data_9HDA # _entry.id 9HDA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.407 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9HDA pdb_00009hda 10.2210/pdb9hda/pdb WWPDB D_1292141467 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-11-19 ? 2 'Structure model' 1 1 2025-12-03 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9HDA _pdbx_database_status.recvd_initial_deposition_date 2024-11-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email sebastian.guettler@icr.ac.uk _pdbx_contact_author.name_first Sebastian _pdbx_contact_author.name_last Guettler _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3135-1546 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Casale, G.' 1 0000-0001-5056-8831 'Le Bihan, Y.-V.' 2 0000-0002-6850-9706 'Van Montfort, R.L.M.' 3 0000-0002-5688-3450 'Guettler, S.' 4 0000-0002-3135-1546 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 15 _citation.language ? _citation.page_first 40922 _citation.page_last 40922 _citation.title 'Discovery of first-in-class inhibitors of the TRF1:TIN2 protein:protein interaction by fragment screening.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-025-23858-3 _citation.pdbx_database_id_PubMed 41266376 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Casale, G.' 1 ? primary 'Liu, M.' 2 ? primary 'Le Bihan, Y.V.' 3 ? primary 'Inian, O.' 4 ? primary 'Stammers, E.' 5 ? primary 'Caldwell, J.' 6 ? primary 'van Montfort, R.L.M.' 7 ? primary 'Collins, I.' 8 ? primary 'Guettler, S.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Telomeric repeat-binding factor 1' 25556.039 1 ? ? ? ? 2 non-polymer syn 4-IODOPYRAZOLE 193.974 2 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 3 ? ? ? ? 4 water nat water 18.015 42 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NIMA-interacting protein 2,TTAGGG repeat-binding factor 1,Telomeric protein Pin2/TRF1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIY ICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDP NSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKR ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIY ICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDP NSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 4-IODOPYRAZOLE PYZ 3 1,2-ETHANEDIOL EDO 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 GLN n 1 5 VAL n 1 6 GLN n 1 7 VAL n 1 8 GLY n 1 9 ALA n 1 10 PRO n 1 11 GLU n 1 12 GLU n 1 13 GLU n 1 14 GLU n 1 15 GLU n 1 16 GLU n 1 17 GLU n 1 18 GLU n 1 19 ASP n 1 20 ALA n 1 21 GLY n 1 22 LEU n 1 23 VAL n 1 24 ALA n 1 25 GLU n 1 26 ALA n 1 27 GLU n 1 28 ALA n 1 29 VAL n 1 30 ALA n 1 31 ALA n 1 32 GLY n 1 33 TRP n 1 34 MET n 1 35 LEU n 1 36 ASP n 1 37 PHE n 1 38 LEU n 1 39 CYS n 1 40 LEU n 1 41 SER n 1 42 LEU n 1 43 CYS n 1 44 ARG n 1 45 ALA n 1 46 PHE n 1 47 ARG n 1 48 ASP n 1 49 GLY n 1 50 ARG n 1 51 SER n 1 52 GLU n 1 53 ASP n 1 54 PHE n 1 55 ARG n 1 56 ARG n 1 57 THR n 1 58 ARG n 1 59 ASN n 1 60 SER n 1 61 ALA n 1 62 GLU n 1 63 ALA n 1 64 ILE n 1 65 ILE n 1 66 HIS n 1 67 GLY n 1 68 LEU n 1 69 SER n 1 70 SER n 1 71 LEU n 1 72 THR n 1 73 ALA n 1 74 CYS n 1 75 GLN n 1 76 LEU n 1 77 ARG n 1 78 THR n 1 79 ILE n 1 80 TYR n 1 81 ILE n 1 82 CYS n 1 83 GLN n 1 84 PHE n 1 85 LEU n 1 86 THR n 1 87 ARG n 1 88 ILE n 1 89 ALA n 1 90 ALA n 1 91 GLY n 1 92 LYS n 1 93 THR n 1 94 LEU n 1 95 ASP n 1 96 ALA n 1 97 GLN n 1 98 PHE n 1 99 GLU n 1 100 ASN n 1 101 ASP n 1 102 GLU n 1 103 ARG n 1 104 ILE n 1 105 THR n 1 106 PRO n 1 107 LEU n 1 108 GLU n 1 109 SER n 1 110 ALA n 1 111 LEU n 1 112 MET n 1 113 ILE n 1 114 TRP n 1 115 GLY n 1 116 SER n 1 117 ILE n 1 118 GLU n 1 119 LYS n 1 120 GLU n 1 121 HIS n 1 122 ASP n 1 123 LYS n 1 124 LEU n 1 125 HIS n 1 126 GLU n 1 127 GLU n 1 128 ILE n 1 129 GLN n 1 130 ASN n 1 131 LEU n 1 132 ILE n 1 133 LYS n 1 134 ILE n 1 135 GLN n 1 136 ALA n 1 137 ILE n 1 138 ALA n 1 139 VAL n 1 140 CYS n 1 141 MET n 1 142 GLU n 1 143 ASN n 1 144 GLY n 1 145 ASN n 1 146 PHE n 1 147 LYS n 1 148 GLU n 1 149 ALA n 1 150 GLU n 1 151 GLU n 1 152 VAL n 1 153 PHE n 1 154 GLU n 1 155 ARG n 1 156 ILE n 1 157 PHE n 1 158 GLY n 1 159 ASP n 1 160 PRO n 1 161 ASN n 1 162 SER n 1 163 HIS n 1 164 MET n 1 165 PRO n 1 166 PHE n 1 167 LYS n 1 168 SER n 1 169 LYS n 1 170 LEU n 1 171 LEU n 1 172 MET n 1 173 ILE n 1 174 ILE n 1 175 SER n 1 176 GLN n 1 177 LYS n 1 178 ASP n 1 179 THR n 1 180 PHE n 1 181 HIS n 1 182 SER n 1 183 PHE n 1 184 PHE n 1 185 GLN n 1 186 HIS n 1 187 PHE n 1 188 SER n 1 189 TYR n 1 190 ASN n 1 191 HIS n 1 192 MET n 1 193 MET n 1 194 GLU n 1 195 LYS n 1 196 ILE n 1 197 LYS n 1 198 SER n 1 199 TYR n 1 200 VAL n 1 201 ASN n 1 202 TYR n 1 203 VAL n 1 204 LEU n 1 205 SER n 1 206 GLU n 1 207 LYS n 1 208 SER n 1 209 SER n 1 210 THR n 1 211 PHE n 1 212 LEU n 1 213 MET n 1 214 LYS n 1 215 ALA n 1 216 ALA n 1 217 ALA n 1 218 LYS n 1 219 VAL n 1 220 VAL n 1 221 GLU n 1 222 SER n 1 223 LYS n 1 224 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 224 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TERF1, PIN2, TRBF1, TRF, TRF1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-CodonPlus(DE3)-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET His6 MBP Asn10 TEV LIC' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PYZ non-polymer . 4-IODOPYRAZOLE ? 'C3 H3 I N2' 193.974 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 45 ? ? ? A . n A 1 2 ASN 2 46 ? ? ? A . n A 1 3 ALA 3 47 ? ? ? A . n A 1 4 GLN 4 48 ? ? ? A . n A 1 5 VAL 5 49 ? ? ? A . n A 1 6 GLN 6 50 ? ? ? A . n A 1 7 VAL 7 51 ? ? ? A . n A 1 8 GLY 8 52 ? ? ? A . n A 1 9 ALA 9 53 ? ? ? A . n A 1 10 PRO 10 54 ? ? ? A . n A 1 11 GLU 11 55 ? ? ? A . n A 1 12 GLU 12 56 ? ? ? A . n A 1 13 GLU 13 57 ? ? ? A . n A 1 14 GLU 14 58 ? ? ? A . n A 1 15 GLU 15 59 59 GLU GLU A . n A 1 16 GLU 16 60 60 GLU GLU A . n A 1 17 GLU 17 61 61 GLU GLU A . n A 1 18 GLU 18 62 62 GLU GLU A . n A 1 19 ASP 19 63 63 ASP ASP A . n A 1 20 ALA 20 64 64 ALA ALA A . n A 1 21 GLY 21 65 65 GLY GLY A . n A 1 22 LEU 22 66 66 LEU LEU A . n A 1 23 VAL 23 67 67 VAL VAL A . n A 1 24 ALA 24 68 68 ALA ALA A . n A 1 25 GLU 25 69 69 GLU GLU A . n A 1 26 ALA 26 70 70 ALA ALA A . n A 1 27 GLU 27 71 71 GLU GLU A . n A 1 28 ALA 28 72 72 ALA ALA A . n A 1 29 VAL 29 73 73 VAL VAL A . n A 1 30 ALA 30 74 74 ALA ALA A . n A 1 31 ALA 31 75 75 ALA ALA A . n A 1 32 GLY 32 76 76 GLY GLY A . n A 1 33 TRP 33 77 77 TRP TRP A . n A 1 34 MET 34 78 78 MET MET A . n A 1 35 LEU 35 79 79 LEU LEU A . n A 1 36 ASP 36 80 80 ASP ASP A . n A 1 37 PHE 37 81 81 PHE PHE A . n A 1 38 LEU 38 82 82 LEU LEU A . n A 1 39 CYS 39 83 83 CYS CYS A . n A 1 40 LEU 40 84 84 LEU LEU A . n A 1 41 SER 41 85 85 SER SER A . n A 1 42 LEU 42 86 86 LEU LEU A . n A 1 43 CYS 43 87 87 CYS CYS A . n A 1 44 ARG 44 88 88 ARG ARG A . n A 1 45 ALA 45 89 89 ALA ALA A . n A 1 46 PHE 46 90 90 PHE PHE A . n A 1 47 ARG 47 91 91 ARG ARG A . n A 1 48 ASP 48 92 92 ASP ASP A . n A 1 49 GLY 49 93 93 GLY GLY A . n A 1 50 ARG 50 94 94 ARG ARG A . n A 1 51 SER 51 95 95 SER SER A . n A 1 52 GLU 52 96 96 GLU GLU A . n A 1 53 ASP 53 97 97 ASP ASP A . n A 1 54 PHE 54 98 98 PHE PHE A . n A 1 55 ARG 55 99 99 ARG ARG A . n A 1 56 ARG 56 100 100 ARG ARG A . n A 1 57 THR 57 101 101 THR THR A . n A 1 58 ARG 58 102 102 ARG ARG A . n A 1 59 ASN 59 103 103 ASN ASN A . n A 1 60 SER 60 104 104 SER SER A . n A 1 61 ALA 61 105 105 ALA ALA A . n A 1 62 GLU 62 106 106 GLU GLU A . n A 1 63 ALA 63 107 107 ALA ALA A . n A 1 64 ILE 64 108 108 ILE ILE A . n A 1 65 ILE 65 109 109 ILE ILE A . n A 1 66 HIS 66 110 110 HIS HIS A . n A 1 67 GLY 67 111 111 GLY GLY A . n A 1 68 LEU 68 112 112 LEU LEU A . n A 1 69 SER 69 113 113 SER SER A . n A 1 70 SER 70 114 114 SER SER A . n A 1 71 LEU 71 115 115 LEU LEU A . n A 1 72 THR 72 116 116 THR THR A . n A 1 73 ALA 73 117 117 ALA ALA A . n A 1 74 CYS 74 118 118 CYS CYS A . n A 1 75 GLN 75 119 119 GLN GLN A . n A 1 76 LEU 76 120 120 LEU LEU A . n A 1 77 ARG 77 121 121 ARG ARG A . n A 1 78 THR 78 122 122 THR THR A . n A 1 79 ILE 79 123 123 ILE ILE A . n A 1 80 TYR 80 124 124 TYR TYR A . n A 1 81 ILE 81 125 125 ILE ILE A . n A 1 82 CYS 82 126 126 CYS CYS A . n A 1 83 GLN 83 127 127 GLN GLN A . n A 1 84 PHE 84 128 128 PHE PHE A . n A 1 85 LEU 85 129 129 LEU LEU A . n A 1 86 THR 86 130 130 THR THR A . n A 1 87 ARG 87 131 131 ARG ARG A . n A 1 88 ILE 88 132 132 ILE ILE A . n A 1 89 ALA 89 133 133 ALA ALA A . n A 1 90 ALA 90 134 134 ALA ALA A . n A 1 91 GLY 91 135 135 GLY GLY A . n A 1 92 LYS 92 136 136 LYS LYS A . n A 1 93 THR 93 137 137 THR THR A . n A 1 94 LEU 94 138 138 LEU LEU A . n A 1 95 ASP 95 139 139 ASP ASP A . n A 1 96 ALA 96 140 140 ALA ALA A . n A 1 97 GLN 97 141 141 GLN GLN A . n A 1 98 PHE 98 142 142 PHE PHE A . n A 1 99 GLU 99 143 143 GLU GLU A . n A 1 100 ASN 100 144 144 ASN ASN A . n A 1 101 ASP 101 145 145 ASP ASP A . n A 1 102 GLU 102 146 146 GLU GLU A . n A 1 103 ARG 103 147 147 ARG ARG A . n A 1 104 ILE 104 148 148 ILE ILE A . n A 1 105 THR 105 149 149 THR THR A . n A 1 106 PRO 106 150 150 PRO PRO A . n A 1 107 LEU 107 151 151 LEU LEU A . n A 1 108 GLU 108 152 152 GLU GLU A . n A 1 109 SER 109 153 153 SER SER A . n A 1 110 ALA 110 154 154 ALA ALA A . n A 1 111 LEU 111 155 155 LEU LEU A . n A 1 112 MET 112 156 156 MET MET A . n A 1 113 ILE 113 157 157 ILE ILE A . n A 1 114 TRP 114 158 158 TRP TRP A . n A 1 115 GLY 115 159 159 GLY GLY A . n A 1 116 SER 116 160 160 SER SER A . n A 1 117 ILE 117 161 161 ILE ILE A . n A 1 118 GLU 118 162 162 GLU GLU A . n A 1 119 LYS 119 163 163 LYS LYS A . n A 1 120 GLU 120 164 164 GLU GLU A . n A 1 121 HIS 121 165 165 HIS HIS A . n A 1 122 ASP 122 166 166 ASP ASP A . n A 1 123 LYS 123 167 167 LYS LYS A . n A 1 124 LEU 124 168 168 LEU LEU A . n A 1 125 HIS 125 169 169 HIS HIS A . n A 1 126 GLU 126 170 170 GLU GLU A . n A 1 127 GLU 127 171 171 GLU GLU A . n A 1 128 ILE 128 172 172 ILE ILE A . n A 1 129 GLN 129 173 173 GLN GLN A . n A 1 130 ASN 130 174 174 ASN ASN A . n A 1 131 LEU 131 175 175 LEU LEU A . n A 1 132 ILE 132 176 176 ILE ILE A . n A 1 133 LYS 133 177 177 LYS LYS A . n A 1 134 ILE 134 178 178 ILE ILE A . n A 1 135 GLN 135 179 179 GLN GLN A . n A 1 136 ALA 136 180 180 ALA ALA A . n A 1 137 ILE 137 181 181 ILE ILE A . n A 1 138 ALA 138 182 182 ALA ALA A . n A 1 139 VAL 139 183 183 VAL VAL A . n A 1 140 CYS 140 184 184 CYS CYS A . n A 1 141 MET 141 185 185 MET MET A . n A 1 142 GLU 142 186 186 GLU GLU A . n A 1 143 ASN 143 187 187 ASN ASN A . n A 1 144 GLY 144 188 188 GLY GLY A . n A 1 145 ASN 145 189 189 ASN ASN A . n A 1 146 PHE 146 190 190 PHE PHE A . n A 1 147 LYS 147 191 191 LYS LYS A . n A 1 148 GLU 148 192 192 GLU GLU A . n A 1 149 ALA 149 193 193 ALA ALA A . n A 1 150 GLU 150 194 194 GLU GLU A . n A 1 151 GLU 151 195 195 GLU GLU A . n A 1 152 VAL 152 196 196 VAL VAL A . n A 1 153 PHE 153 197 197 PHE PHE A . n A 1 154 GLU 154 198 198 GLU GLU A . n A 1 155 ARG 155 199 199 ARG ARG A . n A 1 156 ILE 156 200 200 ILE ILE A . n A 1 157 PHE 157 201 201 PHE PHE A . n A 1 158 GLY 158 202 202 GLY GLY A . n A 1 159 ASP 159 203 ? ? ? A . n A 1 160 PRO 160 204 ? ? ? A . n A 1 161 ASN 161 205 ? ? ? A . n A 1 162 SER 162 206 ? ? ? A . n A 1 163 HIS 163 207 207 HIS HIS A . n A 1 164 MET 164 208 208 MET MET A . n A 1 165 PRO 165 209 209 PRO PRO A . n A 1 166 PHE 166 210 210 PHE PHE A . n A 1 167 LYS 167 211 211 LYS LYS A . n A 1 168 SER 168 212 212 SER SER A . n A 1 169 LYS 169 213 213 LYS LYS A . n A 1 170 LEU 170 214 214 LEU LEU A . n A 1 171 LEU 171 215 215 LEU LEU A . n A 1 172 MET 172 216 216 MET MET A . n A 1 173 ILE 173 217 217 ILE ILE A . n A 1 174 ILE 174 218 218 ILE ILE A . n A 1 175 SER 175 219 219 SER SER A . n A 1 176 GLN 176 220 220 GLN GLN A . n A 1 177 LYS 177 221 221 LYS LYS A . n A 1 178 ASP 178 222 222 ASP ASP A . n A 1 179 THR 179 223 223 THR THR A . n A 1 180 PHE 180 224 224 PHE PHE A . n A 1 181 HIS 181 225 225 HIS HIS A . n A 1 182 SER 182 226 226 SER SER A . n A 1 183 PHE 183 227 227 PHE PHE A . n A 1 184 PHE 184 228 228 PHE PHE A . n A 1 185 GLN 185 229 229 GLN GLN A . n A 1 186 HIS 186 230 230 HIS HIS A . n A 1 187 PHE 187 231 231 PHE PHE A . n A 1 188 SER 188 232 232 SER SER A . n A 1 189 TYR 189 233 233 TYR TYR A . n A 1 190 ASN 190 234 234 ASN ASN A . n A 1 191 HIS 191 235 235 HIS HIS A . n A 1 192 MET 192 236 236 MET MET A . n A 1 193 MET 193 237 237 MET MET A . n A 1 194 GLU 194 238 238 GLU GLU A . n A 1 195 LYS 195 239 239 LYS LYS A . n A 1 196 ILE 196 240 240 ILE ILE A . n A 1 197 LYS 197 241 241 LYS LYS A . n A 1 198 SER 198 242 242 SER SER A . n A 1 199 TYR 199 243 243 TYR TYR A . n A 1 200 VAL 200 244 244 VAL VAL A . n A 1 201 ASN 201 245 245 ASN ASN A . n A 1 202 TYR 202 246 246 TYR TYR A . n A 1 203 VAL 203 247 247 VAL VAL A . n A 1 204 LEU 204 248 248 LEU LEU A . n A 1 205 SER 205 249 249 SER SER A . n A 1 206 GLU 206 250 250 GLU GLU A . n A 1 207 LYS 207 251 251 LYS LYS A . n A 1 208 SER 208 252 252 SER SER A . n A 1 209 SER 209 253 253 SER SER A . n A 1 210 THR 210 254 254 THR THR A . n A 1 211 PHE 211 255 255 PHE PHE A . n A 1 212 LEU 212 256 256 LEU LEU A . n A 1 213 MET 213 257 257 MET MET A . n A 1 214 LYS 214 258 258 LYS LYS A . n A 1 215 ALA 215 259 259 ALA ALA A . n A 1 216 ALA 216 260 260 ALA ALA A . n A 1 217 ALA 217 261 261 ALA ALA A . n A 1 218 LYS 218 262 262 LYS LYS A . n A 1 219 VAL 219 263 263 VAL VAL A . n A 1 220 VAL 220 264 264 VAL VAL A . n A 1 221 GLU 221 265 265 GLU GLU A . n A 1 222 SER 222 266 266 SER SER A . n A 1 223 LYS 223 267 267 LYS LYS A . n A 1 224 ARG 224 268 268 ARG ARG A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PYZ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PYZ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PYZ 1 301 301 PYZ LIG A . C 2 PYZ 1 302 401 PYZ LIG A . D 3 EDO 1 303 402 EDO EDO A . E 3 EDO 1 304 403 EDO EDO A . F 3 EDO 1 305 59 EDO EDO A . G 4 HOH 1 401 1 HOH HOH A . G 4 HOH 2 402 19 HOH HOH A . G 4 HOH 3 403 46 HOH HOH A . G 4 HOH 4 404 53 HOH HOH A . G 4 HOH 5 405 7 HOH HOH A . G 4 HOH 6 406 22 HOH HOH A . G 4 HOH 7 407 21 HOH HOH A . G 4 HOH 8 408 14 HOH HOH A . G 4 HOH 9 409 2 HOH HOH A . G 4 HOH 10 410 58 HOH HOH A . G 4 HOH 11 411 17 HOH HOH A . G 4 HOH 12 412 26 HOH HOH A . G 4 HOH 13 413 39 HOH HOH A . G 4 HOH 14 414 9 HOH HOH A . G 4 HOH 15 415 34 HOH HOH A . G 4 HOH 16 416 11 HOH HOH A . G 4 HOH 17 417 57 HOH HOH A . G 4 HOH 18 418 43 HOH HOH A . G 4 HOH 19 419 23 HOH HOH A . G 4 HOH 20 420 33 HOH HOH A . G 4 HOH 21 421 4 HOH HOH A . G 4 HOH 22 422 51 HOH HOH A . G 4 HOH 23 423 15 HOH HOH A . G 4 HOH 24 424 3 HOH HOH A . G 4 HOH 25 425 52 HOH HOH A . G 4 HOH 26 426 29 HOH HOH A . G 4 HOH 27 427 20 HOH HOH A . G 4 HOH 28 428 31 HOH HOH A . G 4 HOH 29 429 28 HOH HOH A . G 4 HOH 30 430 36 HOH HOH A . G 4 HOH 31 431 12 HOH HOH A . G 4 HOH 32 432 40 HOH HOH A . G 4 HOH 33 433 32 HOH HOH A . G 4 HOH 34 434 41 HOH HOH A . G 4 HOH 35 435 27 HOH HOH A . G 4 HOH 36 436 49 HOH HOH A . G 4 HOH 37 437 18 HOH HOH A . G 4 HOH 38 438 45 HOH HOH A . G 4 HOH 39 439 44 HOH HOH A . G 4 HOH 40 440 16 HOH HOH A . G 4 HOH 41 441 13 HOH HOH A . G 4 HOH 42 442 24 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 59 ? CG ? A GLU 15 CG 2 1 Y 1 A GLU 59 ? CD ? A GLU 15 CD 3 1 Y 1 A GLU 59 ? OE1 ? A GLU 15 OE1 4 1 Y 1 A GLU 59 ? OE2 ? A GLU 15 OE2 5 1 Y 1 A GLU 60 ? CB ? A GLU 16 CB 6 1 Y 1 A GLU 60 ? CG ? A GLU 16 CG 7 1 Y 1 A GLU 60 ? CD ? A GLU 16 CD 8 1 Y 1 A GLU 60 ? OE1 ? A GLU 16 OE1 9 1 Y 1 A GLU 60 ? OE2 ? A GLU 16 OE2 10 1 Y 1 A GLU 61 ? CB ? A GLU 17 CB 11 1 Y 1 A GLU 61 ? CG ? A GLU 17 CG 12 1 Y 1 A GLU 61 ? CD ? A GLU 17 CD 13 1 Y 1 A GLU 61 ? OE1 ? A GLU 17 OE1 14 1 Y 1 A GLU 61 ? OE2 ? A GLU 17 OE2 15 1 Y 1 A GLU 62 ? CG ? A GLU 18 CG 16 1 Y 1 A GLU 62 ? CD ? A GLU 18 CD 17 1 Y 1 A GLU 62 ? OE1 ? A GLU 18 OE1 18 1 Y 1 A GLU 62 ? OE2 ? A GLU 18 OE2 19 1 Y 1 A ASP 63 ? CG ? A ASP 19 CG 20 1 Y 1 A ASP 63 ? OD1 ? A ASP 19 OD1 21 1 Y 1 A ASP 63 ? OD2 ? A ASP 19 OD2 22 1 Y 1 A ALA 64 ? CB ? A ALA 20 CB 23 1 Y 1 A LEU 84 ? CG ? A LEU 40 CG 24 1 Y 1 A LEU 84 ? CD1 ? A LEU 40 CD1 25 1 Y 1 A LEU 84 ? CD2 ? A LEU 40 CD2 26 1 Y 1 A ARG 88 ? NH1 ? A ARG 44 NH1 27 1 Y 1 A ARG 88 ? NH2 ? A ARG 44 NH2 28 1 Y 1 A GLN 141 ? CD ? A GLN 97 CD 29 1 Y 1 A GLN 141 ? OE1 ? A GLN 97 OE1 30 1 Y 1 A GLN 141 ? NE2 ? A GLN 97 NE2 31 1 Y 1 A GLU 146 ? CG ? A GLU 102 CG 32 1 Y 1 A GLU 146 ? CD ? A GLU 102 CD 33 1 Y 1 A GLU 146 ? OE1 ? A GLU 102 OE1 34 1 Y 1 A GLU 146 ? OE2 ? A GLU 102 OE2 35 1 Y 1 A ARG 147 ? CG ? A ARG 103 CG 36 1 Y 1 A ARG 147 ? CD ? A ARG 103 CD 37 1 Y 1 A ARG 147 ? NE ? A ARG 103 NE 38 1 Y 1 A ARG 147 ? CZ ? A ARG 103 CZ 39 1 Y 1 A ARG 147 ? NH1 ? A ARG 103 NH1 40 1 Y 1 A ARG 147 ? NH2 ? A ARG 103 NH2 41 1 Y 1 A MET 185 ? CE ? A MET 141 CE 42 1 Y 1 A LYS 191 ? CD ? A LYS 147 CD 43 1 Y 1 A LYS 191 ? CE ? A LYS 147 CE 44 1 Y 1 A LYS 191 ? NZ ? A LYS 147 NZ 45 1 Y 1 A GLU 194 ? CG ? A GLU 150 CG 46 1 Y 1 A GLU 194 ? CD ? A GLU 150 CD 47 1 Y 1 A GLU 194 ? OE1 ? A GLU 150 OE1 48 1 Y 1 A GLU 194 ? OE2 ? A GLU 150 OE2 49 1 Y 1 A GLU 198 ? CG ? A GLU 154 CG 50 1 Y 1 A GLU 198 ? CD ? A GLU 154 CD 51 1 Y 1 A GLU 198 ? OE1 ? A GLU 154 OE1 52 1 Y 1 A GLU 198 ? OE2 ? A GLU 154 OE2 53 1 Y 1 A HIS 207 ? CG ? A HIS 163 CG 54 1 Y 1 A HIS 207 ? ND1 ? A HIS 163 ND1 55 1 Y 1 A HIS 207 ? CD2 ? A HIS 163 CD2 56 1 Y 1 A HIS 207 ? CE1 ? A HIS 163 CE1 57 1 Y 1 A HIS 207 ? NE2 ? A HIS 163 NE2 58 1 Y 1 A MET 208 ? CG ? A MET 164 CG 59 1 Y 1 A MET 208 ? SD ? A MET 164 SD 60 1 Y 1 A MET 208 ? CE ? A MET 164 CE 61 1 Y 1 A PHE 210 ? CG ? A PHE 166 CG 62 1 Y 1 A PHE 210 ? CD1 ? A PHE 166 CD1 63 1 Y 1 A PHE 210 ? CD2 ? A PHE 166 CD2 64 1 Y 1 A PHE 210 ? CE1 ? A PHE 166 CE1 65 1 Y 1 A PHE 210 ? CE2 ? A PHE 166 CE2 66 1 Y 1 A PHE 210 ? CZ ? A PHE 166 CZ 67 1 Y 1 A LYS 211 ? CE ? A LYS 167 CE 68 1 Y 1 A LYS 211 ? NZ ? A LYS 167 NZ 69 1 Y 1 A LYS 213 ? CG ? A LYS 169 CG 70 1 Y 1 A LYS 213 ? CD ? A LYS 169 CD 71 1 Y 1 A LYS 213 ? CE ? A LYS 169 CE 72 1 Y 1 A LYS 213 ? NZ ? A LYS 169 NZ 73 1 Y 1 A MET 216 ? CG ? A MET 172 CG 74 1 Y 1 A MET 216 ? SD ? A MET 172 SD 75 1 Y 1 A MET 216 ? CE ? A MET 172 CE 76 1 Y 1 A SER 219 ? OG ? A SER 175 OG 77 1 Y 1 A GLN 220 ? CG ? A GLN 176 CG 78 1 Y 1 A GLN 220 ? CD ? A GLN 176 CD 79 1 Y 1 A GLN 220 ? OE1 ? A GLN 176 OE1 80 1 Y 1 A GLN 220 ? NE2 ? A GLN 176 NE2 81 1 Y 1 A LYS 221 ? CG ? A LYS 177 CG 82 1 Y 1 A LYS 221 ? CD ? A LYS 177 CD 83 1 Y 1 A LYS 221 ? CE ? A LYS 177 CE 84 1 Y 1 A LYS 221 ? NZ ? A LYS 177 NZ 85 1 Y 1 A ASP 222 ? OD1 ? A ASP 178 OD1 86 1 Y 1 A THR 223 ? OG1 ? A THR 179 OG1 87 1 Y 1 A THR 223 ? CG2 ? A THR 179 CG2 88 1 Y 1 A PHE 224 ? CB ? A PHE 180 CB 89 1 Y 1 A PHE 224 ? CG ? A PHE 180 CG 90 1 Y 1 A PHE 224 ? CD1 ? A PHE 180 CD1 91 1 Y 1 A PHE 224 ? CD2 ? A PHE 180 CD2 92 1 Y 1 A PHE 224 ? CE1 ? A PHE 180 CE1 93 1 Y 1 A PHE 224 ? CE2 ? A PHE 180 CE2 94 1 Y 1 A PHE 224 ? CZ ? A PHE 180 CZ 95 1 Y 1 A GLN 229 ? CG ? A GLN 185 CG 96 1 Y 1 A GLN 229 ? CD ? A GLN 185 CD 97 1 Y 1 A GLN 229 ? OE1 ? A GLN 185 OE1 98 1 Y 1 A GLN 229 ? NE2 ? A GLN 185 NE2 99 1 Y 1 A ASN 234 ? CG ? A ASN 190 CG 100 1 Y 1 A ASN 234 ? OD1 ? A ASN 190 OD1 101 1 Y 1 A ASN 234 ? ND2 ? A ASN 190 ND2 102 1 Y 1 A TYR 246 ? CG ? A TYR 202 CG 103 1 Y 1 A TYR 246 ? CD1 ? A TYR 202 CD1 104 1 Y 1 A TYR 246 ? CD2 ? A TYR 202 CD2 105 1 Y 1 A TYR 246 ? CE1 ? A TYR 202 CE1 106 1 Y 1 A TYR 246 ? CE2 ? A TYR 202 CE2 107 1 Y 1 A TYR 246 ? CZ ? A TYR 202 CZ 108 1 Y 1 A TYR 246 ? OH ? A TYR 202 OH 109 1 Y 1 A SER 249 ? OG ? A SER 205 OG 110 1 Y 1 A GLU 250 ? CG ? A GLU 206 CG 111 1 Y 1 A GLU 250 ? CD ? A GLU 206 CD 112 1 Y 1 A GLU 250 ? OE1 ? A GLU 206 OE1 113 1 Y 1 A GLU 250 ? OE2 ? A GLU 206 OE2 114 1 Y 1 A LYS 251 ? CG ? A LYS 207 CG 115 1 Y 1 A LYS 251 ? CD ? A LYS 207 CD 116 1 Y 1 A LYS 251 ? CE ? A LYS 207 CE 117 1 Y 1 A LYS 251 ? NZ ? A LYS 207 NZ 118 1 Y 1 A SER 253 ? OG ? A SER 209 OG 119 1 Y 0 A SER 253 ? CA B A SER 209 CA 120 1 Y 0 A SER 253 ? CB B A SER 209 CB 121 1 Y 1 A LYS 258 ? CG ? A LYS 214 CG 122 1 Y 1 A LYS 258 ? CD ? A LYS 214 CD 123 1 Y 1 A LYS 258 ? CE ? A LYS 214 CE 124 1 Y 1 A LYS 258 ? NZ ? A LYS 214 NZ 125 1 Y 1 A LYS 262 ? CD ? A LYS 218 CD 126 1 Y 1 A LYS 262 ? CE ? A LYS 218 CE 127 1 Y 1 A LYS 262 ? NZ ? A LYS 218 NZ 128 1 Y 1 A GLU 265 ? OE1 ? A GLU 221 OE1 129 1 Y 1 A GLU 265 ? OE2 ? A GLU 221 OE2 130 1 Y 1 A LYS 267 ? CG ? A LYS 223 CG 131 1 Y 1 A LYS 267 ? CD ? A LYS 223 CD 132 1 Y 1 A LYS 267 ? CE ? A LYS 223 CE 133 1 Y 1 A LYS 267 ? NZ ? A LYS 223 NZ 134 1 Y 1 A ARG 268 ? NE ? A ARG 224 NE 135 1 Y 1 A ARG 268 ? CZ ? A ARG 224 CZ 136 1 Y 1 A ARG 268 ? NH1 ? A ARG 224 NH1 137 1 Y 1 A ARG 268 ? NH2 ? A ARG 224 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.10.4 (23-JAN-2024)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9HDA _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.272 _cell.length_a_esd ? _cell.length_b 52.272 _cell.length_b_esd ? _cell.length_c 146.049 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9HDA _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9HDA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.98 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;150 nanoliter of TRF1 TRFH at 28.6 mg/mL plus 150 nanoliter of a crystallisation solution consisting of 0.1 M MES pH 6, 50 mM CaCl2 and 35-45 % PEG 200, against 35 microliter of crystallisation solution. ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-07-06 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9212 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9212 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04-1 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9HDA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.10 _reflns.d_resolution_low 52.27 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12580 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.97 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.110 _reflns.pdbx_Rpim_I_all 0.030 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 178320 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.106 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 14549 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 989 _reflns_shell.percent_possible_obs 100.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 14.7 _reflns_shell.pdbx_chi_squared 0.85 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.8 _reflns_shell.pdbx_Rrim_I_all 2.899 _reflns_shell.pdbx_Rpim_I_all 0.761 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.810 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.796 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -11.69440 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][2] -11.69440 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 23.38880 _refine.B_iso_max ? _refine.B_iso_mean 69.47 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.926 _refine.correlation_coeff_Fo_to_Fc_free 0.916 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9HDA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.100 _refine.ls_d_res_low 49.22 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12518 _refine.ls_number_reflns_R_free 649 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.0 _refine.ls_percent_reflns_R_free 5.180 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2343 _refine.ls_R_factor_R_free 0.2829 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2317 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.211 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.215 _refine.pdbx_overall_SU_R_Blow_DPI 0.262 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.247 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9HDA _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.32 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.100 _refine_hist.d_res_low 49.22 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 1589 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1523 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1581 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 0.79 ? 2131 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 535 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 274 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1581 ? t_it 10.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.24 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 17.02 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 220 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 3 ? t_sum_occupancies 1.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1237 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.10 _refine_ls_shell.d_res_low 2.12 _refine_ls_shell.number_reflns_all 392 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work 373 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free 4.85 _refine_ls_shell.R_factor_all 0.3485 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3527 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 33 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.2684 # _struct.entry_id 9HDA _struct.title 'Crystal structure of human TRF1 TRFH domain in complex with compound 58' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9HDA _struct_keywords.text 'Telomere, Inhibitor, Shelterin, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TERF1_HUMAN _struct_ref.pdbx_db_accession P54274 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQ FLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSH MPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKR ; _struct_ref.pdbx_align_begin 48 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9HDA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 224 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54274 _struct_ref_seq.db_align_beg 48 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 268 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 48 _struct_ref_seq.pdbx_auth_seq_align_end 268 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9HDA SER A 1 ? UNP P54274 ? ? 'expression tag' 45 1 1 9HDA ASN A 2 ? UNP P54274 ? ? 'expression tag' 46 2 1 9HDA ALA A 3 ? UNP P54274 ? ? 'expression tag' 47 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4860 ? 1 MORE -13 ? 1 'SSA (A^2)' 19920 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 15 ? GLY A 49 ? GLU A 59 GLY A 93 1 ? 35 HELX_P HELX_P2 AA2 ARG A 50 ? GLY A 67 ? ARG A 94 GLY A 111 1 ? 18 HELX_P HELX_P3 AA3 THR A 72 ? ALA A 90 ? THR A 116 ALA A 134 1 ? 19 HELX_P HELX_P4 AA4 THR A 105 ? GLY A 115 ? THR A 149 GLY A 159 1 ? 11 HELX_P HELX_P5 AA5 ASP A 122 ? ASN A 143 ? ASP A 166 ASN A 187 1 ? 22 HELX_P HELX_P6 AA6 ASN A 145 ? PHE A 157 ? ASN A 189 PHE A 201 1 ? 13 HELX_P HELX_P7 AA7 MET A 164 ? LYS A 177 ? MET A 208 LYS A 221 1 ? 14 HELX_P HELX_P8 AA8 HIS A 181 ? PHE A 187 ? HIS A 225 PHE A 231 1 ? 7 HELX_P HELX_P9 AA9 SER A 188 ? GLU A 206 ? SER A 232 GLU A 250 1 ? 19 HELX_P HELX_P10 AB1 THR A 210 ? SER A 222 ? THR A 254 SER A 266 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9HDA _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 224 ? ? -83.89 45.12 2 1 PHE A 231 ? ? -109.73 65.89 3 1 SER A 253 ? ? 57.13 108.81 4 1 SER A 253 ? ? 57.37 108.73 5 1 SER A 266 ? ? -67.63 2.27 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 22.4854 _pdbx_refine_tls.origin_y 6.3578 _pdbx_refine_tls.origin_z 16.1212 _pdbx_refine_tls.T[1][1] -0.3704 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0367 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0728 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] -0.6736 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0316 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.4519 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.9987 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.6830 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 1.8388 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.4866 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.3518 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.8488 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0598 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0424 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0735 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.2008 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0817 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0273 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.2290 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.1576 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0219 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{A|63 - 266}' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 45 ? A SER 1 2 1 Y 1 A ASN 46 ? A ASN 2 3 1 Y 1 A ALA 47 ? A ALA 3 4 1 Y 1 A GLN 48 ? A GLN 4 5 1 Y 1 A VAL 49 ? A VAL 5 6 1 Y 1 A GLN 50 ? A GLN 6 7 1 Y 1 A VAL 51 ? A VAL 7 8 1 Y 1 A GLY 52 ? A GLY 8 9 1 Y 1 A ALA 53 ? A ALA 9 10 1 Y 1 A PRO 54 ? A PRO 10 11 1 Y 1 A GLU 55 ? A GLU 11 12 1 Y 1 A GLU 56 ? A GLU 12 13 1 Y 1 A GLU 57 ? A GLU 13 14 1 Y 1 A GLU 58 ? A GLU 14 15 1 Y 1 A ASP 203 ? A ASP 159 16 1 Y 1 A PRO 204 ? A PRO 160 17 1 Y 1 A ASN 205 ? A ASN 161 18 1 Y 1 A SER 206 ? A SER 162 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 PHE N N N N 260 PHE CA C N S 261 PHE C C N N 262 PHE O O N N 263 PHE CB C N N 264 PHE CG C Y N 265 PHE CD1 C Y N 266 PHE CD2 C Y N 267 PHE CE1 C Y N 268 PHE CE2 C Y N 269 PHE CZ C Y N 270 PHE OXT O N N 271 PHE H H N N 272 PHE H2 H N N 273 PHE HA H N N 274 PHE HB2 H N N 275 PHE HB3 H N N 276 PHE HD1 H N N 277 PHE HD2 H N N 278 PHE HE1 H N N 279 PHE HE2 H N N 280 PHE HZ H N N 281 PHE HXT H N N 282 PRO N N N N 283 PRO CA C N S 284 PRO C C N N 285 PRO O O N N 286 PRO CB C N N 287 PRO CG C N N 288 PRO CD C N N 289 PRO OXT O N N 290 PRO H H N N 291 PRO HA H N N 292 PRO HB2 H N N 293 PRO HB3 H N N 294 PRO HG2 H N N 295 PRO HG3 H N N 296 PRO HD2 H N N 297 PRO HD3 H N N 298 PRO HXT H N N 299 PYZ N1 N Y N 300 PYZ N2 N Y N 301 PYZ C3 C Y N 302 PYZ C4 C Y N 303 PYZ I4 I N N 304 PYZ C5 C Y N 305 PYZ HN1 H N N 306 PYZ H3 H N N 307 PYZ H5 H N N 308 SER N N N N 309 SER CA C N S 310 SER C C N N 311 SER O O N N 312 SER CB C N N 313 SER OG O N N 314 SER OXT O N N 315 SER H H N N 316 SER H2 H N N 317 SER HA H N N 318 SER HB2 H N N 319 SER HB3 H N N 320 SER HG H N N 321 SER HXT H N N 322 THR N N N N 323 THR CA C N S 324 THR C C N N 325 THR O O N N 326 THR CB C N R 327 THR OG1 O N N 328 THR CG2 C N N 329 THR OXT O N N 330 THR H H N N 331 THR H2 H N N 332 THR HA H N N 333 THR HB H N N 334 THR HG1 H N N 335 THR HG21 H N N 336 THR HG22 H N N 337 THR HG23 H N N 338 THR HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 PHE N CA sing N N 246 PHE N H sing N N 247 PHE N H2 sing N N 248 PHE CA C sing N N 249 PHE CA CB sing N N 250 PHE CA HA sing N N 251 PHE C O doub N N 252 PHE C OXT sing N N 253 PHE CB CG sing N N 254 PHE CB HB2 sing N N 255 PHE CB HB3 sing N N 256 PHE CG CD1 doub Y N 257 PHE CG CD2 sing Y N 258 PHE CD1 CE1 sing Y N 259 PHE CD1 HD1 sing N N 260 PHE CD2 CE2 doub Y N 261 PHE CD2 HD2 sing N N 262 PHE CE1 CZ doub Y N 263 PHE CE1 HE1 sing N N 264 PHE CE2 CZ sing Y N 265 PHE CE2 HE2 sing N N 266 PHE CZ HZ sing N N 267 PHE OXT HXT sing N N 268 PRO N CA sing N N 269 PRO N CD sing N N 270 PRO N H sing N N 271 PRO CA C sing N N 272 PRO CA CB sing N N 273 PRO CA HA sing N N 274 PRO C O doub N N 275 PRO C OXT sing N N 276 PRO CB CG sing N N 277 PRO CB HB2 sing N N 278 PRO CB HB3 sing N N 279 PRO CG CD sing N N 280 PRO CG HG2 sing N N 281 PRO CG HG3 sing N N 282 PRO CD HD2 sing N N 283 PRO CD HD3 sing N N 284 PRO OXT HXT sing N N 285 PYZ N1 N2 sing Y N 286 PYZ N1 C5 sing Y N 287 PYZ N1 HN1 sing N N 288 PYZ N2 C3 doub Y N 289 PYZ C3 C4 sing Y N 290 PYZ C3 H3 sing N N 291 PYZ C4 I4 sing N N 292 PYZ C4 C5 doub Y N 293 PYZ C5 H5 sing N N 294 SER N CA sing N N 295 SER N H sing N N 296 SER N H2 sing N N 297 SER CA C sing N N 298 SER CA CB sing N N 299 SER CA HA sing N N 300 SER C O doub N N 301 SER C OXT sing N N 302 SER CB OG sing N N 303 SER CB HB2 sing N N 304 SER CB HB3 sing N N 305 SER OG HG sing N N 306 SER OXT HXT sing N N 307 THR N CA sing N N 308 THR N H sing N N 309 THR N H2 sing N N 310 THR CA C sing N N 311 THR CA CB sing N N 312 THR CA HA sing N N 313 THR C O doub N N 314 THR C OXT sing N N 315 THR CB OG1 sing N N 316 THR CB CG2 sing N N 317 THR CB HB sing N N 318 THR OG1 HG1 sing N N 319 THR CG2 HG21 sing N N 320 THR CG2 HG22 sing N N 321 THR CG2 HG23 sing N N 322 THR OXT HXT sing N N 323 TRP N CA sing N N 324 TRP N H sing N N 325 TRP N H2 sing N N 326 TRP CA C sing N N 327 TRP CA CB sing N N 328 TRP CA HA sing N N 329 TRP C O doub N N 330 TRP C OXT sing N N 331 TRP CB CG sing N N 332 TRP CB HB2 sing N N 333 TRP CB HB3 sing N N 334 TRP CG CD1 doub Y N 335 TRP CG CD2 sing Y N 336 TRP CD1 NE1 sing Y N 337 TRP CD1 HD1 sing N N 338 TRP CD2 CE2 doub Y N 339 TRP CD2 CE3 sing Y N 340 TRP NE1 CE2 sing Y N 341 TRP NE1 HE1 sing N N 342 TRP CE2 CZ2 sing Y N 343 TRP CE3 CZ3 doub Y N 344 TRP CE3 HE3 sing N N 345 TRP CZ2 CH2 doub Y N 346 TRP CZ2 HZ2 sing N N 347 TRP CZ3 CH2 sing Y N 348 TRP CZ3 HZ3 sing N N 349 TRP CH2 HH2 sing N N 350 TRP OXT HXT sing N N 351 TYR N CA sing N N 352 TYR N H sing N N 353 TYR N H2 sing N N 354 TYR CA C sing N N 355 TYR CA CB sing N N 356 TYR CA HA sing N N 357 TYR C O doub N N 358 TYR C OXT sing N N 359 TYR CB CG sing N N 360 TYR CB HB2 sing N N 361 TYR CB HB3 sing N N 362 TYR CG CD1 doub Y N 363 TYR CG CD2 sing Y N 364 TYR CD1 CE1 sing Y N 365 TYR CD1 HD1 sing N N 366 TYR CD2 CE2 doub Y N 367 TYR CD2 HD2 sing N N 368 TYR CE1 CZ doub Y N 369 TYR CE1 HE1 sing N N 370 TYR CE2 CZ sing Y N 371 TYR CE2 HE2 sing N N 372 TYR CZ OH sing N N 373 TYR OH HH sing N N 374 TYR OXT HXT sing N N 375 VAL N CA sing N N 376 VAL N H sing N N 377 VAL N H2 sing N N 378 VAL CA C sing N N 379 VAL CA CB sing N N 380 VAL CA HA sing N N 381 VAL C O doub N N 382 VAL C OXT sing N N 383 VAL CB CG1 sing N N 384 VAL CB CG2 sing N N 385 VAL CB HB sing N N 386 VAL CG1 HG11 sing N N 387 VAL CG1 HG12 sing N N 388 VAL CG1 HG13 sing N N 389 VAL CG2 HG21 sing N N 390 VAL CG2 HG22 sing N N 391 VAL CG2 HG23 sing N N 392 VAL OXT HXT sing N N 393 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 214311/Z/18/Z _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3BQO _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9HDA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.019131 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019131 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006847 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C I N O S # loop_ # loop_ #