptl.absorpt_correction_type ?
_exptl.absorpt_process_details ?
_exptl.entry_id 9GVZ
_exptl.crystals_number 1
_exptl.details ?
_exptl.method 'X-RAY DIFFRACTION'
_exptl.method_details ?
#
_exptl_crystal.colour ?
_exptl_crystal.density_diffrn ?
_exptl_crystal.density_Matthews 3.13
_exptl_crystal.density_method ?
_exptl_crystal.density_percent_sol 60.77
_exptl_crystal.description ?
_exptl_crystal.F_000 ?
_exptl_crystal.id 1
_exptl_crystal.preparation ?
_exptl_crystal.size_max ?
_exptl_crystal.size_mid ?
_exptl_crystal.size_min ?
_exptl_crystal.size_rad ?
_exptl_crystal.colour_lustre ?
_exptl_crystal.colour_modifier ?
_exptl_crystal.colour_primary ?
_exptl_crystal.density_meas ?
_exptl_crystal.density_meas_esd ?
_exptl_crystal.density_meas_gt ?
_exptl_crystal.density_meas_lt ?
_exptl_crystal.density_meas_temp ?
_exptl_crystal.density_meas_temp_esd ?
_exptl_crystal.density_meas_temp_gt ?
_exptl_crystal.density_meas_temp_lt ?
_exptl_crystal.pdbx_crystal_image_url ?
_exptl_crystal.pdbx_crystal_image_format ?
_exptl_crystal.pdbx_mosaicity ?
_exptl_crystal.pdbx_mosaicity_esd ?
_exptl_crystal.pdbx_mosaic_method ?
_exptl_crystal.pdbx_mosaic_block_size ?
_exptl_crystal.pdbx_mosaic_block_size_esd ?
#
_exptl_crystal_grow.apparatus ?
_exptl_crystal_grow.atmosphere ?
_exptl_crystal_grow.crystal_id 1
_exptl_crystal_grow.details ?
_exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP'
_exptl_crystal_grow.method_ref ?
_exptl_crystal_grow.pH ?
_exptl_crystal_grow.pressure ?
_exptl_crystal_grow.pressure_esd ?
_exptl_crystal_grow.seeding ?
_exptl_crystal_grow.seeding_ref ?
_exptl_crystal_grow.temp_details ?
_exptl_crystal_grow.temp_esd ?
_exptl_crystal_grow.time ?
_exptl_crystal_grow.pdbx_details '0.2 M sodium malonate pH 7 and 20% w/v polyethylene glycol 3.350'
_exptl_crystal_grow.pdbx_pH_range 7.0
_exptl_crystal_grow.temp 281
#
_diffrn.ambient_environment ?
_diffrn.ambient_temp 100
_diffrn.ambient_temp_details ?
_diffrn.ambient_temp_esd ?
_diffrn.crystal_id 1
_diffrn.crystal_support ?
_diffrn.crystal_treatment ?
_diffrn.details ?
_diffrn.id 1
_diffrn.ambient_pressure ?
_diffrn.ambient_pressure_esd ?
_diffrn.ambient_pressure_gt ?
_diffrn.ambient_pressure_lt ?
_diffrn.ambient_temp_gt ?
_diffrn.ambient_temp_lt ?
_diffrn.pdbx_serial_crystal_experiment N
#
_diffrn_detector.details ?
_diffrn_detector.detector PIXEL
_diffrn_detector.diffrn_id 1
_diffrn_detector.type 'DECTRIS EIGER2 XE 16M'
_diffrn_detector.area_resol_mean ?
_diffrn_detector.dtime ?
_diffrn_detector.pdbx_frames_total ?
_diffrn_detector.pdbx_collection_time_total ?
_diffrn_detector.pdbx_collection_date 2022-02-09
_diffrn_detector.pdbx_frequency ?
_diffrn_detector.id ?
_diffrn_detector.number_of_axes ?
#
_diffrn_radiation.collimation ?
_diffrn_radiation.diffrn_id 1
_diffrn_radiation.filter_edge ?
_diffrn_radiation.inhomogeneity ?
_diffrn_radiation.monochromator 'Si(111)'
_diffrn_radiation.polarisn_norm ?
_diffrn_radiation.polarisn_ratio ?
_diffrn_radiation.probe ?
_diffrn_radiation.type ?
_diffrn_radiation.xray_symbol ?
_diffrn_radiation.wavelength_id 1
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l M
_diffrn_radiation.pdbx_wavelength_list ?
_diffrn_radiation.pdbx_wavelength ?
_diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH'
_diffrn_radiation.pdbx_analyzer ?
_diffrn_radiation.pdbx_scattering_type x-ray
#
_diffrn_radiation_wavelength.id 1
_diffrn_radiation_wavelength.wavelength 0.97949
_diffrn_radiation_wavelength.wt 1.0
#
_diffrn_source.current ?
_diffrn_source.details ?
_diffrn_source.diffrn_id 1
_diffrn_source.power ?
_diffrn_source.size ?
_diffrn_source.source SYNCHROTRON
_diffrn_source.target ?
_diffrn_source.type 'DIAMOND BEAMLINE I04'
_diffrn_source.voltage ?
_diffrn_source.take-off_angle ?
_diffrn_source.pdbx_wavelength_list 0.97949
_diffrn_source.pdbx_wavelength ?
_diffrn_source.pdbx_synchrotron_beamline I04
_diffrn_source.pdbx_synchrotron_site Diamond
#
_reflns.B_iso_Wilson_estimate 63.0
_reflns.entry_id 9GVZ
_reflns.data_reduction_details ?
_reflns.data_reduction_method ?
_reflns.d_resolution_high 3.00
_reflns.d_resolution_low 49.84
_reflns.details ?
_reflns.limit_h_max ?
_reflns.limit_h_min ?
_reflns.limit_k_max ?
_reflns.limit_k_min ?
_reflns.limit_l_max ?
_reflns.limit_l_min ?
_reflns.number_all ?
_reflns.number_obs 4162
_reflns.observed_criterion ?
_reflns.observed_criterion_F_max ?
_reflns.observed_criterion_F_min ?
_reflns.observed_criterion_I_max ?
_reflns.observed_criterion_I_min ?
_reflns.observed_criterion_sigma_F ?
_reflns.observed_criterion_sigma_I ?
_reflns.percent_possible_obs 99.5
_reflns.R_free_details ?
_reflns.Rmerge_F_all ?
_reflns.Rmerge_F_obs ?
_reflns.Friedel_coverage ?
_reflns.number_gt ?
_reflns.threshold_expression ?
_reflns.pdbx_redundancy 6.4
_reflns.pdbx_netI_over_av_sigmaI ?
_reflns.pdbx_netI_over_sigmaI 9.0
_reflns.pdbx_res_netI_over_av_sigmaI_2 ?
_reflns.pdbx_res_netI_over_sigmaI_2 ?
_reflns.pdbx_chi_squared ?
_reflns.pdbx_scaling_rejects ?
_reflns.pdbx_d_res_high_opt ?
_reflns.pdbx_d_res_low_opt ?
_reflns.pdbx_d_res_opt_method ?
_reflns.phase_calculation_details ?
_reflns.pdbx_Rrim_I_all 0.131
_reflns.pdbx_Rpim_I_all 0.051
_reflns.pdbx_d_opt ?
_reflns.pdbx_number_measured_all ?
_reflns.pdbx_diffrn_id 1
_reflns.pdbx_ordinal 1
_reflns.pdbx_CC_half 0.997
_reflns.pdbx_CC_star ?
_reflns.pdbx_R_split ?
_reflns.pdbx_Rmerge_I_obs 0.120
_reflns.pdbx_Rmerge_I_all ?
_reflns.pdbx_Rsym_value ?
_reflns.pdbx_CC_split_method ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ?
_reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ?
_reflns.pdbx_aniso_diffraction_limit_1 ?
_reflns.pdbx_aniso_diffraction_limit_2 ?
_reflns.pdbx_aniso_diffraction_limit_3 ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ?
_reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_1 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_2 ?
_reflns.pdbx_aniso_B_tensor_eigenvalue_3 ?
_reflns.pdbx_orthogonalization_convention ?
_reflns.pdbx_percent_possible_ellipsoidal ?
_reflns.pdbx_percent_possible_spherical ?
_reflns.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns.pdbx_percent_possible_spherical_anomalous ?
_reflns.pdbx_redundancy_anomalous ?
_reflns.pdbx_CC_half_anomalous ?
_reflns.pdbx_absDiff_over_sigma_anomalous ?
_reflns.pdbx_percent_possible_anomalous ?
_reflns.pdbx_observed_signal_threshold ?
_reflns.pdbx_signal_type ?
_reflns.pdbx_signal_details ?
_reflns.pdbx_signal_software_id ?
#
_reflns_shell.d_res_high 3.00
_reflns_shell.d_res_low 3.16
_reflns_shell.meanI_over_sigI_all ?
_reflns_shell.meanI_over_sigI_obs 1.8
_reflns_shell.number_measured_all ?
_reflns_shell.number_measured_obs ?
_reflns_shell.number_possible ?
_reflns_shell.number_unique_all ?
_reflns_shell.number_unique_obs 591
_reflns_shell.percent_possible_obs ?
_reflns_shell.Rmerge_F_all ?
_reflns_shell.Rmerge_F_obs ?
_reflns_shell.meanI_over_sigI_gt ?
_reflns_shell.meanI_over_uI_all ?
_reflns_shell.meanI_over_uI_gt ?
_reflns_shell.number_measured_gt ?
_reflns_shell.number_unique_gt ?
_reflns_shell.percent_possible_gt ?
_reflns_shell.Rmerge_F_gt ?
_reflns_shell.Rmerge_I_gt ?
_reflns_shell.pdbx_redundancy 6.5
_reflns_shell.pdbx_chi_squared ?
_reflns_shell.pdbx_netI_over_sigmaI_all ?
_reflns_shell.pdbx_netI_over_sigmaI_obs ?
_reflns_shell.pdbx_Rrim_I_all 1.128
_reflns_shell.pdbx_Rpim_I_all 0.430
_reflns_shell.pdbx_rejects ?
_reflns_shell.pdbx_ordinal 1
_reflns_shell.pdbx_diffrn_id 1
_reflns_shell.pdbx_CC_half 0.679
_reflns_shell.pdbx_CC_star ?
_reflns_shell.pdbx_R_split ?
_reflns_shell.percent_possible_all 99.8
_reflns_shell.Rmerge_I_all ?
_reflns_shell.Rmerge_I_obs 1.038
_reflns_shell.pdbx_Rsym_value ?
_reflns_shell.pdbx_percent_possible_ellipsoidal ?
_reflns_shell.pdbx_percent_possible_spherical ?
_reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ?
_reflns_shell.pdbx_percent_possible_spherical_anomalous ?
_reflns_shell.pdbx_redundancy_anomalous ?
_reflns_shell.pdbx_CC_half_anomalous ?
_reflns_shell.pdbx_absDiff_over_sigma_anomalous ?
_reflns_shell.pdbx_percent_possible_anomalous ?
#
_refine.aniso_B[1][1] -0.01
_refine.aniso_B[1][2] -0.00
_refine.aniso_B[1][3] -0.00
_refine.aniso_B[2][2] -0.01
_refine.aniso_B[2][3] 0.00
_refine.aniso_B[3][3] 0.02
_refine.B_iso_max ?
_refine.B_iso_mean 70.00
_refine.B_iso_min ?
_refine.correlation_coeff_Fo_to_Fc 0.935
_refine.correlation_coeff_Fo_to_Fc_free 0.902
_refine.details ?
_refine.diff_density_max ?
_refine.diff_density_max_esd ?
_refine.diff_density_min ?
_refine.diff_density_min_esd ?
_refine.diff_density_rms ?
_refine.diff_density_rms_esd ?
_refine.entry_id 9GVZ
_refine.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine.ls_abs_structure_details ?
_refine.ls_abs_structure_Flack ?
_refine.ls_abs_structure_Flack_esd ?
_refine.ls_abs_structure_Rogers ?
_refine.ls_abs_structure_Rogers_esd ?
_refine.ls_d_res_high 3.00
_refine.ls_d_res_low 44.80
_refine.ls_extinction_coef ?
_refine.ls_extinction_coef_esd ?
_refine.ls_extinction_expression ?
_refine.ls_extinction_method ?
_refine.ls_goodness_of_fit_all ?
_refine.ls_goodness_of_fit_all_esd ?
_refine.ls_goodness_of_fit_obs ?
_refine.ls_goodness_of_fit_obs_esd ?
_refine.ls_hydrogen_treatment ?
_refine.ls_matrix_type ?
_refine.ls_number_constraints ?
_refine.ls_number_parameters ?
_refine.ls_number_reflns_all ?
_refine.ls_number_reflns_obs 3962
_refine.ls_number_reflns_R_free 200
_refine.ls_number_reflns_R_work ?
_refine.ls_number_restraints ?
_refine.ls_percent_reflns_obs 99.07
_refine.ls_percent_reflns_R_free 4.8
_refine.ls_R_factor_all ?
_refine.ls_R_factor_obs 0.21364
_refine.ls_R_factor_R_free 0.27080
_refine.ls_R_factor_R_free_error ?
_refine.ls_R_factor_R_free_error_details ?
_refine.ls_R_factor_R_work 0.21002
_refine.ls_R_Fsqd_factor_obs ?
_refine.ls_R_I_factor_obs ?
_refine.ls_redundancy_reflns_all ?
_refine.ls_redundancy_reflns_obs ?
_refine.ls_restrained_S_all ?
_refine.ls_restrained_S_obs ?
_refine.ls_shift_over_esd_max ?
_refine.ls_shift_over_esd_mean ?
_refine.ls_structure_factor_coef ?
_refine.ls_weighting_details ?
_refine.ls_weighting_scheme ?
_refine.ls_wR_factor_all ?
_refine.ls_wR_factor_obs ?
_refine.ls_wR_factor_R_free ?
_refine.ls_wR_factor_R_work ?
_refine.occupancy_max ?
_refine.occupancy_min ?
_refine.solvent_model_details MASK
_refine.solvent_model_param_bsol ?
_refine.solvent_model_param_ksol ?
_refine.pdbx_R_complete ?
_refine.ls_R_factor_gt ?
_refine.ls_goodness_of_fit_gt ?
_refine.ls_goodness_of_fit_ref ?
_refine.ls_shift_over_su_max ?
_refine.ls_shift_over_su_max_lt ?
_refine.ls_shift_over_su_mean ?
_refine.ls_shift_over_su_mean_lt ?
_refine.pdbx_ls_sigma_I ?
_refine.pdbx_ls_sigma_F ?
_refine.pdbx_ls_sigma_Fsqd ?
_refine.pdbx_data_cutoff_high_absF ?
_refine.pdbx_data_cutoff_high_rms_absF ?
_refine.pdbx_data_cutoff_low_absF ?
_refine.pdbx_isotropic_thermal_model ?
_refine.pdbx_ls_cross_valid_method THROUGHOUT
_refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT'
_refine.pdbx_starting_model ?
_refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD'
_refine.pdbx_R_Free_selection_details RANDOM
_refine.pdbx_stereochem_target_val_spec_case ?
_refine.pdbx_overall_ESU_R ?
_refine.pdbx_overall_ESU_R_Free 0.425
_refine.pdbx_solvent_vdw_probe_radii 1.20
_refine.pdbx_solvent_ion_probe_radii 0.80
_refine.pdbx_solvent_shrinkage_radii 0.80
_refine.pdbx_real_space_R ?
_refine.pdbx_density_correlation ?
_refine.pdbx_pd_number_of_powder_patterns ?
_refine.pdbx_pd_number_of_points ?
_refine.pdbx_pd_meas_number_of_points ?
_refine.pdbx_pd_proc_ls_prof_R_factor ?
_refine.pdbx_pd_proc_ls_prof_wR_factor ?
_refine.pdbx_pd_Marquardt_correlation_coeff ?
_refine.pdbx_pd_Fsqrd_R_factor ?
_refine.pdbx_pd_ls_matrix_band_width ?
_refine.pdbx_overall_phase_error ?
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI ?
_refine.pdbx_overall_SU_R_free_Blow_DPI ?
_refine.pdbx_overall_SU_R_Blow_DPI ?
_refine.pdbx_TLS_residual_ADP_flag ?
_refine.pdbx_diffrn_id 1
_refine.overall_SU_B 21.053
_refine.overall_SU_ML 0.377
_refine.overall_SU_R_Cruickshank_DPI ?
_refine.overall_SU_R_free ?
_refine.overall_FOM_free_R_set ?
_refine.overall_FOM_work_R_set ?
_refine.pdbx_average_fsc_overall ?
_refine.pdbx_average_fsc_work ?
_refine.pdbx_average_fsc_free ?
#
_refine_analyze.entry_id 9GVZ
_refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_analyze.Luzzati_coordinate_error_free ?
_refine_analyze.Luzzati_coordinate_error_obs 0.4011
_refine_analyze.Luzzati_d_res_low_free ?
_refine_analyze.Luzzati_d_res_low_obs ?
_refine_analyze.Luzzati_sigma_a_free ?
_refine_analyze.Luzzati_sigma_a_free_details ?
_refine_analyze.Luzzati_sigma_a_obs ?
_refine_analyze.Luzzati_sigma_a_obs_details ?
_refine_analyze.number_disordered_residues ?
_refine_analyze.occupancy_sum_hydrogen ?
_refine_analyze.occupancy_sum_non_hydrogen ?
_refine_analyze.RG_d_res_high ?
_refine_analyze.RG_d_res_low ?
_refine_analyze.RG_free ?
_refine_analyze.RG_work ?
_refine_analyze.RG_free_work_ratio ?
_refine_analyze.pdbx_Luzzati_d_res_high_obs ?
#
_refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_hist.cycle_id 1
_refine_hist.details ?
_refine_hist.d_res_high 3.00
_refine_hist.d_res_low 44.80
_refine_hist.number_atoms_solvent 2
_refine_hist.number_atoms_total 1040
_refine_hist.number_reflns_all ?
_refine_hist.number_reflns_obs ?
_refine_hist.number_reflns_R_free ?
_refine_hist.number_reflns_R_work ?
_refine_hist.R_factor_all ?
_refine_hist.R_factor_obs ?
_refine_hist.R_factor_R_free ?
_refine_hist.R_factor_R_work ?
_refine_hist.pdbx_number_residues_total ?
_refine_hist.pdbx_B_iso_mean_ligand ?
_refine_hist.pdbx_B_iso_mean_solvent ?
_refine_hist.pdbx_number_atoms_protein 1020
_refine_hist.pdbx_number_atoms_nucleic_acid 0
_refine_hist.pdbx_number_atoms_ligand 18
_refine_hist.pdbx_number_atoms_lipid ?
_refine_hist.pdbx_number_atoms_carb ?
_refine_hist.pdbx_pseudo_atom_details ?
#
loop_
_refine_ls_restr.pdbx_refine_id
_refine_ls_restr.criterion
_refine_ls_restr.dev_ideal
_refine_ls_restr.dev_ideal_target
_refine_ls_restr.number
_refine_ls_restr.rejects
_refine_ls_restr.type
_refine_ls_restr.weight
_refine_ls_restr.pdbx_restraint_function
'X-RAY DIFFRACTION' ? 0.005 0.012 1062 ? r_bond_refined_d ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_bond_other_d ? ?
'X-RAY DIFFRACTION' ? 1.503 1.653 1450 ? r_angle_refined_deg ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_angle_other_deg ? ?
'X-RAY DIFFRACTION' ? 7.458 5.000 139 ? r_dihedral_angle_1_deg ? ?
'X-RAY DIFFRACTION' ? 40.647 25.122 41 ? r_dihedral_angle_2_deg ? ?
'X-RAY DIFFRACTION' ? 21.703 15.000 159 ? r_dihedral_angle_3_deg ? ?
'X-RAY DIFFRACTION' ? 15.767 15.000 2 ? r_dihedral_angle_4_deg ? ?
'X-RAY DIFFRACTION' ? 0.104 0.200 150 ? r_chiral_restr ? ?
'X-RAY DIFFRACTION' ? 0.006 0.020 795 ? r_gen_planes_refined ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_gen_planes_other ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ?
'X-RAY DIFFRACTION' ? 5.420 7.618 553 ? r_mcbond_it ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_other ? ?
'X-RAY DIFFRACTION' ? 8.101 11.413 690 ? r_mcangle_it ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_other ? ?
'X-RAY DIFFRACTION' ? 6.819 7.732 509 ? r_scbond_it ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_other ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_other ? ?
'X-RAY DIFFRACTION' ? 11.308 ? 1604 ? r_long_range_B_refined ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_other ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ?
'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ?
#
_refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION'
_refine_ls_shell.d_res_high 3.000
_refine_ls_shell.d_res_low 3.078
_refine_ls_shell.number_reflns_all ?
_refine_ls_shell.number_reflns_obs ?
_refine_ls_shell.number_reflns_R_free 22
_refine_ls_shell.number_reflns_R_work 268
_refine_ls_shell.percent_reflns_obs 99.32
_refine_ls_shell.percent_reflns_R_free ?
_refine_ls_shell.R_factor_all ?
_refine_ls_shell.R_factor_obs ?
_refine_ls_shell.R_factor_R_free_error ?
_refine_ls_shell.R_factor_R_work 0.282
_refine_ls_shell.redundancy_reflns_all ?
_refine_ls_shell.redundancy_reflns_obs ?
_refine_ls_shell.wR_factor_all ?
_refine_ls_shell.wR_factor_obs ?
_refine_ls_shell.wR_factor_R_free ?
_refine_ls_shell.wR_factor_R_work ?
_refine_ls_shell.pdbx_R_complete ?
_refine_ls_shell.pdbx_total_number_of_bins_used ?
_refine_ls_shell.pdbx_phase_error ?
_refine_ls_shell.pdbx_fsc_work ?
_refine_ls_shell.pdbx_fsc_free ?
_refine_ls_shell.R_factor_R_free 0.282
#
_struct.entry_id 9GVZ
_struct.title
'M2 mutant (R111K:Y134F:T54V:R132Q:P39Y:R59Y) of human cellular retinoic acid binding protein II - 1j conjugate'
_struct.pdbx_model_details ?
_struct.pdbx_formula_weight ?
_struct.pdbx_formula_weight_method ?
_struct.pdbx_model_type_details ?
_struct.pdbx_CASP_flag N
#
_struct_keywords.entry_id 9GVZ
_struct_keywords.text
'human cellular retinoic acid binding protein II, hCRABPII, conjugate, chromophore, M2, TRANSPORT PROTEIN'
_struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN'
#
loop_
_struct_asym.id
_struct_asym.pdbx_blank_PDB_chainid_flag
_struct_asym.pdbx_modified
_struct_asym.entity_id
_struct_asym.details
A N N 1 ?
B N N 2 ?
C N N 3 ?
#
_struct_ref.id 1
_struct_ref.db_name UNP
_struct_ref.db_code RABP2_HUMAN
_struct_ref.pdbx_db_accession P29373
_struct_ref.pdbx_db_isoform ?
_struct_ref.entity_id 1
_struct_ref.pdbx_seq_one_letter_code
;MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGR
PCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
;
_struct_ref.pdbx_align_begin 1
#
_struct_ref_seq.align_id 1
_struct_ref_seq.ref_id 1
_struct_ref_seq.pdbx_PDB_id_code 9GVZ
_struct_ref_seq.pdbx_strand_id A
_struct_ref_seq.seq_align_beg 4
_struct_ref_seq.pdbx_seq_align_beg_ins_code ?
_struct_ref_seq.seq_align_end 141
_struct_ref_seq.pdbx_seq_align_end_ins_code ?
_struct_ref_seq.pdbx_db_accession P29373
_struct_ref_seq.db_align_beg 1
_struct_ref_seq.pdbx_db_align_beg_ins_code ?
_struct_ref_seq.db_align_end 138
_struct_ref_seq.pdbx_db_align_end_ins_code ?
_struct_ref_seq.pdbx_auth_seq_align_beg 0
_struct_ref_seq.pdbx_auth_seq_align_end 137
#
loop_
_struct_ref_seq_dif.align_id
_struct_ref_seq_dif.pdbx_pdb_id_code
_struct_ref_seq_dif.mon_id
_struct_ref_seq_dif.pdbx_pdb_strand_id
_struct_ref_seq_dif.seq_num
_struct_ref_seq_dif.pdbx_pdb_ins_code
_struct_ref_seq_dif.pdbx_seq_db_name
_struct_ref_seq_dif.pdbx_seq_db_accession_code
_struct_ref_seq_dif.db_mon_id
_struct_ref_seq_dif.pdbx_seq_db_seq_num
_struct_ref_seq_dif.details
_struct_ref_seq_dif.pdbx_auth_seq_num
_struct_ref_seq_dif.pdbx_ordinal
1 9GVZ GLY A 1 ? UNP P29373 ? ? 'expression tag' -3 1
1 9GVZ SER A 2 ? UNP P29373 ? ? 'expression tag' -2 2
1 9GVZ HIS A 3 ? UNP P29373 ? ? 'expression tag' -1 3
1 9GVZ TYR A 43 ? UNP P29373 PRO 40 'engineered mutation' 39 4
1 9GVZ VAL A 58 ? UNP P29373 THR 55 'engineered mutation' 54 5
1 9GVZ TYR A 63 ? UNP P29373 ARG 60 'engineered mutation' 59 6
1 9GVZ LYS A 115 ? UNP P29373 ARG 112 'engineered mutation' 111 7
1 9GVZ GLN A 136 ? UNP P29373 ARG 133 'engineered mutation' 132 8
1 9GVZ PHE A 138 ? UNP P29373 TYR 135 'engineered mutation' 134 9
#
_pdbx_struct_assembly.id 1
_pdbx_struct_assembly.details author_and_software_defined_assembly
_pdbx_struct_assembly.method_details PISA
_pdbx_struct_assembly.oligomeric_details monomeric
_pdbx_struct_assembly.oligomeric_count 1
#
loop_
_pdbx_struct_assembly_prop.biol_id
_pdbx_struct_assembly_prop.type
_pdbx_struct_assembly_prop.value
_pdbx_struct_assembly_prop.details
1 'ABSA (A^2)' 0 ?
1 MORE 0 ?
1 'SSA (A^2)' 7260 ?
#
_pdbx_struct_assembly_gen.assembly_id 1
_pdbx_struct_assembly_gen.oper_expression 1
_pdbx_struct_assembly_gen.asym_id_list A,B,C
#
_pdbx_struct_assembly_auth_evidence.id 1
_pdbx_struct_assembly_auth_evidence.assembly_id 1
_pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration'
_pdbx_struct_assembly_auth_evidence.details ?
#
_pdbx_struct_oper_list.id 1
_pdbx_struct_oper_list.type 'identity operation'
_pdbx_struct_oper_list.name 1_555
_pdbx_struct_oper_list.symmetry_operation x,y,z
_pdbx_struct_oper_list.matrix[1][1] 1.0000000000
_pdbx_struct_oper_list.matrix[1][2] 0.0000000000
_pdbx_struct_oper_list.matrix[1][3] 0.0000000000
_pdbx_struct_oper_list.vector[1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][1] 0.0000000000
_pdbx_struct_oper_list.matrix[2][2] 1.0000000000
_pdbx_struct_oper_list.matrix[2][3] 0.0000000000
_pdbx_struct_oper_list.vector[2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][1] 0.0000000000
_pdbx_struct_oper_list.matrix[3][2] 0.0000000000
_pdbx_struct_oper_list.matrix[3][3] 1.0000000000
_pdbx_struct_oper_list.vector[3] 0.0000000000
#
loop_
_struct_conf.conf_type_id
_struct_conf.id
_struct_conf.pdbx_PDB_helix_id
_struct_conf.beg_label_comp_id
_struct_conf.beg_label_asym_id
_struct_conf.beg_label_seq_id
_struct_conf.pdbx_beg_PDB_ins_code
_struct_conf.end_label_comp_id
_struct_conf.end_label_asym_id
_struct_conf.end_label_seq_id
_struct_conf.pdbx_end_PDB_ins_code
_struct_conf.beg_auth_comp_id
_struct_conf.beg_auth_asym_id
_struct_conf.beg_auth_seq_id
_struct_conf.end_auth_comp_id
_struct_conf.end_auth_asym_id
_struct_conf.end_auth_seq_id
_struct_conf.pdbx_PDB_helix_class
_struct_conf.details
_struct_conf.pdbx_PDB_helix_length
HELX_P HELX_P1 AA1 ASN A 18 ? LEU A 26 ? ASN A 14 LEU A 22 1 ? 9
HELX_P HELX_P2 AA2 ASN A 29 ? ALA A 40 ? ASN A 25 ALA A 36 1 ? 12
#
_struct_conf_type.id HELX_P
_struct_conf_type.criteria ?
_struct_conf_type.reference ?
#
_struct_conn.id covale1
_struct_conn.conn_type_id covale
_struct_conn.pdbx_leaving_atom_flag none
_struct_conn.pdbx_PDB_id ?
_struct_conn.ptnr1_label_asym_id A
_struct_conn.ptnr1_label_comp_id LYS
_struct_conn.ptnr1_label_seq_id 115
_struct_conn.ptnr1_label_atom_id NZ
_struct_conn.pdbx_ptnr1_label_alt_id ?
_struct_conn.pdbx_ptnr1_PDB_ins_code ?
_struct_conn.pdbx_ptnr1_standard_comp_id ?
_struct_conn.ptnr1_symmetry 1_555
_struct_conn.ptnr2_label_asym_id B
_struct_conn.ptnr2_label_comp_id A1IQ0
_struct_conn.ptnr2_label_seq_id .
_struct_conn.ptnr2_label_atom_id CAQ
_struct_conn.pdbx_ptnr2_label_alt_id ?
_struct_conn.pdbx_ptnr2_PDB_ins_code ?
_struct_conn.ptnr1_auth_asym_id A
_struct_conn.ptnr1_auth_comp_id LYS
_struct_conn.ptnr1_auth_seq_id 111
_struct_conn.ptnr2_auth_asym_id A
_struct_conn.ptnr2_auth_comp_id A1IQ0
_struct_conn.ptnr2_auth_seq_id 201
_struct_conn.ptnr2_symmetry 1_555
_struct_conn.pdbx_ptnr3_label_atom_id ?
_struct_conn.pdbx_ptnr3_label_seq_id ?
_struct_conn.pdbx_ptnr3_label_comp_id ?
_struct_conn.pdbx_ptnr3_label_asym_id ?
_struct_conn.pdbx_ptnr3_label_alt_id ?
_struct_conn.pdbx_ptnr3_PDB_ins_code ?
_struct_conn.details ?
_struct_conn.pdbx_dist_value 1.421
_struct_conn.pdbx_value_order ?
_struct_conn.pdbx_role ?
#
_struct_conn_type.id covale
_struct_conn_type.criteria ?
_struct_conn_type.reference ?
#
_pdbx_modification_feature.ordinal 1
_pdbx_modification_feature.label_comp_id A1IQ0
_pdbx_modification_feature.label_asym_id B
_pdbx_modification_feature.label_seq_id .
_pdbx_modification_feature.label_alt_id ?
_pdbx_modification_feature.modified_residue_label_comp_id LYS
_pdbx_modification_feature.modified_residue_label_asym_id A
_pdbx_modification_feature.modified_residue_label_seq_id 115
_pdbx_modification_feature.modified_residue_label_alt_id ?
_pdbx_modification_feature.auth_comp_id A1IQ0
_pdbx_modification_feature.auth_asym_id A
_pdbx_modification_feature.auth_seq_id 201
_pdbx_modification_feature.PDB_ins_code ?
_pdbx_modification_feature.symmetry 1_555
_pdbx_modification_feature.modified_residue_auth_comp_id LYS
_pdbx_modification_feature.modified_residue_auth_asym_id A
_pdbx_modification_feature.modified_residue_auth_seq_id 111
_pdbx_modification_feature.modified_residue_PDB_ins_code ?
_pdbx_modification_feature.modified_residue_symmetry 1_555
_pdbx_modification_feature.comp_id_linking_atom CAQ
_pdbx_modification_feature.modified_residue_id_linking_atom NZ
_pdbx_modification_feature.modified_residue_id LYS
_pdbx_modification_feature.ref_pcm_id 1
_pdbx_modification_feature.ref_comp_id A1IQ0
_pdbx_modification_feature.type None
_pdbx_modification_feature.category 'Covalent chemical modification'
#
_struct_sheet.id AA1
_struct_sheet.type ?
_struct_sheet.number_strands 10
_struct_sheet.details ?
#
loop_
_struct_sheet_order.sheet_id
_struct_sheet_order.range_id_1
_struct_sheet_order.range_id_2
_struct_sheet_order.offset
_struct_sheet_order.sense
AA1 1 2 ? anti-parallel
AA1 2 3 ? anti-parallel
AA1 3 4 ? anti-parallel
AA1 4 5 ? anti-parallel
AA1 5 6 ? anti-parallel
AA1 6 7 ? anti-parallel
AA1 7 8 ? anti-parallel
AA1 8 9 ? anti-parallel
AA1 9 10 ? anti-parallel
#
loop_
_struct_sheet_range.sheet_id
_struct_sheet_range.id
_struct_sheet_range.beg_label_comp_id
_struct_sheet_range.beg_label_asym_id
_struct_sheet_range.beg_label_seq_id
_struct_sheet_range.pdbx_beg_PDB_ins_code
_struct_sheet_range.end_label_comp_id
_struct_sheet_range.end_label_asym_id
_struct_sheet_range.end_label_seq_id
_struct_sheet_range.pdbx_end_PDB_ins_code
_struct_sheet_range.beg_auth_comp_id
_struct_sheet_range.beg_auth_asym_id
_struct_sheet_range.beg_auth_seq_id
_struct_sheet_range.end_auth_comp_id
_struct_sheet_range.end_auth_asym_id
_struct_sheet_range.end_auth_seq_id
AA1 1 THR A 64 ? LYS A 70 ? THR A 60 LYS A 66
AA1 2 THR A 53 ? SER A 59 ? THR A 49 SER A 55
AA1 3 ALA A 44 ? GLU A 50 ? ALA A 40 GLU A 46
AA1 4 GLY A 9 ? GLU A 17 ? GLY A 5 GLU A 13
AA1 5 VAL A 132 ? ARG A 140 ? VAL A 128 ARG A 136
AA1 6 GLU A 122 ? ALA A 129 ? GLU A 118 ALA A 125
AA1 7 THR A 111 ? LEU A 117 ? THR A 107 LEU A 113
AA1 8 LYS A 96 ? LEU A 103 ? LYS A 92 LEU A 99
AA1 9 PRO A 84 ? SER A 93 ? PRO A 80 SER A 89
AA1 10 PHE A 75 ? GLN A 78 ? PHE A 71 GLN A 74
#
loop_
_pdbx_struct_sheet_hbond.sheet_id
_pdbx_struct_sheet_hbond.range_id_1
_pdbx_struct_sheet_hbond.range_id_2
_pdbx_struct_sheet_hbond.range_1_label_atom_id
_pdbx_struct_sheet_hbond.range_1_label_comp_id
_pdbx_struct_sheet_hbond.range_1_label_asym_id
_pdbx_struct_sheet_hbond.range_1_label_seq_id
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code
_pdbx_struct_sheet_hbond.range_1_auth_atom_id
_pdbx_struct_sheet_hbond.range_1_auth_comp_id
_pdbx_struct_sheet_hbond.range_1_auth_asym_id
_pdbx_struct_sheet_hbond.range_1_auth_seq_id
_pdbx_struct_sheet_hbond.range_2_label_atom_id
_pdbx_struct_sheet_hbond.range_2_label_comp_id
_pdbx_struct_sheet_hbond.range_2_label_asym_id
_pdbx_struct_sheet_hbond.range_2_label_seq_id
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code
_pdbx_struct_sheet_hbond.range_2_auth_atom_id
_pdbx_struct_sheet_hbond.range_2_auth_comp_id
_pdbx_struct_sheet_hbond.range_2_auth_asym_id
_pdbx_struct_sheet_hbond.range_2_auth_seq_id
AA1 1 2 O PHE A 69 ? O PHE A 65 N PHE A 54 ? N PHE A 50
AA1 2 3 O TYR A 55 ? O TYR A 51 N LYS A 48 ? N LYS A 44
AA1 3 4 O ILE A 47 ? O ILE A 43 N GLY A 9 ? N GLY A 5
AA1 4 5 N ILE A 14 ? N ILE A 10 O VAL A 137 ? O VAL A 133
AA1 5 6 O GLN A 136 ? O GLN A 132 N LEU A 125 ? N LEU A 121
AA1 6 7 O ILE A 124 ? O ILE A 120 N GLU A 116 ? N GLU A 112
AA1 7 8 O LYS A 115 ? O LYS A 111 N MET A 97 ? N MET A 93
AA1 8 9 O LYS A 102 ? O LYS A 98 N LYS A 86 ? N LYS A 82
AA1 9 10 O SER A 87 ? O SER A 83 N PHE A 75 ? N PHE A 71
#
_pdbx_entry_details.entry_id 9GVZ
_pdbx_entry_details.has_ligand_of_interest Y
_pdbx_entry_details.compound_details ?
_pdbx_entry_details.source_details ?
_pdbx_entry_details.nonpolymer_details ?
_pdbx_entry_details.sequence_details ?
_pdbx_entry_details.has_protein_modification Y
#
loop_
_pdbx_validate_torsion.id
_pdbx_validate_torsion.PDB_model_num
_pdbx_validate_torsion.auth_comp_id
_pdbx_validate_torsion.auth_asym_id
_pdbx_validate_torsion.auth_seq_id
_pdbx_validate_torsion.PDB_ins_code
_pdbx_validate_torsion.label_alt_id
_pdbx_validate_torsion.phi
_pdbx_validate_torsion.psi
1 1 ASN A 14 ? ? 84.26 14.39
2 1 THR A 56 ? ? -118.99 -155.70
3 1 THR A 75 ? ? -69.62 -163.60
4 1 SER A 89 ? ? -168.58 -167.55
5 1 ASN A 91 ? ? -140.09 40.61
6 1 ASP A 126 ? ? 60.10 -123.65
#
loop_
_pdbx_unobs_or_zero_occ_residues.id
_pdbx_unobs_or_zero_occ_residues.PDB_model_num
_pdbx_unobs_or_zero_occ_residues.polymer_flag
_pdbx_unobs_or_zero_occ_residues.occupancy_flag
_pdbx_unobs_or_zero_occ_residues.auth_asym_id
_pdbx_unobs_or_zero_occ_residues.auth_comp_id
_pdbx_unobs_or_zero_occ_residues.auth_seq_id
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code
_pdbx_unobs_or_zero_occ_residues.label_asym_id
_pdbx_unobs_or_zero_occ_residues.label_comp_id
_pdbx_unobs_or_zero_occ_residues.label_seq_id
1 1 Y 1 A GLY -3 ? A GLY 1
2 1 Y 1 A SER -2 ? A SER 2
3 1 Y 1 A HIS -1 ? A HIS 3
#
loop_
_chem_comp_atom.comp_id
_chem_comp_atom.atom_id
_chem_comp_atom.type_symbol
_chem_comp_atom.pdbx_aromatic_flag
_chem_comp_atom.pdbx_stereo_config
_chem_comp_atom.pdbx_ordinal
A1IQ0 CAU C N N 1
A1IQ0 OAT O N N 2
A1IQ0 CAR C N N 3
A1IQ0 OAS O N N 4
A1IQ0 CAP C N N 5
A1IQ0 CAQ C N N 6
A1IQ0 CAO C N N 7
A1IQ0 CAD C Y N 8
A1IQ0 CAE C Y N 9
A1IQ0 CAF C Y N 10
A1IQ0 OAM O N N 11
A1IQ0 CAN C N N 12
A1IQ0 CAC C Y N 13
A1IQ0 CAA C Y N 14
A1IQ0 OAK O N N 15
A1IQ0 CAL C N N 16
A1IQ0 CAB C Y N 17
A1IQ0 OAG O N N 18
A1IQ0 H1 H N N 19
A1IQ0 H2 H N N 20
A1IQ0 H3 H N N 21
A1IQ0 H4 H N N 22
A1IQ0 H5 H N N 23
A1IQ0 H6 H N N 24
A1IQ0 H7 H N N 25
A1IQ0 H8 H N N 26
A1IQ0 H9 H N N 27
A1IQ0 H10 H N N 28
A1IQ0 H11 H N N 29
A1IQ0 H12 H N N 30
A1IQ0 H13 H N N 31
A1IQ0 H14 H N N 32
A1IQ0 H15 H N N 33
A1IQ0 C1 C N N 34
A1IQ0 C2 C N N 35
A1IQ0 C3 C N N 36
A1IQ0 H17 H N N 37
A1IQ0 H18 H N N 38
A1IQ0 H16 H N N 39
ALA N N N N 40
ALA CA C N S 41
ALA C C N N 42
ALA O O N N 43
ALA CB C N N 44
ALA OXT O N N 45
ALA H H N N 46
ALA H2 H N N 47
ALA HA H N N 48
ALA HB1 H N N 49
ALA HB2 H N N 50
ALA HB3 H N N 51
ALA HXT H N N 52
ARG N N N N 53
ARG CA C N S 54
ARG C C N N 55
ARG O O N N 56
ARG CB C N N 57
ARG CG C N N 58
ARG CD C N N 59
ARG NE N N N 60
ARG CZ C N N 61
ARG NH1 N N N 62
ARG NH2 N N N 63
ARG OXT O N N 64
ARG H H N N 65
ARG H2 H N N 66
ARG HA H N N 67
ARG HB2 H N N 68
ARG HB3 H N N 69
ARG HG2 H N N 70
ARG HG3 H N N 71
ARG HD2 H N N 72
ARG HD3 H N N 73
ARG HE H N N 74
ARG HH11 H N N 75
ARG HH12 H N N 76
ARG HH21 H N N 77
ARG HH22 H N N 78
ARG HXT H N N 79
ASN N N N N 80
ASN CA C N S 81
ASN C C N N 82
ASN O O N N 83
ASN CB C N N 84
ASN CG C N N 85
ASN OD1 O N N 86
ASN ND2 N N N 87
ASN OXT O N N 88
ASN H H N N 89
ASN H2 H N N 90
ASN HA H N N 91
ASN HB2 H N N 92
ASN HB3 H N N 93
ASN HD21 H N N 94
ASN HD22 H N N 95
ASN HXT H N N 96
ASP N N N N 97
ASP CA C N S 98
ASP C C N N 99
ASP O O N N 100
ASP CB C N N 101
ASP CG C N N 102
ASP OD1 O N N 103
ASP OD2 O N N 104
ASP OXT O N N 105
ASP H H N N 106
ASP H2 H N N 107
ASP HA H N N 108
ASP HB2 H N N 109
ASP HB3 H N N 110
ASP HD2 H N N 111
ASP HXT H N N 112
CYS N N N N 113
CYS CA C N R 114
CYS C C N N 115
CYS O O N N 116
CYS CB C N N 117
CYS SG S N N 118
CYS OXT O N N 119
CYS H H N N 120
CYS H2 H N N 121
CYS HA H N N 122
CYS HB2 H N N 123
CYS HB3 H N N 124
CYS HG H N N 125
CYS HXT H N N 126
GLN N N N N 127
GLN CA C N S 128
GLN C C N N 129
GLN O O N N 130
GLN CB C N N 131
GLN CG C N N 132
GLN CD C N N 133
GLN OE1 O N N 134
GLN NE2 N N N 135
GLN OXT O N N 136
GLN H H N N 137
GLN H2 H N N 138
GLN HA H N N 139
GLN HB2 H N N 140
GLN HB3 H N N 141
GLN HG2 H N N 142
GLN HG3 H N N 143
GLN HE21 H N N 144
GLN HE22 H N N 145
GLN HXT H N N 146
GLU N N N N 147
GLU CA C N S 148
GLU C C N N 149
GLU O O N N 150
GLU CB C N N 151
GLU CG C N N 152
GLU CD C N N 153
GLU OE1 O N N 154
GLU OE2 O N N 155
GLU OXT O N N 156
GLU H H N N 157
GLU H2 H N N 158
GLU HA H N N 159
GLU HB2 H N N 160
GLU HB3 H N N 161
GLU HG2 H N N 162
GLU HG3 H N N 163
GLU HE2 H N N 164
GLU HXT H N N 165
GLY N N N N 166
GLY CA C N N 167
GLY C C N N 168
GLY O O N N 169
GLY OXT O N N 170
GLY H H N N 171
GLY H2 H N N 172
GLY HA2 H N N 173
GLY HA3 H N N 174
GLY HXT H N N 175
HIS N N N N 176
HIS CA C N S 177
HIS C C N N 178
HIS O O N N 179
HIS CB C N N 180
HIS CG C Y N 181
HIS ND1 N Y N 182
HIS CD2 C Y N 183
HIS CE1 C Y N 184
HIS NE2 N Y N 185
HIS OXT O N N 186
HIS H H N N 187
HIS H2 H N N 188
HIS HA H N N 189
HIS HB2 H N N 190
HIS HB3 H N N 191
HIS HD1 H N N 192
HIS HD2 H N N 193
HIS HE1 H N N 194
HIS HE2 H N N 195
HIS HXT H N N 196
HOH O O N N 197
HOH H1 H N N 198
HOH H2 H N N 199
ILE N N N N 200
ILE CA C N S 201
ILE C C N N 202
ILE O O N N 203
ILE CB C N S 204
ILE CG1 C N N 205
ILE CG2 C N N 206
ILE CD1 C N N 207
ILE OXT O N N 208
ILE H H N N 209
ILE H2 H N N 210
ILE HA H N N 211
ILE HB H N N 212
ILE HG12 H N N 213
ILE HG13 H N N 214
ILE HG21 H N N 215
ILE HG22 H N N 216
ILE HG23 H N N 217
ILE HD11 H N N 218
ILE HD12 H N N 219
ILE HD13 H N N 220
ILE HXT H N N 221
LEU N N N N 222
LEU CA C N S 223
LEU C C N N 224
LEU O O N N 225
LEU CB C N N 226
LEU CG C N N 227
LEU CD1 C N N 228
LEU CD2 C N N 229
LEU OXT O N N 230
LEU H H N N 231
LEU H2 H N N 232
LEU HA H N N 233
LEU HB2 H N N 234
LEU HB3 H N N 235
LEU HG H N N 236
LEU HD11 H N N 237
LEU HD12 H N N 238
LEU HD13 H N N 239
LEU HD21 H N N 240
LEU HD22 H N N 241
LEU HD23 H N N 242
LEU HXT H N N 243
LYS N N N N 244
LYS CA C N S 245
LYS C C N N 246
LYS O O N N 247
LYS CB C N N 248
LYS CG C N N 249
LYS CD C N N 250
LYS CE C N N 251
LYS NZ N N N 252
LYS OXT O N N 253
LYS H H N N 254
LYS H2 H N N 255
LYS HA H N N 256
LYS HB2 H N N 257
LYS HB3 H N N 258
LYS HG2 H N N 259
LYS HG3 H N N 260
LYS HD2 H N N 261
LYS HD3 H N N 262
LYS HE2 H N N 263
LYS HE3 H N N 264
LYS HZ1 H N N 265
LYS HZ2 H N N 266
LYS HZ3 H N N 267
LYS HXT H N N 268
MET N N N N 269
MET CA C N S 270
MET C C N N 271
MET O O N N 272
MET CB C N N 273
MET CG C N N 274
MET SD S N N 275
MET CE C N N 276
MET OXT O N N 277
MET H H N N 278
MET H2 H N N 279
MET HA H N N 280
MET HB2 H N N 281
MET HB3 H N N 282
MET HG2 H N N 283
MET HG3 H N N 284
MET HE1 H N N 285
MET HE2 H N N 286
MET HE3 H N N 287
MET HXT H N N 288
PHE N N N N 289
PHE CA C N S 290
PHE C C N N 291
PHE O O N N 292
PHE CB C N N 293
PHE CG C Y N 294
PHE CD1 C Y N 295
PHE CD2 C Y N 296
PHE CE1 C Y N 297
PHE CE2 C Y N 298
PHE CZ C Y N 299
PHE OXT O N N 300
PHE H H N N 301
PHE H2 H N N 302
PHE HA H N N 303
PHE HB2 H N N 304
PHE HB3 H N N 305
PHE HD1 H N N 306
PHE HD2 H N N 307
PHE HE1 H N N 308
PHE HE2 H N N 309
PHE HZ H N N 310
PHE HXT H N N 311
PRO N N N N 312
PRO CA C N S 313
PRO C C N N 314
PRO O O N N 315
PRO CB C N N 316
PRO CG C N N 317
PRO CD C N N 318
PRO OXT O N N 319
PRO H H N N 320
PRO HA H N N 321
PRO HB2 H N N 322
PRO HB3 H N N 323
PRO HG2 H N N 324
PRO HG3 H N N 325
PRO HD2 H N N 326
PRO HD3 H N N 327
PRO HXT H N N 328
SER N N N N 329
SER CA C N S 330
SER C C N N 331
SER O O N N 332
SER CB C N N 333
SER OG O N N 334
SER OXT O N N 335
SER H H N N 336
SER H2 H N N 337
SER HA H N N 338
SER HB2 H N N 339
SER HB3 H N N 340
SER HG H N N 341
SER HXT H N N 342
THR N N N N 343
THR CA C N S 344
THR C C N N 345
THR O O N N 346
THR CB C N R 347
THR OG1 O N N 348
THR CG2 C N N 349
THR OXT O N N 350
THR H H N N 351
THR H2 H N N 352
THR HA H N N 353
THR HB H N N 354
THR HG1 H N N 355
THR HG21 H N N 356
THR HG22 H N N 357
THR HG23 H N N 358
THR HXT H N N 359
TRP N N N N 360
TRP CA C N S 361
TRP C C N N 362
TRP O O N N 363
TRP CB C N N 364
TRP CG C Y N 365
TRP CD1 C Y N 366
TRP CD2 C Y N 367
TRP NE1 N Y N 368
TRP CE2 C Y N 369
TRP CE3 C Y N 370
TRP CZ2 C Y N 371
TRP CZ3 C Y N 372
TRP CH2 C Y N 373
TRP OXT O N N 374
TRP H H N N 375
TRP H2 H N N 376
TRP HA H N N 377
TRP HB2 H N N 378
TRP HB3 H N N 379
TRP HD1 H N N 380
TRP HE1 H N N 381
TRP HE3 H N N 382
TRP HZ2 H N N 383
TRP HZ3 H N N 384
TRP HH2 H N N 385
TRP HXT H N N 386
TYR N N N N 387
TYR CA C N S 388
TYR C C N N 389
TYR O O N N 390
TYR CB C N N 391
TYR CG C Y N 392
TYR CD1 C Y N 393
TYR CD2 C Y N 394
TYR CE1 C Y N 395
TYR CE2 C Y N 396
TYR CZ C Y N 397
TYR OH O N N 398
TYR OXT O N N 399
TYR H H N N 400
TYR H2 H N N 401
TYR HA H N N 402
TYR HB2 H N N 403
TYR HB3 H N N 404
TYR HD1 H N N 405
TYR HD2 H N N 406
TYR HE1 H N N 407
TYR HE2 H N N 408
TYR HH H N N 409
TYR HXT H N N 410
VAL N N N N 411
VAL CA C N S 412
VAL C C N N 413
VAL O O N N 414
VAL CB C N N 415
VAL CG1 C N N 416
VAL CG2 C N N 417
VAL OXT O N N 418
VAL H H N N 419
VAL H2 H N N 420
VAL HA H N N 421
VAL HB H N N 422
VAL HG11 H N N 423
VAL HG12 H N N 424
VAL HG13 H N N 425
VAL HG21 H N N 426
VAL HG22 H N N 427
VAL HG23 H N N 428
VAL HXT H N N 429
#
loop_
_chem_comp_bond.comp_id
_chem_comp_bond.atom_id_1
_chem_comp_bond.atom_id_2
_chem_comp_bond.value_order
_chem_comp_bond.pdbx_aromatic_flag
_chem_comp_bond.pdbx_stereo_config
_chem_comp_bond.pdbx_ordinal
A1IQ0 CAL OAK sing N N 1
A1IQ0 OAK CAA sing N N 2
A1IQ0 OAG CAB sing N N 3
A1IQ0 CAA CAB doub Y N 4
A1IQ0 CAA CAC sing Y N 5
A1IQ0 CAB CAF sing Y N 6
A1IQ0 CAC CAD doub Y N 7
A1IQ0 CAN OAM sing N N 8
A1IQ0 CAF OAM sing N N 9
A1IQ0 CAF CAE doub Y N 10
A1IQ0 CAD CAE sing Y N 11
A1IQ0 CAD CAO sing N N 12
A1IQ0 CAO CAP doub N Z 13
A1IQ0 CAU OAT sing N N 14
A1IQ0 OAT CAR sing N N 15
A1IQ0 CAP CAR sing N N 16
A1IQ0 CAP CAQ sing N N 17
A1IQ0 CAR OAS doub N N 18
A1IQ0 CAU H1 sing N N 19
A1IQ0 CAU H2 sing N N 20
A1IQ0 CAU H3 sing N N 21
A1IQ0 CAQ H4 sing N N 22
A1IQ0 CAQ H5 sing N N 23
A1IQ0 CAQ H6 sing N N 24
A1IQ0 CAO H7 sing N N 25
A1IQ0 CAE H8 sing N N 26
A1IQ0 CAN H9 sing N N 27
A1IQ0 CAN H10 sing N N 28
A1IQ0 CAN H11 sing N N 29
A1IQ0 CAC H12 sing N N 30
A1IQ0 CAL H13 sing N N 31
A1IQ0 CAL H14 sing N N 32
A1IQ0 CAL H15 sing N N 33
A1IQ0 OAG C1 sing N N 34
A1IQ0 C1 C2 sing N N 35
A1IQ0 C2 C3 trip N N 36
A1IQ0 C1 H17 sing N N 37
A1IQ0 C1 H18 sing N N 38
A1IQ0 C3 H16 sing N N 39
ALA N CA sing N N 40
ALA N H sing N N 41
ALA N H2 sing N N 42
ALA CA C sing N N 43
ALA CA CB sing N N 44
ALA CA HA sing N N 45
ALA C O doub N N 46
ALA C OXT sing N N 47
ALA CB HB1 sing N N 48
ALA CB HB2 sing N N 49
ALA CB HB3 sing N N 50
ALA OXT HXT sing N N 51
ARG N CA sing N N 52
ARG N H sing N N 53
ARG N H2 sing N N 54
ARG CA C sing N N 55
ARG CA CB sing N N 56
ARG CA HA sing N N 57
ARG C O doub N N 58
ARG C OXT sing N N 59
ARG CB CG sing N N 60
ARG CB HB2 sing N N 61
ARG CB HB3 sing N N 62
ARG CG CD sing N N 63
ARG CG HG2 sing N N 64
ARG CG HG3 sing N N 65
ARG CD NE sing N N 66
ARG CD HD2 sing N N 67
ARG CD HD3 sing N N 68
ARG NE CZ sing N N 69
ARG NE HE sing N N 70
ARG CZ NH1 sing N N 71
ARG CZ NH2 doub N N 72
ARG NH1 HH11 sing N N 73
ARG NH1 HH12 sing N N 74
ARG NH2 HH21 sing N N 75
ARG NH2 HH22 sing N N 76
ARG OXT HXT sing N N 77
ASN N CA sing N N 78
ASN N H sing N N 79
ASN N H2 sing N N 80
ASN CA C sing N N 81
ASN CA CB sing N N 82
ASN CA HA sing N N 83
ASN C O doub N N 84
ASN C OXT sing N N 85
ASN CB CG sing N N 86
ASN CB HB2 sing N N 87
ASN CB HB3 sing N N 88
ASN CG OD1 doub N N 89
ASN CG ND2 sing N N 90
ASN ND2 HD21 sing N N 91
ASN ND2 HD22 sing N N 92
ASN OXT HXT sing N N 93
ASP N CA sing N N 94
ASP N H sing N N 95
ASP N H2 sing N N 96
ASP CA C sing N N 97
ASP CA CB sing N N 98
ASP CA HA sing N N 99
ASP C O doub N N 100
ASP C OXT sing N N 101
ASP CB CG sing N N 102
ASP CB HB2 sing N N 103
ASP CB HB3 sing N N 104
ASP CG OD1 doub N N 105
ASP CG OD2 sing N N 106
ASP OD2 HD2 sing N N 107
ASP OXT HXT sing N N 108
CYS N CA sing N N 109
CYS N H sing N N 110
CYS N H2 sing N N 111
CYS CA C sing N N 112
CYS CA CB sing N N 113
CYS CA HA sing N N 114
CYS C O doub N N 115
CYS C OXT sing N N 116
CYS CB SG sing N N 117
CYS CB HB2 sing N N 118
CYS CB HB3 sing N N 119
CYS SG HG sing N N 120
CYS OXT HXT sing N N 121
GLN N CA sing N N 122
GLN N H sing N N 123
GLN N H2 sing N N 124
GLN CA C sing N N 125
GLN CA CB sing N N 126
GLN CA HA sing N N 127
GLN C O doub N N 128
GLN C OXT sing N N 129
GLN CB CG sing N N 130
GLN CB HB2 sing N N 131
GLN CB HB3 sing N N 132
GLN CG CD sing N N 133
GLN CG HG2 sing N N 134
GLN CG HG3 sing N N 135
GLN CD OE1 doub N N 136
GLN CD NE2 sing N N 137
GLN NE2 HE21 sing N N 138
GLN NE2 HE22 sing N N 139
GLN OXT HXT sing N N 140
GLU N CA sing N N 141
GLU N H sing N N 142
GLU N H2 sing N N 143
GLU CA C sing N N 144
GLU CA CB sing N N 145
GLU CA HA sing N N 146
GLU C O doub N N 147
GLU C OXT sing N N 148
GLU CB CG sing N N 149
GLU CB HB2 sing N N 150
GLU CB HB3 sing N N 151
GLU CG CD sing N N 152
GLU CG HG2 sing N N 153
GLU CG HG3 sing N N 154
GLU CD OE1 doub N N 155
GLU CD OE2 sing N N 156
GLU OE2 HE2 sing N N 157
GLU OXT HXT sing N N 158
GLY N CA sing N N 159
GLY N H sing N N 160
GLY N H2 sing N N 161
GLY CA C sing N N 162
GLY CA HA2 sing N N 163
GLY CA HA3 sing N N 164
GLY C O doub N N 165
GLY C OXT sing N N 166
GLY OXT HXT sing N N 167
HIS N CA sing N N 168
HIS N H sing N N 169
HIS N H2 sing N N 170
HIS CA C sing N N 171
HIS CA CB sing N N 172
HIS CA HA sing N N 173
HIS C O doub N N 174
HIS C OXT sing N N 175
HIS CB CG sing N N 176
HIS CB HB2 sing N N 177
HIS CB HB3 sing N N 178
HIS CG ND1 sing Y N 179
HIS CG CD2 doub Y N 180
HIS ND1 CE1 doub Y N 181
HIS ND1 HD1 sing N N 182
HIS CD2 NE2 sing Y N 183
HIS CD2 HD2 sing N N 184
HIS CE1 NE2 sing Y N 185
HIS CE1 HE1 sing N N 186
HIS NE2 HE2 sing N N 187
HIS OXT HXT sing N N 188
HOH O H1 sing N N 189
HOH O H2 sing N N 190
ILE N CA sing N N 191
ILE N H sing N N 192
ILE N H2 sing N N 193
ILE CA C sing N N 194
ILE CA CB sing N N 195
ILE CA HA sing N N 196
ILE C O doub N N 197
ILE C OXT sing N N 198
ILE CB CG1 sing N N 199
ILE CB CG2 sing N N 200
ILE CB HB sing N N 201
ILE CG1 CD1 sing N N 202
ILE CG1 HG12 sing N N 203
ILE CG1 HG13 sing N N 204
ILE CG2 HG21 sing N N 205
ILE CG2 HG22 sing N N 206
ILE CG2 HG23 sing N N 207
ILE CD1 HD11 sing N N 208
ILE CD1 HD12 sing N N 209
ILE CD1 HD13 sing N N 210
ILE OXT HXT sing N N 211
LEU N CA sing N N 212
LEU N H sing N N 213
LEU N H2 sing N N 214
LEU CA C sing N N 215
LEU CA CB sing N N 216
LEU CA HA sing N N 217
LEU C O doub N N 218
LEU C OXT sing N N 219
LEU CB CG sing N N 220
LEU CB HB2 sing N N 221
LEU CB HB3 sing N N 222
LEU CG CD1 sing N N 223
LEU CG CD2 sing N N 224
LEU CG HG sing N N 225
LEU CD1 HD11 sing N N 226
LEU CD1 HD12 sing N N 227
LEU CD1 HD13 sing N N 228
LEU CD2 HD21 sing N N 229
LEU CD2 HD22 sing N N 230
LEU CD2 HD23 sing N N 231
LEU OXT HXT sing N N 232
LYS N CA sing N N 233
LYS N H sing N N 234
LYS N H2 sing N N 235
LYS CA C sing N N 236
LYS CA CB sing N N 237
LYS CA HA sing N N 238
LYS C O doub N N 239
LYS C OXT sing N N 240
LYS CB CG sing N N 241
LYS CB HB2 sing N N 242
LYS CB HB3 sing N N 243
LYS CG CD sing N N 244
LYS CG HG2 sing N N 245
LYS CG HG3 sing N N 246
LYS CD CE sing N N 247
LYS CD HD2 sing N N 248
LYS CD HD3 sing N N 249
LYS CE NZ sing N N 250
LYS CE HE2 sing N N 251
LYS CE HE3 sing N N 252
LYS NZ HZ1 sing N N 253
LYS NZ HZ2 sing N N 254
LYS NZ HZ3 sing N N 255
LYS OXT HXT sing N N 256
MET N CA sing N N 257
MET N H sing N N 258
MET N H2 sing N N 259
MET CA C sing N N 260
MET CA CB sing N N 261
MET CA HA sing N N 262
MET C O doub N N 263
MET C OXT sing N N 264
MET CB CG sing N N 265
MET CB HB2 sing N N 266
MET CB HB3 sing N N 267
MET CG SD sing N N 268
MET CG HG2 sing N N 269
MET CG HG3 sing N N 270
MET SD CE sing N N 271
MET CE HE1 sing N N 272
MET CE HE2 sing N N 273
MET CE HE3 sing N N 274
MET OXT HXT sing N N 275
PHE N CA sing N N 276
PHE N H sing N N 277
PHE N H2 sing N N 278
PHE CA C sing N N 279
PHE CA CB sing N N 280
PHE CA HA sing N N 281
PHE C O doub N N 282
PHE C OXT sing N N 283
PHE CB CG sing N N 284
PHE CB HB2 sing N N 285
PHE CB HB3 sing N N 286
PHE CG CD1 doub Y N 287
PHE CG CD2 sing Y N 288
PHE CD1 CE1 sing Y N 289
PHE CD1 HD1 sing N N 290
PHE CD2 CE2 doub Y N 291
PHE CD2 HD2 sing N N 292
PHE CE1 CZ doub Y N 293
PHE CE1 HE1 sing N N 294
PHE CE2 CZ sing Y N 295
PHE CE2 HE2 sing N N 296
PHE CZ HZ sing N N 297
PHE OXT HXT sing N N 298
PRO N CA sing N N 299
PRO N CD sing N N 300
PRO N H sing N N 301
PRO CA C sing N N 302
PRO CA CB sing N N 303
PRO CA HA sing N N 304
PRO C O doub N N 305
PRO C OXT sing N N 306
PRO CB CG sing N N 307
PRO CB HB2 sing N N 308
PRO CB HB3 sing N N 309
PRO CG CD sing N N 310
PRO CG HG2 sing N N 311
PRO CG HG3 sing N N 312
PRO CD HD2 sing N N 313
PRO CD HD3 sing N N 314
PRO OXT HXT sing N N 315
SER N CA sing N N 316
SER N H sing N N 317
SER N H2 sing N N 318
SER CA C sing N N 319
SER CA CB sing N N 320
SER CA HA sing N N 321
SER C O doub N N 322
SER C OXT sing N N 323
SER CB OG sing N N 324
SER CB HB2 sing N N 325
SER CB HB3 sing N N 326
SER OG HG sing N N 327
SER OXT HXT sing N N 328
THR N CA sing N N 329
THR N H sing N N 330
THR N H2 sing N N 331
THR CA C sing N N 332
THR CA CB sing N N 333
THR CA HA sing N N 334
THR C O doub N N 335
THR C OXT sing N N 336
THR CB OG1 sing N N 337
THR CB CG2 sing N N 338
THR CB HB sing N N 339
THR OG1 HG1 sing N N 340
THR CG2 HG21 sing N N 341
THR CG2 HG22 sing N N 342
THR CG2 HG23 sing N N 343
THR OXT HXT sing N N 344
TRP N CA sing N N 345
TRP N H sing N N 346
TRP N H2 sing N N 347
TRP CA C sing N N 348
TRP CA CB sing N N 349
TRP CA HA sing N N 350
TRP C O doub N N 351
TRP C OXT sing N N 352
TRP CB CG sing N N 353
TRP CB HB2 sing N N 354
TRP CB HB3 sing N N 355
TRP CG CD1 doub Y N 356
TRP CG CD2 sing Y N 357
TRP CD1 NE1 sing Y N 358
TRP CD1 HD1 sing N N 359
TRP CD2 CE2 doub Y N 360
TRP CD2 CE3 sing Y N 361
TRP NE1 CE2 sing Y N 362
TRP NE1 HE1 sing N N 363
TRP CE2 CZ2 sing Y N 364
TRP CE3 CZ3 doub Y N 365
TRP CE3 HE3 sing N N 366
TRP CZ2 CH2 doub Y N 367
TRP CZ2 HZ2 sing N N 368
TRP CZ3 CH2 sing Y N 369
TRP CZ3 HZ3 sing N N 370
TRP CH2 HH2 sing N N 371
TRP OXT HXT sing N N 372
TYR N CA sing N N 373
TYR N H sing N N 374
TYR N H2 sing N N 375
TYR CA C sing N N 376
TYR CA CB sing N N 377
TYR CA HA sing N N 378
TYR C O doub N N 379
TYR C OXT sing N N 380
TYR CB CG sing N N 381
TYR CB HB2 sing N N 382
TYR CB HB3 sing N N 383
TYR CG CD1 doub Y N 384
TYR CG CD2 sing Y N 385
TYR CD1 CE1 sing Y N 386
TYR CD1 HD1 sing N N 387
TYR CD2 CE2 doub Y N 388
TYR CD2 HD2 sing N N 389
TYR CE1 CZ doub Y N 390
TYR CE1 HE1 sing N N 391
TYR CE2 CZ sing Y N 392
TYR CE2 HE2 sing N N 393
TYR CZ OH sing N N 394
TYR OH HH sing N N 395
TYR OXT HXT sing N N 396
VAL N CA sing N N 397
VAL N H sing N N 398
VAL N H2 sing N N 399
VAL CA C sing N N 400
VAL CA CB sing N N 401
VAL CA HA sing N N 402
VAL C O doub N N 403
VAL C OXT sing N N 404
VAL CB CG1 sing N N 405
VAL CB CG2 sing N N 406
VAL CB HB sing N N 407
VAL CG1 HG11 sing N N 408
VAL CG1 HG12 sing N N 409
VAL CG1 HG13 sing N N 410
VAL CG2 HG21 sing N N 411
VAL CG2 HG22 sing N N 412
VAL CG2 HG23 sing N N 413
VAL OXT HXT sing N N 414
#
_pdbx_audit_support.funding_organization 'Not funded'
_pdbx_audit_support.country Italy
_pdbx_audit_support.grant_number ?
_pdbx_audit_support.ordinal 1
#
_pdbx_initial_refinement_model.id 1
_pdbx_initial_refinement_model.entity_id_list ?
_pdbx_initial_refinement_model.type 'experimental model'
_pdbx_initial_refinement_model.source_name PDB
_pdbx_initial_refinement_model.accession_code 6Z2U
_pdbx_initial_refinement_model.details ?
#
_atom_sites.entry_id 9GVZ
_atom_sites.Cartn_transf_matrix[1][1] ?
_atom_sites.Cartn_transf_matrix[1][2] ?
_atom_sites.Cartn_transf_matrix[1][3] ?
_atom_sites.Cartn_transf_matrix[2][1] ?
_atom_sites.Cartn_transf_matrix[2][2] ?
_atom_sites.Cartn_transf_matrix[2][3] ?
_atom_sites.Cartn_transf_matrix[3][1] ?
_atom_sites.Cartn_transf_matrix[3][2] ?
_atom_sites.Cartn_transf_matrix[3][3] ?
_atom_sites.Cartn_transf_vector[1] ?
_atom_sites.Cartn_transf_vector[2] ?
_atom_sites.Cartn_transf_vector[3] ?
_atom_sites.Cartn_transform_axes ?
_atom_sites.fract_transf_matrix[1][1] 0.017375
_atom_sites.fract_transf_matrix[1][2] 0.010031
_atom_sites.fract_transf_matrix[1][3] 0.000000
_atom_sites.fract_transf_matrix[2][1] -0.000000
_atom_sites.fract_transf_matrix[2][2] 0.020063
_atom_sites.fract_transf_matrix[2][3] 0.000000
_atom_sites.fract_transf_matrix[3][1] 0.000000
_atom_sites.fract_transf_matrix[3][2] -0.000000
_atom_sites.fract_transf_matrix[3][3] 0.009829
_atom_sites.fract_transf_vector[1] 0.00000
_atom_sites.fract_transf_vector[2] 0.00000
_atom_sites.fract_transf_vector[3] 0.00000
_atom_sites.solution_primary ?
_atom_sites.solution_secondary ?
_atom_sites.solution_hydrogens ?
_atom_sites.special_details ?
#
loop_
_atom_type.symbol
C
N
O
S
#
loop_