data_9H1N # _entry.id 9H1N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9H1N pdb_00009h1n 10.2210/pdb9h1n/pdb WWPDB D_1292142149 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-10-29 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9H1N _pdbx_database_status.recvd_initial_deposition_date 2024-10-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email rudi@mol.biol.ethz.ch _pdbx_contact_author.name_first Rudi _pdbx_contact_author.name_last Glockshuber _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3320-3843 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bothe, S.N.' 1 0009-0006-9529-2094 'Racunica, D.' 2 ? 'Glockshuber, R.' 3 0000-0003-3320-3843 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'A cooperative binding mechanism steers the recruitment of peripheral subunits in the E. coli pyruvate dehydrogenase complex' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bothe, S.N.' 1 0009-0006-9529-2094 primary 'Racunica, D.' 2 ? primary 'Zajec Hudnik, T.' 3 ? primary 'Zdanowicz, R.' 4 0009-0005-5694-2704 primary 'Bothe, A.' 5 0009-0007-2710-1273 primary 'Giese, C.' 6 0000-0001-9875-9629 primary 'Glockshuber, R.' 7 0000-0003-3320-3843 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Pyruvate dehydrogenase E1 component' 5633.201 2 1.2.4.1 ? ? 'isolated binding domain of E1 (residues 1-50)' 2 polymer man 'Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex' 7210.218 1 2.3.1.12 ? ? ? 3 water nat water 18.015 122 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'PDH E1 component' 2 'Dihydrolipoyllysine-residue acetyltransferase (E2) component of pyruvate dehydrogenase complex' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no SERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEARKGGVN SERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEARKGGVN C,B ? 2 'polypeptide(L)' no no EGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAATG EGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAATG A ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 ARG n 1 4 PHE n 1 5 PRO n 1 6 ASN n 1 7 ASP n 1 8 VAL n 1 9 ASP n 1 10 PRO n 1 11 ILE n 1 12 GLU n 1 13 THR n 1 14 ARG n 1 15 ASP n 1 16 TRP n 1 17 LEU n 1 18 GLN n 1 19 ALA n 1 20 ILE n 1 21 GLU n 1 22 SER n 1 23 VAL n 1 24 ILE n 1 25 ARG n 1 26 GLU n 1 27 GLU n 1 28 GLY n 1 29 VAL n 1 30 GLU n 1 31 ARG n 1 32 ALA n 1 33 GLN n 1 34 TYR n 1 35 LEU n 1 36 ILE n 1 37 ASP n 1 38 GLN n 1 39 LEU n 1 40 LEU n 1 41 ALA n 1 42 GLU n 1 43 ALA n 1 44 ARG n 1 45 LYS n 1 46 GLY n 1 47 GLY n 1 48 VAL n 1 49 ASN n 2 1 GLU n 2 2 GLY n 2 3 LYS n 2 4 SER n 2 5 GLU n 2 6 PHE n 2 7 ALA n 2 8 GLU n 2 9 ASN n 2 10 ASP n 2 11 ALA n 2 12 TYR n 2 13 VAL n 2 14 HIS n 2 15 ALA n 2 16 THR n 2 17 PRO n 2 18 LEU n 2 19 ILE n 2 20 ARG n 2 21 ARG n 2 22 LEU n 2 23 ALA n 2 24 ARG n 2 25 GLU n 2 26 PHE n 2 27 GLY n 2 28 VAL n 2 29 ASN n 2 30 LEU n 2 31 ALA n 2 32 LYS n 2 33 VAL n 2 34 LYS n 2 35 GLY n 2 36 THR n 2 37 GLY n 2 38 ARG n 2 39 LYS n 2 40 GLY n 2 41 ARG n 2 42 ILE n 2 43 LEU n 2 44 ARG n 2 45 GLU n 2 46 ASP n 2 47 VAL n 2 48 GLN n 2 49 ALA n 2 50 TYR n 2 51 VAL n 2 52 LYS n 2 53 GLU n 2 54 ALA n 2 55 ILE n 2 56 LYS n 2 57 ARG n 2 58 ALA n 2 59 GLU n 2 60 ALA n 2 61 ALA n 2 62 PRO n 2 63 ALA n 2 64 ALA n 2 65 THR n 2 66 GLY n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 49 ? ? 'aceE, b0114, JW0110' ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 66 ? ? 'aceF, b0115, JW0111' ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? C . n A 1 2 GLU 2 2 ? ? ? C . n A 1 3 ARG 3 3 ? ? ? C . n A 1 4 PHE 4 4 4 PHE PHE C . n A 1 5 PRO 5 5 5 PRO PRO C . n A 1 6 ASN 6 6 6 ASN ASN C . n A 1 7 ASP 7 7 7 ASP ASP C . n A 1 8 VAL 8 8 8 VAL VAL C . n A 1 9 ASP 9 9 9 ASP ASP C . n A 1 10 PRO 10 10 10 PRO PRO C . n A 1 11 ILE 11 11 11 ILE ILE C . n A 1 12 GLU 12 12 12 GLU GLU C . n A 1 13 THR 13 13 13 THR THR C . n A 1 14 ARG 14 14 14 ARG ARG C . n A 1 15 ASP 15 15 15 ASP ASP C . n A 1 16 TRP 16 16 16 TRP TRP C . n A 1 17 LEU 17 17 17 LEU LEU C . n A 1 18 GLN 18 18 18 GLN GLN C . n A 1 19 ALA 19 19 19 ALA ALA C . n A 1 20 ILE 20 20 20 ILE ILE C . n A 1 21 GLU 21 21 21 GLU GLU C . n A 1 22 SER 22 22 22 SER SER C . n A 1 23 VAL 23 23 23 VAL VAL C . n A 1 24 ILE 24 24 24 ILE ILE C . n A 1 25 ARG 25 25 25 ARG ARG C . n A 1 26 GLU 26 26 26 GLU GLU C . n A 1 27 GLU 27 27 27 GLU GLU C . n A 1 28 GLY 28 28 28 GLY GLY C . n A 1 29 VAL 29 29 29 VAL VAL C . n A 1 30 GLU 30 30 30 GLU GLU C . n A 1 31 ARG 31 31 31 ARG ARG C . n A 1 32 ALA 32 32 32 ALA ALA C . n A 1 33 GLN 33 33 33 GLN GLN C . n A 1 34 TYR 34 34 34 TYR TYR C . n A 1 35 LEU 35 35 35 LEU LEU C . n A 1 36 ILE 36 36 36 ILE ILE C . n A 1 37 ASP 37 37 37 ASP ASP C . n A 1 38 GLN 38 38 38 GLN GLN C . n A 1 39 LEU 39 39 39 LEU LEU C . n A 1 40 LEU 40 40 40 LEU LEU C . n A 1 41 ALA 41 41 41 ALA ALA C . n A 1 42 GLU 42 42 42 GLU GLU C . n A 1 43 ALA 43 43 43 ALA ALA C . n A 1 44 ARG 44 44 44 ARG ARG C . n A 1 45 LYS 45 45 45 LYS LYS C . n A 1 46 GLY 46 46 46 GLY GLY C . n A 1 47 GLY 47 47 47 GLY GLY C . n A 1 48 VAL 48 48 48 VAL VAL C . n A 1 49 ASN 49 49 49 ASN ASN C . n B 1 1 SER 1 1 ? ? ? B . n B 1 2 GLU 2 2 ? ? ? B . n B 1 3 ARG 3 3 3 ARG ARG B . n B 1 4 PHE 4 4 4 PHE PHE B . n B 1 5 PRO 5 5 5 PRO PRO B . n B 1 6 ASN 6 6 6 ASN ASN B . n B 1 7 ASP 7 7 7 ASP ASP B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 ASP 9 9 9 ASP ASP B . n B 1 10 PRO 10 10 10 PRO PRO B . n B 1 11 ILE 11 11 11 ILE ILE B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 THR 13 13 13 THR THR B . n B 1 14 ARG 14 14 14 ARG ARG B . n B 1 15 ASP 15 15 15 ASP ASP B . n B 1 16 TRP 16 16 16 TRP TRP B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 GLN 18 18 18 GLN GLN B . n B 1 19 ALA 19 19 19 ALA ALA B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 SER 22 22 22 SER SER B . n B 1 23 VAL 23 23 23 VAL VAL B . n B 1 24 ILE 24 24 24 ILE ILE B . n B 1 25 ARG 25 25 25 ARG ARG B . n B 1 26 GLU 26 26 26 GLU GLU B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 GLY 28 28 28 GLY GLY B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 GLU 30 30 30 GLU GLU B . n B 1 31 ARG 31 31 31 ARG ARG B . n B 1 32 ALA 32 32 32 ALA ALA B . n B 1 33 GLN 33 33 33 GLN GLN B . n B 1 34 TYR 34 34 34 TYR TYR B . n B 1 35 LEU 35 35 35 LEU LEU B . n B 1 36 ILE 36 36 36 ILE ILE B . n B 1 37 ASP 37 37 37 ASP ASP B . n B 1 38 GLN 38 38 38 GLN GLN B . n B 1 39 LEU 39 39 39 LEU LEU B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 ALA 41 41 41 ALA ALA B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 ALA 43 43 43 ALA ALA B . n B 1 44 ARG 44 44 44 ARG ARG B . n B 1 45 LYS 45 45 45 LYS LYS B . n B 1 46 GLY 46 46 46 GLY GLY B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 VAL 48 48 48 VAL VAL B . n B 1 49 ASN 49 49 49 ASN ASN B . n C 2 1 GLU 1 314 ? ? ? A . n C 2 2 GLY 2 315 ? ? ? A . n C 2 3 LYS 3 316 ? ? ? A . n C 2 4 SER 4 317 ? ? ? A . n C 2 5 GLU 5 318 ? ? ? A . n C 2 6 PHE 6 319 ? ? ? A . n C 2 7 ALA 7 320 320 ALA ALA A . n C 2 8 GLU 8 321 321 GLU GLU A . n C 2 9 ASN 9 322 322 ASN ASN A . n C 2 10 ASP 10 323 323 ASP ASP A . n C 2 11 ALA 11 324 324 ALA ALA A . n C 2 12 TYR 12 325 325 TYR TYR A . n C 2 13 VAL 13 326 326 VAL VAL A . n C 2 14 HIS 14 327 327 HIS HIS A . n C 2 15 ALA 15 328 328 ALA ALA A . n C 2 16 THR 16 329 329 THR THR A . n C 2 17 PRO 17 330 330 PRO PRO A . n C 2 18 LEU 18 331 331 LEU LEU A . n C 2 19 ILE 19 332 332 ILE ILE A . n C 2 20 ARG 20 333 333 ARG ARG A . n C 2 21 ARG 21 334 334 ARG ARG A . n C 2 22 LEU 22 335 335 LEU LEU A . n C 2 23 ALA 23 336 336 ALA ALA A . n C 2 24 ARG 24 337 337 ARG ARG A . n C 2 25 GLU 25 338 338 GLU GLU A . n C 2 26 PHE 26 339 339 PHE PHE A . n C 2 27 GLY 27 340 340 GLY GLY A . n C 2 28 VAL 28 341 341 VAL VAL A . n C 2 29 ASN 29 342 342 ASN ASN A . n C 2 30 LEU 30 343 343 LEU LEU A . n C 2 31 ALA 31 344 344 ALA ALA A . n C 2 32 LYS 32 345 345 LYS LYS A . n C 2 33 VAL 33 346 346 VAL VAL A . n C 2 34 LYS 34 347 347 LYS LYS A . n C 2 35 GLY 35 348 348 GLY GLY A . n C 2 36 THR 36 349 349 THR THR A . n C 2 37 GLY 37 350 350 GLY GLY A . n C 2 38 ARG 38 351 351 ARG ARG A . n C 2 39 LYS 39 352 352 LYS LYS A . n C 2 40 GLY 40 353 353 GLY GLY A . n C 2 41 ARG 41 354 354 ARG ARG A . n C 2 42 ILE 42 355 355 ILE ILE A . n C 2 43 LEU 43 356 356 LEU LEU A . n C 2 44 ARG 44 357 357 ARG ARG A . n C 2 45 GLU 45 358 358 GLU GLU A . n C 2 46 ASP 46 359 359 ASP ASP A . n C 2 47 VAL 47 360 360 VAL VAL A . n C 2 48 GLN 48 361 361 GLN GLN A . n C 2 49 ALA 49 362 362 ALA ALA A . n C 2 50 TYR 50 363 363 TYR TYR A . n C 2 51 VAL 51 364 364 VAL VAL A . n C 2 52 LYS 52 365 365 LYS LYS A . n C 2 53 GLU 53 366 366 GLU GLU A . n C 2 54 ALA 54 367 367 ALA ALA A . n C 2 55 ILE 55 368 368 ILE ILE A . n C 2 56 LYS 56 369 369 LYS LYS A . n C 2 57 ARG 57 370 370 ARG ARG A . n C 2 58 ALA 58 371 371 ALA ALA A . n C 2 59 GLU 59 372 372 GLU GLU A . n C 2 60 ALA 60 373 373 ALA ALA A . n C 2 61 ALA 61 374 374 ALA ALA A . n C 2 62 PRO 62 375 ? ? ? A . n C 2 63 ALA 63 376 ? ? ? A . n C 2 64 ALA 64 377 ? ? ? A . n C 2 65 THR 65 378 ? ? ? A . n C 2 66 GLY 66 379 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 HOH 1 101 60 HOH HOH C . D 3 HOH 2 102 111 HOH HOH C . D 3 HOH 3 103 35 HOH HOH C . D 3 HOH 4 104 82 HOH HOH C . D 3 HOH 5 105 64 HOH HOH C . D 3 HOH 6 106 62 HOH HOH C . D 3 HOH 7 107 18 HOH HOH C . D 3 HOH 8 108 29 HOH HOH C . D 3 HOH 9 109 70 HOH HOH C . D 3 HOH 10 110 39 HOH HOH C . D 3 HOH 11 111 7 HOH HOH C . D 3 HOH 12 112 26 HOH HOH C . D 3 HOH 13 113 21 HOH HOH C . D 3 HOH 14 114 38 HOH HOH C . D 3 HOH 15 115 57 HOH HOH C . D 3 HOH 16 116 104 HOH HOH C . D 3 HOH 17 117 106 HOH HOH C . D 3 HOH 18 118 15 HOH HOH C . D 3 HOH 19 119 75 HOH HOH C . D 3 HOH 20 120 76 HOH HOH C . D 3 HOH 21 121 102 HOH HOH C . D 3 HOH 22 122 105 HOH HOH C . E 3 HOH 1 101 58 HOH HOH B . E 3 HOH 2 102 49 HOH HOH B . E 3 HOH 3 103 59 HOH HOH B . E 3 HOH 4 104 118 HOH HOH B . E 3 HOH 5 105 83 HOH HOH B . E 3 HOH 6 106 68 HOH HOH B . E 3 HOH 7 107 45 HOH HOH B . E 3 HOH 8 108 6 HOH HOH B . E 3 HOH 9 109 1 HOH HOH B . E 3 HOH 10 110 4 HOH HOH B . E 3 HOH 11 111 14 HOH HOH B . E 3 HOH 12 112 2 HOH HOH B . E 3 HOH 13 113 110 HOH HOH B . E 3 HOH 14 114 46 HOH HOH B . E 3 HOH 15 115 54 HOH HOH B . E 3 HOH 16 116 10 HOH HOH B . E 3 HOH 17 117 77 HOH HOH B . E 3 HOH 18 118 50 HOH HOH B . E 3 HOH 19 119 80 HOH HOH B . E 3 HOH 20 120 56 HOH HOH B . E 3 HOH 21 121 32 HOH HOH B . E 3 HOH 22 122 85 HOH HOH B . E 3 HOH 23 123 61 HOH HOH B . E 3 HOH 24 124 93 HOH HOH B . E 3 HOH 25 125 94 HOH HOH B . E 3 HOH 26 126 47 HOH HOH B . E 3 HOH 27 127 51 HOH HOH B . E 3 HOH 28 128 81 HOH HOH B . E 3 HOH 29 129 55 HOH HOH B . F 3 HOH 1 401 79 HOH HOH A . F 3 HOH 2 402 44 HOH HOH A . F 3 HOH 3 403 120 HOH HOH A . F 3 HOH 4 404 116 HOH HOH A . F 3 HOH 5 405 27 HOH HOH A . F 3 HOH 6 406 114 HOH HOH A . F 3 HOH 7 407 22 HOH HOH A . F 3 HOH 8 408 109 HOH HOH A . F 3 HOH 9 409 41 HOH HOH A . F 3 HOH 10 410 40 HOH HOH A . F 3 HOH 11 411 92 HOH HOH A . F 3 HOH 12 412 20 HOH HOH A . F 3 HOH 13 413 5 HOH HOH A . F 3 HOH 14 414 25 HOH HOH A . F 3 HOH 15 415 37 HOH HOH A . F 3 HOH 16 416 95 HOH HOH A . F 3 HOH 17 417 24 HOH HOH A . F 3 HOH 18 418 8 HOH HOH A . F 3 HOH 19 419 103 HOH HOH A . F 3 HOH 20 420 52 HOH HOH A . F 3 HOH 21 421 9 HOH HOH A . F 3 HOH 22 422 31 HOH HOH A . F 3 HOH 23 423 90 HOH HOH A . F 3 HOH 24 424 91 HOH HOH A . F 3 HOH 25 425 3 HOH HOH A . F 3 HOH 26 426 11 HOH HOH A . F 3 HOH 27 427 28 HOH HOH A . F 3 HOH 28 428 43 HOH HOH A . F 3 HOH 29 429 30 HOH HOH A . F 3 HOH 30 430 113 HOH HOH A . F 3 HOH 31 431 73 HOH HOH A . F 3 HOH 32 432 42 HOH HOH A . F 3 HOH 33 433 53 HOH HOH A . F 3 HOH 34 434 23 HOH HOH A . F 3 HOH 35 435 19 HOH HOH A . F 3 HOH 36 436 13 HOH HOH A . F 3 HOH 37 437 89 HOH HOH A . F 3 HOH 38 438 69 HOH HOH A . F 3 HOH 39 439 66 HOH HOH A . F 3 HOH 40 440 12 HOH HOH A . F 3 HOH 41 441 63 HOH HOH A . F 3 HOH 42 442 101 HOH HOH A . F 3 HOH 43 443 16 HOH HOH A . F 3 HOH 44 444 36 HOH HOH A . F 3 HOH 45 445 71 HOH HOH A . F 3 HOH 46 446 97 HOH HOH A . F 3 HOH 47 447 74 HOH HOH A . F 3 HOH 48 448 96 HOH HOH A . F 3 HOH 49 449 86 HOH HOH A . F 3 HOH 50 450 33 HOH HOH A . F 3 HOH 51 451 108 HOH HOH A . F 3 HOH 52 452 88 HOH HOH A . F 3 HOH 53 453 65 HOH HOH A . F 3 HOH 54 454 119 HOH HOH A . F 3 HOH 55 455 99 HOH HOH A . F 3 HOH 56 456 100 HOH HOH A . F 3 HOH 57 457 121 HOH HOH A . F 3 HOH 58 458 122 HOH HOH A . F 3 HOH 59 459 78 HOH HOH A . F 3 HOH 60 460 112 HOH HOH A . F 3 HOH 61 461 67 HOH HOH A . F 3 HOH 62 462 117 HOH HOH A . F 3 HOH 63 463 72 HOH HOH A . F 3 HOH 64 464 124 HOH HOH A . F 3 HOH 65 465 84 HOH HOH A . F 3 HOH 66 466 107 HOH HOH A . F 3 HOH 67 467 87 HOH HOH A . F 3 HOH 68 468 17 HOH HOH A . F 3 HOH 69 469 48 HOH HOH A . F 3 HOH 70 470 98 HOH HOH A . F 3 HOH 71 471 34 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9H1N _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.262 _cell.length_a_esd ? _cell.length_b 87.262 _cell.length_b_esd ? _cell.length_c 42.341 _cell.length_c_esd ? _cell.volume 322412.177 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9H1N _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9H1N _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.18 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '56% Tacsimate pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-07-12 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.999990 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.999990 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 32.63 _reflns.entry_id 9H1N _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.54 _reflns.d_resolution_low 39.02 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24525 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.87 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.07 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.01691 _reflns.pdbx_Rpim_I_all 0.01196 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.01196 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.54 _reflns_shell.d_res_low 1.6 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2383 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.8738 _reflns_shell.pdbx_Rpim_I_all 0.6179 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.546 _reflns_shell.pdbx_CC_star 0.84 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.0 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.6179 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 42.99 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9H1N _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.54 _refine.ls_d_res_low 39.02 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24522 _refine.ls_number_reflns_R_free 1215 _refine.ls_number_reflns_R_work 23307 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 4.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2052 _refine.ls_R_factor_R_free 0.2265 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2040 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.9559 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2238 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.54 _refine_hist.d_res_low 39.02 _refine_hist.number_atoms_solvent 122 _refine_hist.number_atoms_total 1304 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1182 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0121 ? 1239 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.2356 ? 1679 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0789 ? 185 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0114 ? 227 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 4.1904 ? 179 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.54 1.61 . . 113 2526 99.10 . . . . 0.3824 . . . . . . . . . . . 0.3803 'X-RAY DIFFRACTION' 1.61 1.68 . . 141 2545 99.96 . . . . 0.3099 . . . . . . . . . . . 0.3245 'X-RAY DIFFRACTION' 1.68 1.77 . . 116 2578 99.96 . . . . 0.2610 . . . . . . . . . . . 0.3077 'X-RAY DIFFRACTION' 1.77 1.88 . . 136 2533 100.00 . . . . 0.2533 . . . . . . . . . . . 0.3014 'X-RAY DIFFRACTION' 1.88 2.02 . . 151 2562 100.00 . . . . 0.2430 . . . . . . . . . . . 0.3042 'X-RAY DIFFRACTION' 2.02 2.23 . . 156 2542 100.00 . . . . 0.2096 . . . . . . . . . . . 0.2253 'X-RAY DIFFRACTION' 2.23 2.55 . . 132 2602 100.00 . . . . 0.2072 . . . . . . . . . . . 0.2565 'X-RAY DIFFRACTION' 2.55 3.21 . . 137 2639 100.00 . . . . 0.2113 . . . . . . . . . . . 0.2406 'X-RAY DIFFRACTION' 3.21 39.02 . . 133 2780 99.86 . . . . 0.1789 . . . . . . . . . . . 0.1829 # _struct.entry_id 9H1N _struct.title 'Dihydrolipoamide Acetyltransferase (E2) PSBD in complex with the Pyruvate Dehydrogenase (E1) binding domain from E. coli' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9H1N _struct_keywords.text 'Complex, pyruvate dehydrogenase, OXIDOREDUCTASE, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ODP1_ECOLI P0AFG8 ? 1 SERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEARKGGVN 2 2 UNP ODP2_ECOLI P06959 ? 2 EGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAATG 315 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9H1N C 1 ? 49 ? P0AFG8 2 ? 50 ? 1 49 2 1 9H1N B 1 ? 49 ? P0AFG8 2 ? 50 ? 1 49 3 2 9H1N A 1 ? 66 ? P06959 315 ? 380 ? 314 379 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 1 2 A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -21.1705000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 9 ? GLY A 28 ? ASP C 9 GLY C 28 1 ? 20 HELX_P HELX_P2 AA2 GLY A 28 ? GLY A 47 ? GLY C 28 GLY C 47 1 ? 20 HELX_P HELX_P3 AA3 ASP B 9 ? GLY B 28 ? ASP B 9 GLY B 28 1 ? 20 HELX_P HELX_P4 AA4 GLY B 28 ? GLY B 46 ? GLY B 28 GLY B 46 1 ? 19 HELX_P HELX_P5 AA5 GLU C 8 ? TYR C 12 ? GLU A 321 TYR A 325 5 ? 5 HELX_P HELX_P6 AA6 THR C 16 ? GLY C 27 ? THR A 329 GLY A 340 1 ? 12 HELX_P HELX_P7 AA7 ASN C 29 ? VAL C 33 ? ASN A 342 VAL A 346 5 ? 5 HELX_P HELX_P8 AA8 GLY C 37 ? ARG C 41 ? GLY A 350 ARG A 354 5 ? 5 HELX_P HELX_P9 AA9 LEU C 43 ? GLU C 59 ? LEU A 356 GLU A 372 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9H1N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 C _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 120 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 460 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_455 _pdbx_validate_symm_contact.dist 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP C 9 ? ? -155.14 77.24 2 1 ASP B 7 ? ? -39.21 110.12 3 1 ASP B 9 ? ? -154.13 77.59 4 1 GLU A 372 ? ? -68.51 4.17 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B HOH 115 ? E HOH . 2 1 B HOH 120 ? E HOH . 3 1 B HOH 129 ? E HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C SER 1 ? A SER 1 2 1 Y 1 C GLU 2 ? A GLU 2 3 1 Y 1 C ARG 3 ? A ARG 3 4 1 Y 1 B SER 1 ? B SER 1 5 1 Y 1 B GLU 2 ? B GLU 2 6 1 Y 1 A GLU 314 ? C GLU 1 7 1 Y 1 A GLY 315 ? C GLY 2 8 1 Y 1 A LYS 316 ? C LYS 3 9 1 Y 1 A SER 317 ? C SER 4 10 1 Y 1 A GLU 318 ? C GLU 5 11 1 Y 1 A PHE 319 ? C PHE 6 12 1 Y 1 A PRO 375 ? C PRO 62 13 1 Y 1 A ALA 376 ? C ALA 63 14 1 Y 1 A ALA 377 ? C ALA 64 15 1 Y 1 A THR 378 ? C THR 65 16 1 Y 1 A GLY 379 ? C GLY 66 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 TRP N N N N 287 TRP CA C N S 288 TRP C C N N 289 TRP O O N N 290 TRP CB C N N 291 TRP CG C Y N 292 TRP CD1 C Y N 293 TRP CD2 C Y N 294 TRP NE1 N Y N 295 TRP CE2 C Y N 296 TRP CE3 C Y N 297 TRP CZ2 C Y N 298 TRP CZ3 C Y N 299 TRP CH2 C Y N 300 TRP OXT O N N 301 TRP H H N N 302 TRP H2 H N N 303 TRP HA H N N 304 TRP HB2 H N N 305 TRP HB3 H N N 306 TRP HD1 H N N 307 TRP HE1 H N N 308 TRP HE3 H N N 309 TRP HZ2 H N N 310 TRP HZ3 H N N 311 TRP HH2 H N N 312 TRP HXT H N N 313 TYR N N N N 314 TYR CA C N S 315 TYR C C N N 316 TYR O O N N 317 TYR CB C N N 318 TYR CG C Y N 319 TYR CD1 C Y N 320 TYR CD2 C Y N 321 TYR CE1 C Y N 322 TYR CE2 C Y N 323 TYR CZ C Y N 324 TYR OH O N N 325 TYR OXT O N N 326 TYR H H N N 327 TYR H2 H N N 328 TYR HA H N N 329 TYR HB2 H N N 330 TYR HB3 H N N 331 TYR HD1 H N N 332 TYR HD2 H N N 333 TYR HE1 H N N 334 TYR HE2 H N N 335 TYR HH H N N 336 TYR HXT H N N 337 VAL N N N N 338 VAL CA C N S 339 VAL C C N N 340 VAL O O N N 341 VAL CB C N N 342 VAL CG1 C N N 343 VAL CG2 C N N 344 VAL OXT O N N 345 VAL H H N N 346 VAL H2 H N N 347 VAL HA H N N 348 VAL HB H N N 349 VAL HG11 H N N 350 VAL HG12 H N N 351 VAL HG13 H N N 352 VAL HG21 H N N 353 VAL HG22 H N N 354 VAL HG23 H N N 355 VAL HXT H N N 356 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 PHE N CA sing N N 205 PHE N H sing N N 206 PHE N H2 sing N N 207 PHE CA C sing N N 208 PHE CA CB sing N N 209 PHE CA HA sing N N 210 PHE C O doub N N 211 PHE C OXT sing N N 212 PHE CB CG sing N N 213 PHE CB HB2 sing N N 214 PHE CB HB3 sing N N 215 PHE CG CD1 doub Y N 216 PHE CG CD2 sing Y N 217 PHE CD1 CE1 sing Y N 218 PHE CD1 HD1 sing N N 219 PHE CD2 CE2 doub Y N 220 PHE CD2 HD2 sing N N 221 PHE CE1 CZ doub Y N 222 PHE CE1 HE1 sing N N 223 PHE CE2 CZ sing Y N 224 PHE CE2 HE2 sing N N 225 PHE CZ HZ sing N N 226 PHE OXT HXT sing N N 227 PRO N CA sing N N 228 PRO N CD sing N N 229 PRO N H sing N N 230 PRO CA C sing N N 231 PRO CA CB sing N N 232 PRO CA HA sing N N 233 PRO C O doub N N 234 PRO C OXT sing N N 235 PRO CB CG sing N N 236 PRO CB HB2 sing N N 237 PRO CB HB3 sing N N 238 PRO CG CD sing N N 239 PRO CG HG2 sing N N 240 PRO CG HG3 sing N N 241 PRO CD HD2 sing N N 242 PRO CD HD3 sing N N 243 PRO OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TRP N CA sing N N 274 TRP N H sing N N 275 TRP N H2 sing N N 276 TRP CA C sing N N 277 TRP CA CB sing N N 278 TRP CA HA sing N N 279 TRP C O doub N N 280 TRP C OXT sing N N 281 TRP CB CG sing N N 282 TRP CB HB2 sing N N 283 TRP CB HB3 sing N N 284 TRP CG CD1 doub Y N 285 TRP CG CD2 sing Y N 286 TRP CD1 NE1 sing Y N 287 TRP CD1 HD1 sing N N 288 TRP CD2 CE2 doub Y N 289 TRP CD2 CE3 sing Y N 290 TRP NE1 CE2 sing Y N 291 TRP NE1 HE1 sing N N 292 TRP CE2 CZ2 sing Y N 293 TRP CE3 CZ3 doub Y N 294 TRP CE3 HE3 sing N N 295 TRP CZ2 CH2 doub Y N 296 TRP CZ2 HZ2 sing N N 297 TRP CZ3 CH2 sing Y N 298 TRP CZ3 HZ3 sing N N 299 TRP CH2 HH2 sing N N 300 TRP OXT HXT sing N N 301 TYR N CA sing N N 302 TYR N H sing N N 303 TYR N H2 sing N N 304 TYR CA C sing N N 305 TYR CA CB sing N N 306 TYR CA HA sing N N 307 TYR C O doub N N 308 TYR C OXT sing N N 309 TYR CB CG sing N N 310 TYR CB HB2 sing N N 311 TYR CB HB3 sing N N 312 TYR CG CD1 doub Y N 313 TYR CG CD2 sing Y N 314 TYR CD1 CE1 sing Y N 315 TYR CD1 HD1 sing N N 316 TYR CD2 CE2 doub Y N 317 TYR CD2 HD2 sing N N 318 TYR CE1 CZ doub Y N 319 TYR CE1 HE1 sing N N 320 TYR CE2 CZ sing Y N 321 TYR CE2 HE2 sing N N 322 TYR CZ OH sing N N 323 TYR OH HH sing N N 324 TYR OXT HXT sing N N 325 VAL N CA sing N N 326 VAL N H sing N N 327 VAL N H2 sing N N 328 VAL CA C sing N N 329 VAL CA CB sing N N 330 VAL CA HA sing N N 331 VAL C O doub N N 332 VAL C OXT sing N N 333 VAL CB CG1 sing N N 334 VAL CB CG2 sing N N 335 VAL CB HB sing N N 336 VAL CG1 HG11 sing N N 337 VAL CG1 HG12 sing N N 338 VAL CG1 HG13 sing N N 339 VAL CG2 HG21 sing N N 340 VAL CG2 HG22 sing N N 341 VAL CG2 HG23 sing N N 342 VAL OXT HXT sing N N 343 # _pdbx_audit_support.funding_organization 'Swiss National Science Foundation' _pdbx_audit_support.country Switzerland _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list 1,2,3 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4qoy _pdbx_initial_refinement_model.details 'from 4qoy: full chain F, only residues 4-49 of chains C,D' # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9H1N _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011460 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011460 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023618 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #