data_9HDI # _entry.id 9HDI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9HDI pdb_00009hdi 10.2210/pdb9hdi/pdb WWPDB D_1292143066 ? ? BMRB 50124 ? 10.13018/BMR50124 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-08-20 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9HDI _pdbx_database_status.recvd_initial_deposition_date 2024-11-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 50124 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 1 _pdbx_contact_author.email hans-robert.kalbitzer@biologie.uni-regensburg.de _pdbx_contact_author.name_first 'Hans Robert' _pdbx_contact_author.name_last Kalbitzer _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6514-2355 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Munte, C.E.' 1 0000-0002-7937-2645 'Kalbitzer, H.R.' 2 0000-0002-6514-2355 'Kreitner, R.R.' 3 ? 'Stetter, K.O.' 4 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Sci Rep' ? ? 2045-2322 ? ? 15 ? 28563 28563 ;Biophysical characterization and solution structure of the cannulae-forming protein CanA from the hyperthermophilic archaeon Pyrodictium abyssi. ; 2025 ? 10.1038/s41598-025-13242-6 40764357 ? ? ? ? ? ? ? ? ? NE ? ? 1 'J. Mol. NMR' ? ? 1874-2718 ? ? ? ? ? ? ;Complete sequential assignment and secondary structure prediction of the cannulae forming protein CanA from the hyperthermophilic archaebacterium Pyrodictium abyssi. ; 2020 ? 10.1007/s12104-020-09934-x ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Munte, C.E.' 1 ? primary 'Kreitner, R.' 2 ? primary 'Rachel, R.' 3 ? primary 'Stetter, K.O.' 4 ? primary 'Kremer, W.' 5 ? primary 'Kalbitzer, H.R.' 6 ? 1 'Kreitner, R.' 7 ? 1 'Munte, C.E.' 8 0000-0002-7937-2645 1 'Singer, K.' 9 ? 1 'Stetter, K.O.' 10 ? 1 'Horn, G.' 11 ? 1 'Kremer, W.' 12 ? 1 'Kalbitzer, H.R.' 13 0000-0002-6514-2355 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cannulae forming protein' _entity.formula_weight 19989.492 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'N-terminally truncated construct of CanA (K1-CanA)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTTQSPLNSFYATGTAQAVSEPIDVESHLGSITPAAGAQGSDDIGYAIVWIKDQVNDVKLKVTLANAEQLKPYFKYLQIQ ITSGYETNSTALGNFSETKAVISLDNPSAVIVLDKEDIAVLYPDKTGYTNTSIWVPGEPDKIIVYNETKPVAILNFKAFY EAKEGMLFDSLPVIFNFQVLQVG ; _entity_poly.pdbx_seq_one_letter_code_can ;MTTQSPLNSFYATGTAQAVSEPIDVESHLGSITPAAGAQGSDDIGYAIVWIKDQVNDVKLKVTLANAEQLKPYFKYLQIQ ITSGYETNSTALGNFSETKAVISLDNPSAVIVLDKEDIAVLYPDKTGYTNTSIWVPGEPDKIIVYNETKPVAILNFKAFY EAKEGMLFDSLPVIFNFQVLQVG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 THR n 1 4 GLN n 1 5 SER n 1 6 PRO n 1 7 LEU n 1 8 ASN n 1 9 SER n 1 10 PHE n 1 11 TYR n 1 12 ALA n 1 13 THR n 1 14 GLY n 1 15 THR n 1 16 ALA n 1 17 GLN n 1 18 ALA n 1 19 VAL n 1 20 SER n 1 21 GLU n 1 22 PRO n 1 23 ILE n 1 24 ASP n 1 25 VAL n 1 26 GLU n 1 27 SER n 1 28 HIS n 1 29 LEU n 1 30 GLY n 1 31 SER n 1 32 ILE n 1 33 THR n 1 34 PRO n 1 35 ALA n 1 36 ALA n 1 37 GLY n 1 38 ALA n 1 39 GLN n 1 40 GLY n 1 41 SER n 1 42 ASP n 1 43 ASP n 1 44 ILE n 1 45 GLY n 1 46 TYR n 1 47 ALA n 1 48 ILE n 1 49 VAL n 1 50 TRP n 1 51 ILE n 1 52 LYS n 1 53 ASP n 1 54 GLN n 1 55 VAL n 1 56 ASN n 1 57 ASP n 1 58 VAL n 1 59 LYS n 1 60 LEU n 1 61 LYS n 1 62 VAL n 1 63 THR n 1 64 LEU n 1 65 ALA n 1 66 ASN n 1 67 ALA n 1 68 GLU n 1 69 GLN n 1 70 LEU n 1 71 LYS n 1 72 PRO n 1 73 TYR n 1 74 PHE n 1 75 LYS n 1 76 TYR n 1 77 LEU n 1 78 GLN n 1 79 ILE n 1 80 GLN n 1 81 ILE n 1 82 THR n 1 83 SER n 1 84 GLY n 1 85 TYR n 1 86 GLU n 1 87 THR n 1 88 ASN n 1 89 SER n 1 90 THR n 1 91 ALA n 1 92 LEU n 1 93 GLY n 1 94 ASN n 1 95 PHE n 1 96 SER n 1 97 GLU n 1 98 THR n 1 99 LYS n 1 100 ALA n 1 101 VAL n 1 102 ILE n 1 103 SER n 1 104 LEU n 1 105 ASP n 1 106 ASN n 1 107 PRO n 1 108 SER n 1 109 ALA n 1 110 VAL n 1 111 ILE n 1 112 VAL n 1 113 LEU n 1 114 ASP n 1 115 LYS n 1 116 GLU n 1 117 ASP n 1 118 ILE n 1 119 ALA n 1 120 VAL n 1 121 LEU n 1 122 TYR n 1 123 PRO n 1 124 ASP n 1 125 LYS n 1 126 THR n 1 127 GLY n 1 128 TYR n 1 129 THR n 1 130 ASN n 1 131 THR n 1 132 SER n 1 133 ILE n 1 134 TRP n 1 135 VAL n 1 136 PRO n 1 137 GLY n 1 138 GLU n 1 139 PRO n 1 140 ASP n 1 141 LYS n 1 142 ILE n 1 143 ILE n 1 144 VAL n 1 145 TYR n 1 146 ASN n 1 147 GLU n 1 148 THR n 1 149 LYS n 1 150 PRO n 1 151 VAL n 1 152 ALA n 1 153 ILE n 1 154 LEU n 1 155 ASN n 1 156 PHE n 1 157 LYS n 1 158 ALA n 1 159 PHE n 1 160 TYR n 1 161 GLU n 1 162 ALA n 1 163 LYS n 1 164 GLU n 1 165 GLY n 1 166 MET n 1 167 LEU n 1 168 PHE n 1 169 ASP n 1 170 SER n 1 171 LEU n 1 172 PRO n 1 173 VAL n 1 174 ILE n 1 175 PHE n 1 176 ASN n 1 177 PHE n 1 178 GLN n 1 179 VAL n 1 180 LEU n 1 181 GLN n 1 182 VAL n 1 183 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 183 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrodictium abyssi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 54256 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 GLN 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 LEU 7 7 ? ? ? A . n A 1 8 ASN 8 8 ? ? ? A . n A 1 9 SER 9 9 ? ? ? A . n A 1 10 PHE 10 10 ? ? ? A . n A 1 11 TYR 11 11 ? ? ? A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 TYR 128 128 128 TYR TYR A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 TRP 134 134 134 TRP TRP A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 ASN 146 146 146 ASN ASN A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 MET 166 166 166 MET MET A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 SER 170 170 170 SER SER A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 PHE 175 175 175 PHE PHE A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 GLY 183 183 183 GLY GLY A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLY 183 ? O ? A GLY 183 O 2 2 Y 1 A GLY 183 ? O ? A GLY 183 O 3 3 Y 1 A GLY 183 ? O ? A GLY 183 O 4 4 Y 1 A GLY 183 ? O ? A GLY 183 O 5 5 Y 1 A GLY 183 ? O ? A GLY 183 O 6 6 Y 1 A GLY 183 ? O ? A GLY 183 O 7 7 Y 1 A GLY 183 ? O ? A GLY 183 O 8 8 Y 1 A GLY 183 ? O ? A GLY 183 O 9 9 Y 1 A GLY 183 ? O ? A GLY 183 O 10 10 Y 1 A GLY 183 ? O ? A GLY 183 O # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9HDI _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9HDI _struct.title 'N-terminally truncated CanA from Pyrodictium abyssi - K1-CanA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9HDI _struct_keywords.text 'cannulae forming protein, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9HDI _struct_ref.pdbx_db_accession 9HDI _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9HDI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9HDI _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 66 ? LYS A 71 ? ASN A 66 LYS A 71 1 ? 6 HELX_P HELX_P2 AA2 SER A 89 ? GLY A 93 ? SER A 89 GLY A 93 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 3 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 24 ? LEU A 29 ? ASP A 24 LEU A 29 AA1 2 GLY A 40 ? TRP A 50 ? GLY A 40 TRP A 50 AA1 3 VAL A 151 ? ALA A 162 ? VAL A 151 ALA A 162 AA1 4 PHE A 74 ? SER A 83 ? PHE A 74 SER A 83 AA1 5 GLU A 97 ? SER A 103 ? GLU A 97 SER A 103 AA2 1 SER A 31 ? ILE A 32 ? SER A 31 ILE A 32 AA2 2 LEU A 171 ? PRO A 172 ? LEU A 171 PRO A 172 AA3 1 SER A 108 ? ASP A 114 ? SER A 108 ASP A 114 AA3 2 ASP A 57 ? LEU A 64 ? ASP A 57 LEU A 64 AA3 3 PHE A 175 ? VAL A 182 ? PHE A 175 VAL A 182 AA4 1 GLU A 86 ? THR A 87 ? GLU A 86 THR A 87 AA4 2 SER A 132 ? TRP A 134 ? SER A 132 TRP A 134 AA4 3 ILE A 142 ? TYR A 145 ? ILE A 142 TYR A 145 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 28 ? N HIS A 28 O TYR A 46 ? O TYR A 46 AA1 2 3 N VAL A 49 ? N VAL A 49 O ALA A 152 ? O ALA A 152 AA1 3 4 O ASN A 155 ? O ASN A 155 N THR A 82 ? N THR A 82 AA1 4 5 N ILE A 81 ? N ILE A 81 O ALA A 100 ? O ALA A 100 AA2 1 2 N ILE A 32 ? N ILE A 32 O LEU A 171 ? O LEU A 171 AA3 1 2 O ILE A 111 ? O ILE A 111 N LEU A 60 ? N LEU A 60 AA3 2 3 N THR A 63 ? N THR A 63 O ASN A 176 ? O ASN A 176 AA4 1 2 N GLU A 86 ? N GLU A 86 O TRP A 134 ? O TRP A 134 AA4 2 3 N ILE A 133 ? N ILE A 133 O ILE A 143 ? O ILE A 143 # _pdbx_entry_details.entry_id 9HDI _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A GLN 78 ? ? H A PHE 159 ? ? 1.60 2 3 O A GLN 78 ? ? H A PHE 159 ? ? 1.58 3 4 O A ILE 79 ? ? H A ILE 102 ? ? 1.57 4 5 O A GLN 78 ? ? H A PHE 159 ? ? 1.54 5 7 O A GLN 78 ? ? H A PHE 159 ? ? 1.60 6 8 O A GLN 78 ? ? H A PHE 159 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 16 ? ? 60.04 76.10 2 1 VAL A 19 ? ? 52.52 161.33 3 1 ALA A 38 ? ? 177.58 -49.02 4 1 GLN A 39 ? ? 174.97 155.97 5 1 ASP A 53 ? ? -174.83 125.66 6 1 GLN A 54 ? ? 18.70 117.26 7 1 TYR A 128 ? ? 83.49 137.09 8 1 LYS A 141 ? ? -92.19 59.25 9 2 THR A 13 ? ? 52.66 101.95 10 2 ALA A 16 ? ? -153.63 75.81 11 2 VAL A 19 ? ? 50.60 161.61 12 2 SER A 20 ? ? 60.17 108.61 13 2 GLN A 39 ? ? -178.97 148.44 14 2 GLN A 54 ? ? 3.71 123.45 15 2 ASN A 94 ? ? -105.50 -166.91 16 2 LYS A 125 ? ? 39.94 46.86 17 2 LYS A 141 ? ? -91.91 58.78 18 2 ASN A 146 ? ? 68.25 -65.57 19 2 ASP A 169 ? ? -175.41 -87.91 20 3 ALA A 18 ? ? 62.56 106.78 21 3 VAL A 19 ? ? 52.93 160.92 22 3 PRO A 22 ? ? -1.00 88.48 23 3 ALA A 35 ? ? -163.85 27.72 24 3 ALA A 38 ? ? -169.65 -50.36 25 3 GLN A 39 ? ? 175.64 139.69 26 3 GLN A 54 ? ? 0.70 124.27 27 3 ASN A 94 ? ? 79.78 -169.60 28 3 LYS A 125 ? ? 52.80 75.15 29 3 TYR A 128 ? ? 52.79 163.83 30 3 LYS A 141 ? ? -92.54 59.58 31 3 ASP A 169 ? ? -103.45 -88.90 32 4 ALA A 16 ? ? -153.17 71.93 33 4 GLN A 17 ? ? 63.43 -79.94 34 4 ALA A 18 ? ? 56.22 101.53 35 4 SER A 20 ? ? 51.44 76.22 36 4 ALA A 36 ? ? 59.94 129.03 37 4 ALA A 38 ? ? 170.28 -45.26 38 4 ASP A 53 ? ? -99.41 -153.47 39 4 ALA A 100 ? ? -170.26 148.65 40 4 LYS A 125 ? ? 31.60 70.22 41 4 TYR A 128 ? ? 79.02 133.37 42 4 LYS A 141 ? ? -92.12 58.64 43 4 ASN A 146 ? ? 45.95 27.51 44 4 ASP A 169 ? ? -98.09 -88.30 45 5 THR A 13 ? ? -133.98 -46.35 46 5 ALA A 16 ? ? -176.76 40.70 47 5 SER A 20 ? ? 61.20 168.92 48 5 PRO A 22 ? ? -53.10 -74.78 49 5 ALA A 38 ? ? 177.64 -46.80 50 5 GLN A 39 ? ? 176.17 141.59 51 5 ASP A 53 ? ? -161.62 -98.07 52 5 LYS A 125 ? ? -117.44 68.27 53 5 TYR A 128 ? ? 53.02 96.67 54 5 LYS A 141 ? ? -94.52 57.31 55 5 ASP A 169 ? ? -97.55 -87.84 56 6 THR A 13 ? ? 52.48 177.23 57 6 THR A 15 ? ? 59.85 76.76 58 6 ALA A 16 ? ? -164.59 73.90 59 6 GLN A 17 ? ? -154.33 -48.42 60 6 ALA A 18 ? ? -59.65 105.86 61 6 VAL A 19 ? ? 52.17 160.83 62 6 PRO A 22 ? ? -62.94 -84.34 63 6 ALA A 38 ? ? 174.07 -48.83 64 6 ASP A 53 ? ? -99.09 -154.30 65 6 TYR A 128 ? ? 67.06 173.72 66 6 LYS A 141 ? ? -91.79 59.46 67 6 ASN A 146 ? ? 35.01 31.39 68 7 ALA A 16 ? ? -174.41 74.64 69 7 SER A 20 ? ? 60.82 155.61 70 7 ALA A 36 ? ? 43.07 -54.31 71 7 ASP A 53 ? ? -97.13 -157.38 72 7 ASN A 94 ? ? 52.79 176.56 73 7 ASP A 169 ? ? -94.80 -86.32 74 8 ALA A 16 ? ? -176.55 40.15 75 8 ALA A 18 ? ? 60.81 108.57 76 8 VAL A 19 ? ? 41.08 -102.06 77 8 PRO A 22 ? ? -59.14 -70.84 78 8 ALA A 36 ? ? 23.75 104.43 79 8 ASP A 53 ? ? -176.95 139.58 80 8 GLN A 54 ? ? 20.48 109.18 81 8 ASN A 94 ? ? 50.88 146.43 82 8 ALA A 100 ? ? -170.02 146.16 83 8 LYS A 141 ? ? -92.13 58.49 84 8 ASN A 146 ? ? 68.61 -67.69 85 8 ASP A 169 ? ? -101.59 -87.72 86 9 THR A 13 ? ? 52.25 177.97 87 9 THR A 15 ? ? 70.79 -61.97 88 9 ALA A 16 ? ? -171.84 67.01 89 9 GLN A 17 ? ? 64.94 -73.09 90 9 ALA A 18 ? ? -173.32 107.72 91 9 ALA A 35 ? ? -165.74 29.03 92 9 ALA A 38 ? ? -173.45 -58.37 93 9 ASP A 53 ? ? -175.81 115.06 94 9 GLN A 54 ? ? 36.72 116.23 95 9 ASN A 94 ? ? -103.36 -154.20 96 9 TYR A 128 ? ? 80.50 155.88 97 9 LYS A 141 ? ? -92.27 58.81 98 9 ASN A 146 ? ? 68.12 -62.05 99 10 ALA A 16 ? ? -160.36 73.92 100 10 GLN A 17 ? ? 66.98 -66.97 101 10 VAL A 19 ? ? 49.33 161.48 102 10 SER A 20 ? ? 85.54 -19.92 103 10 PRO A 22 ? ? -88.82 -82.15 104 10 ALA A 36 ? ? 164.13 136.97 105 10 ALA A 38 ? ? -101.05 77.45 106 10 GLN A 39 ? ? 71.82 137.63 107 10 ASP A 53 ? ? -177.36 136.43 108 10 GLN A 54 ? ? 13.34 115.67 109 10 ASN A 94 ? ? 40.11 -163.46 110 10 LYS A 125 ? ? -104.17 55.68 111 10 TYR A 128 ? ? -94.38 51.77 112 10 LYS A 141 ? ? -91.95 58.91 113 10 ASN A 146 ? ? 68.81 -58.75 114 10 ASP A 169 ? ? -85.86 -82.10 # _pdbx_nmr_ensemble.entry_id 9HDI _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9HDI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '500 uM K1-CanA, 20 mM sodium phosphate, 1 mM EDTA, 2 mM sodium azide, 50 uM DSS, 95% H2O/5% D2O' '95% H2O/5% D2O' 1H_sample_H2O solution ? 6 '1.8 mM K1-CanA, 20 mM sodium phosphate, 1 mM EDTA, 2 mM sodium azide, 50 uM DSS, 95% H2O/5% D2O' '95% H2O/5% D2O' 1H_sample_H2O_conc solution ? 5 '500 uM [U-13C; U-15N] K1-CanA, 20 mM sodium phosphate, 1 mM EDTA, 2 mM sodium azide, 50 uM DSS, 100% D2O' '100% D2O' 13C_15N_sample_D2O solution ? 4 '500 uM [U-13C; U-15N] K1-CanA, 20 mM sodium phosphate, 1 mM EDTA, 2 mM sodium azide, 50 uM DSS, 95% H2O/5% D2O' '95% H2O/5% D2O' 13C_15N_sample_H2O solution ? 3 '400 uM K1-CanA, 20 mM sodium phosphate, 1 mM EDTA, 2 mM sodium azide, 50 uM DSS, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N_sample_H2O solution ? 2 '500 uM K1-CanA, 20 mM sodium phosphate, 1 mM EDTA, 2 mM sodium azide, 50 uM DSS, 100% D2O' '100% D2O' 1H_sample_D2O solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 K1-CanA 500 ? uM 'natural abundance' 1 'sodium phosphate' 20 ? mM 'natural abundance' 1 EDTA 1 ? mM 'natural abundance' 1 'sodium azide' 2 ? mM 'natural abundance' 1 DSS 50 ? uM 'natural abundance' 6 K1-CanA 1.8 ? mM 'natural abundance' 6 'sodium phosphate' 20 ? mM 'natural abundance' 6 EDTA 1 ? mM 'natural abundance' 6 'sodium azide' 2 ? mM 'natural abundance' 6 DSS 50 ? uM 'natural abundance' 5 K1-CanA 500 ? uM '[U-13C; U-15N]' 5 'sodium phosphate' 20 ? mM 'natural abundance' 5 EDTA 1 ? mM 'natural abundance' 5 'sodium azide' 2 ? mM 'natural abundance' 5 DSS 50 ? uM 'natural abundance' 4 K1-CanA 500 ? uM '[U-13C; U-15N]' 4 'sodium phosphate' 20 ? mM 'natural abundance' 4 EDTA 1 ? mM 'natural abundance' 4 'sodium azide' 2 ? mM 'natural abundance' 4 DSS 50 ? uM 'natural abundance' 3 K1-CanA 400 ? uM 'natural abundance' 3 'sodium phosphate' 20 ? mM 'natural abundance' 3 EDTA 1 ? mM 'natural abundance' 3 'sodium azide' 2 ? mM 'natural abundance' 3 DSS 50 ? uM 'natural abundance' 2 K1-CanA 500 ? uM 'natural abundance' 2 'sodium phosphate' 20 ? mM 'natural abundance' 2 EDTA 1 ? mM 'natural abundance' 2 'sodium azide' 2 ? mM 'natural abundance' 2 DSS 50 ? uM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H NOESY' 1 isotropic 2 1 2 '2D 1H-1H NOESY' 1 isotropic 3 1 6 '2D 1H-1H NOESY' 3 isotropic 4 1 1 '2D 1H-1H TOCSY' 1 isotropic 5 1 5 '2D 1H-13C HSQC aliphatic' 1 isotropic 6 1 5 '2D 1H-13C HSQC aromatic' 1 isotropic 15 1 4 '2D 1H-15N HSQC' 1 isotropic 14 1 3 '2D 1H-15N HSQC' 2 isotropic 13 1 3 '2D 1H-15N HSQC' 3 isotropic 12 1 4 '3D HNCO' 1 isotropic 11 1 4 '3D HNCA' 1 isotropic 10 1 4 '3D CBCA(CO)NH' 1 isotropic 9 1 4 '3D CBCANH' 1 isotropic 8 1 4 '3D HCAN' 1 isotropic 7 1 3 '3D 1H-15N NOESY' 2 isotropic 16 1 3 '3D 1H-15N NOESY' 3 isotropic 17 1 5 '3D HCCH-TOCSY' 1 isotropic 18 1 4 '3D (HB)CB(CGCC-TOCSY)Har' 1 isotropic 19 1 4 '3D (HB)CB(CGCD)HD' 1 isotropic 20 1 4 '3D HNCO H-bonds' 1 isotropic # _pdbx_nmr_refine.entry_id 9HDI _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' AUREMOL ? 'Bruker Biospin' 2 'peak picking' AUREMOL ? 'Bruker Biospin' 3 'structure calculation' CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 4 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A THR 2 ? A THR 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A GLN 4 ? A GLN 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A LEU 7 ? A LEU 7 8 1 Y 1 A ASN 8 ? A ASN 8 9 1 Y 1 A SER 9 ? A SER 9 10 1 Y 1 A PHE 10 ? A PHE 10 11 1 Y 1 A TYR 11 ? A TYR 11 12 2 Y 1 A MET 1 ? A MET 1 13 2 Y 1 A THR 2 ? A THR 2 14 2 Y 1 A THR 3 ? A THR 3 15 2 Y 1 A GLN 4 ? A GLN 4 16 2 Y 1 A SER 5 ? A SER 5 17 2 Y 1 A PRO 6 ? A PRO 6 18 2 Y 1 A LEU 7 ? A LEU 7 19 2 Y 1 A ASN 8 ? A ASN 8 20 2 Y 1 A SER 9 ? A SER 9 21 2 Y 1 A PHE 10 ? A PHE 10 22 2 Y 1 A TYR 11 ? A TYR 11 23 3 Y 1 A MET 1 ? A MET 1 24 3 Y 1 A THR 2 ? A THR 2 25 3 Y 1 A THR 3 ? A THR 3 26 3 Y 1 A GLN 4 ? A GLN 4 27 3 Y 1 A SER 5 ? A SER 5 28 3 Y 1 A PRO 6 ? A PRO 6 29 3 Y 1 A LEU 7 ? A LEU 7 30 3 Y 1 A ASN 8 ? A ASN 8 31 3 Y 1 A SER 9 ? A SER 9 32 3 Y 1 A PHE 10 ? A PHE 10 33 3 Y 1 A TYR 11 ? A TYR 11 34 4 Y 1 A MET 1 ? A MET 1 35 4 Y 1 A THR 2 ? A THR 2 36 4 Y 1 A THR 3 ? A THR 3 37 4 Y 1 A GLN 4 ? A GLN 4 38 4 Y 1 A SER 5 ? A SER 5 39 4 Y 1 A PRO 6 ? A PRO 6 40 4 Y 1 A LEU 7 ? A LEU 7 41 4 Y 1 A ASN 8 ? A ASN 8 42 4 Y 1 A SER 9 ? A SER 9 43 4 Y 1 A PHE 10 ? A PHE 10 44 4 Y 1 A TYR 11 ? A TYR 11 45 5 Y 1 A MET 1 ? A MET 1 46 5 Y 1 A THR 2 ? A THR 2 47 5 Y 1 A THR 3 ? A THR 3 48 5 Y 1 A GLN 4 ? A GLN 4 49 5 Y 1 A SER 5 ? A SER 5 50 5 Y 1 A PRO 6 ? A PRO 6 51 5 Y 1 A LEU 7 ? A LEU 7 52 5 Y 1 A ASN 8 ? A ASN 8 53 5 Y 1 A SER 9 ? A SER 9 54 5 Y 1 A PHE 10 ? A PHE 10 55 5 Y 1 A TYR 11 ? A TYR 11 56 6 Y 1 A MET 1 ? A MET 1 57 6 Y 1 A THR 2 ? A THR 2 58 6 Y 1 A THR 3 ? A THR 3 59 6 Y 1 A GLN 4 ? A GLN 4 60 6 Y 1 A SER 5 ? A SER 5 61 6 Y 1 A PRO 6 ? A PRO 6 62 6 Y 1 A LEU 7 ? A LEU 7 63 6 Y 1 A ASN 8 ? A ASN 8 64 6 Y 1 A SER 9 ? A SER 9 65 6 Y 1 A PHE 10 ? A PHE 10 66 6 Y 1 A TYR 11 ? A TYR 11 67 7 Y 1 A MET 1 ? A MET 1 68 7 Y 1 A THR 2 ? A THR 2 69 7 Y 1 A THR 3 ? A THR 3 70 7 Y 1 A GLN 4 ? A GLN 4 71 7 Y 1 A SER 5 ? A SER 5 72 7 Y 1 A PRO 6 ? A PRO 6 73 7 Y 1 A LEU 7 ? A LEU 7 74 7 Y 1 A ASN 8 ? A ASN 8 75 7 Y 1 A SER 9 ? A SER 9 76 7 Y 1 A PHE 10 ? A PHE 10 77 7 Y 1 A TYR 11 ? A TYR 11 78 8 Y 1 A MET 1 ? A MET 1 79 8 Y 1 A THR 2 ? A THR 2 80 8 Y 1 A THR 3 ? A THR 3 81 8 Y 1 A GLN 4 ? A GLN 4 82 8 Y 1 A SER 5 ? A SER 5 83 8 Y 1 A PRO 6 ? A PRO 6 84 8 Y 1 A LEU 7 ? A LEU 7 85 8 Y 1 A ASN 8 ? A ASN 8 86 8 Y 1 A SER 9 ? A SER 9 87 8 Y 1 A PHE 10 ? A PHE 10 88 8 Y 1 A TYR 11 ? A TYR 11 89 9 Y 1 A MET 1 ? A MET 1 90 9 Y 1 A THR 2 ? A THR 2 91 9 Y 1 A THR 3 ? A THR 3 92 9 Y 1 A GLN 4 ? A GLN 4 93 9 Y 1 A SER 5 ? A SER 5 94 9 Y 1 A PRO 6 ? A PRO 6 95 9 Y 1 A LEU 7 ? A LEU 7 96 9 Y 1 A ASN 8 ? A ASN 8 97 9 Y 1 A SER 9 ? A SER 9 98 9 Y 1 A PHE 10 ? A PHE 10 99 9 Y 1 A TYR 11 ? A TYR 11 100 10 Y 1 A MET 1 ? A MET 1 101 10 Y 1 A THR 2 ? A THR 2 102 10 Y 1 A THR 3 ? A THR 3 103 10 Y 1 A GLN 4 ? A GLN 4 104 10 Y 1 A SER 5 ? A SER 5 105 10 Y 1 A PRO 6 ? A PRO 6 106 10 Y 1 A LEU 7 ? A LEU 7 107 10 Y 1 A ASN 8 ? A ASN 8 108 10 Y 1 A SER 9 ? A SER 9 109 10 Y 1 A PHE 10 ? A PHE 10 110 10 Y 1 A TYR 11 ? A TYR 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 HIS N N N N 96 HIS CA C N S 97 HIS C C N N 98 HIS O O N N 99 HIS CB C N N 100 HIS CG C Y N 101 HIS ND1 N Y N 102 HIS CD2 C Y N 103 HIS CE1 C Y N 104 HIS NE2 N Y N 105 HIS OXT O N N 106 HIS H H N N 107 HIS H2 H N N 108 HIS HA H N N 109 HIS HB2 H N N 110 HIS HB3 H N N 111 HIS HD1 H N N 112 HIS HD2 H N N 113 HIS HE1 H N N 114 HIS HE2 H N N 115 HIS HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 LYS N N N N 161 LYS CA C N S 162 LYS C C N N 163 LYS O O N N 164 LYS CB C N N 165 LYS CG C N N 166 LYS CD C N N 167 LYS CE C N N 168 LYS NZ N N N 169 LYS OXT O N N 170 LYS H H N N 171 LYS H2 H N N 172 LYS HA H N N 173 LYS HB2 H N N 174 LYS HB3 H N N 175 LYS HG2 H N N 176 LYS HG3 H N N 177 LYS HD2 H N N 178 LYS HD3 H N N 179 LYS HE2 H N N 180 LYS HE3 H N N 181 LYS HZ1 H N N 182 LYS HZ2 H N N 183 LYS HZ3 H N N 184 LYS HXT H N N 185 MET N N N N 186 MET CA C N S 187 MET C C N N 188 MET O O N N 189 MET CB C N N 190 MET CG C N N 191 MET SD S N N 192 MET CE C N N 193 MET OXT O N N 194 MET H H N N 195 MET H2 H N N 196 MET HA H N N 197 MET HB2 H N N 198 MET HB3 H N N 199 MET HG2 H N N 200 MET HG3 H N N 201 MET HE1 H N N 202 MET HE2 H N N 203 MET HE3 H N N 204 MET HXT H N N 205 PHE N N N N 206 PHE CA C N S 207 PHE C C N N 208 PHE O O N N 209 PHE CB C N N 210 PHE CG C Y N 211 PHE CD1 C Y N 212 PHE CD2 C Y N 213 PHE CE1 C Y N 214 PHE CE2 C Y N 215 PHE CZ C Y N 216 PHE OXT O N N 217 PHE H H N N 218 PHE H2 H N N 219 PHE HA H N N 220 PHE HB2 H N N 221 PHE HB3 H N N 222 PHE HD1 H N N 223 PHE HD2 H N N 224 PHE HE1 H N N 225 PHE HE2 H N N 226 PHE HZ H N N 227 PHE HXT H N N 228 PRO N N N N 229 PRO CA C N S 230 PRO C C N N 231 PRO O O N N 232 PRO CB C N N 233 PRO CG C N N 234 PRO CD C N N 235 PRO OXT O N N 236 PRO H H N N 237 PRO HA H N N 238 PRO HB2 H N N 239 PRO HB3 H N N 240 PRO HG2 H N N 241 PRO HG3 H N N 242 PRO HD2 H N N 243 PRO HD3 H N N 244 PRO HXT H N N 245 SER N N N N 246 SER CA C N S 247 SER C C N N 248 SER O O N N 249 SER CB C N N 250 SER OG O N N 251 SER OXT O N N 252 SER H H N N 253 SER H2 H N N 254 SER HA H N N 255 SER HB2 H N N 256 SER HB3 H N N 257 SER HG H N N 258 SER HXT H N N 259 THR N N N N 260 THR CA C N S 261 THR C C N N 262 THR O O N N 263 THR CB C N R 264 THR OG1 O N N 265 THR CG2 C N N 266 THR OXT O N N 267 THR H H N N 268 THR H2 H N N 269 THR HA H N N 270 THR HB H N N 271 THR HG1 H N N 272 THR HG21 H N N 273 THR HG22 H N N 274 THR HG23 H N N 275 THR HXT H N N 276 TRP N N N N 277 TRP CA C N S 278 TRP C C N N 279 TRP O O N N 280 TRP CB C N N 281 TRP CG C Y N 282 TRP CD1 C Y N 283 TRP CD2 C Y N 284 TRP NE1 N Y N 285 TRP CE2 C Y N 286 TRP CE3 C Y N 287 TRP CZ2 C Y N 288 TRP CZ3 C Y N 289 TRP CH2 C Y N 290 TRP OXT O N N 291 TRP H H N N 292 TRP H2 H N N 293 TRP HA H N N 294 TRP HB2 H N N 295 TRP HB3 H N N 296 TRP HD1 H N N 297 TRP HE1 H N N 298 TRP HE3 H N N 299 TRP HZ2 H N N 300 TRP HZ3 H N N 301 TRP HH2 H N N 302 TRP HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 HIS N CA sing N N 90 HIS N H sing N N 91 HIS N H2 sing N N 92 HIS CA C sing N N 93 HIS CA CB sing N N 94 HIS CA HA sing N N 95 HIS C O doub N N 96 HIS C OXT sing N N 97 HIS CB CG sing N N 98 HIS CB HB2 sing N N 99 HIS CB HB3 sing N N 100 HIS CG ND1 sing Y N 101 HIS CG CD2 doub Y N 102 HIS ND1 CE1 doub Y N 103 HIS ND1 HD1 sing N N 104 HIS CD2 NE2 sing Y N 105 HIS CD2 HD2 sing N N 106 HIS CE1 NE2 sing Y N 107 HIS CE1 HE1 sing N N 108 HIS NE2 HE2 sing N N 109 HIS OXT HXT sing N N 110 ILE N CA sing N N 111 ILE N H sing N N 112 ILE N H2 sing N N 113 ILE CA C sing N N 114 ILE CA CB sing N N 115 ILE CA HA sing N N 116 ILE C O doub N N 117 ILE C OXT sing N N 118 ILE CB CG1 sing N N 119 ILE CB CG2 sing N N 120 ILE CB HB sing N N 121 ILE CG1 CD1 sing N N 122 ILE CG1 HG12 sing N N 123 ILE CG1 HG13 sing N N 124 ILE CG2 HG21 sing N N 125 ILE CG2 HG22 sing N N 126 ILE CG2 HG23 sing N N 127 ILE CD1 HD11 sing N N 128 ILE CD1 HD12 sing N N 129 ILE CD1 HD13 sing N N 130 ILE OXT HXT sing N N 131 LEU N CA sing N N 132 LEU N H sing N N 133 LEU N H2 sing N N 134 LEU CA C sing N N 135 LEU CA CB sing N N 136 LEU CA HA sing N N 137 LEU C O doub N N 138 LEU C OXT sing N N 139 LEU CB CG sing N N 140 LEU CB HB2 sing N N 141 LEU CB HB3 sing N N 142 LEU CG CD1 sing N N 143 LEU CG CD2 sing N N 144 LEU CG HG sing N N 145 LEU CD1 HD11 sing N N 146 LEU CD1 HD12 sing N N 147 LEU CD1 HD13 sing N N 148 LEU CD2 HD21 sing N N 149 LEU CD2 HD22 sing N N 150 LEU CD2 HD23 sing N N 151 LEU OXT HXT sing N N 152 LYS N CA sing N N 153 LYS N H sing N N 154 LYS N H2 sing N N 155 LYS CA C sing N N 156 LYS CA CB sing N N 157 LYS CA HA sing N N 158 LYS C O doub N N 159 LYS C OXT sing N N 160 LYS CB CG sing N N 161 LYS CB HB2 sing N N 162 LYS CB HB3 sing N N 163 LYS CG CD sing N N 164 LYS CG HG2 sing N N 165 LYS CG HG3 sing N N 166 LYS CD CE sing N N 167 LYS CD HD2 sing N N 168 LYS CD HD3 sing N N 169 LYS CE NZ sing N N 170 LYS CE HE2 sing N N 171 LYS CE HE3 sing N N 172 LYS NZ HZ1 sing N N 173 LYS NZ HZ2 sing N N 174 LYS NZ HZ3 sing N N 175 LYS OXT HXT sing N N 176 MET N CA sing N N 177 MET N H sing N N 178 MET N H2 sing N N 179 MET CA C sing N N 180 MET CA CB sing N N 181 MET CA HA sing N N 182 MET C O doub N N 183 MET C OXT sing N N 184 MET CB CG sing N N 185 MET CB HB2 sing N N 186 MET CB HB3 sing N N 187 MET CG SD sing N N 188 MET CG HG2 sing N N 189 MET CG HG3 sing N N 190 MET SD CE sing N N 191 MET CE HE1 sing N N 192 MET CE HE2 sing N N 193 MET CE HE3 sing N N 194 MET OXT HXT sing N N 195 PHE N CA sing N N 196 PHE N H sing N N 197 PHE N H2 sing N N 198 PHE CA C sing N N 199 PHE CA CB sing N N 200 PHE CA HA sing N N 201 PHE C O doub N N 202 PHE C OXT sing N N 203 PHE CB CG sing N N 204 PHE CB HB2 sing N N 205 PHE CB HB3 sing N N 206 PHE CG CD1 doub Y N 207 PHE CG CD2 sing Y N 208 PHE CD1 CE1 sing Y N 209 PHE CD1 HD1 sing N N 210 PHE CD2 CE2 doub Y N 211 PHE CD2 HD2 sing N N 212 PHE CE1 CZ doub Y N 213 PHE CE1 HE1 sing N N 214 PHE CE2 CZ sing Y N 215 PHE CE2 HE2 sing N N 216 PHE CZ HZ sing N N 217 PHE OXT HXT sing N N 218 PRO N CA sing N N 219 PRO N CD sing N N 220 PRO N H sing N N 221 PRO CA C sing N N 222 PRO CA CB sing N N 223 PRO CA HA sing N N 224 PRO C O doub N N 225 PRO C OXT sing N N 226 PRO CB CG sing N N 227 PRO CB HB2 sing N N 228 PRO CB HB3 sing N N 229 PRO CG CD sing N N 230 PRO CG HG2 sing N N 231 PRO CG HG3 sing N N 232 PRO CD HD2 sing N N 233 PRO CD HD3 sing N N 234 PRO OXT HXT sing N N 235 SER N CA sing N N 236 SER N H sing N N 237 SER N H2 sing N N 238 SER CA C sing N N 239 SER CA CB sing N N 240 SER CA HA sing N N 241 SER C O doub N N 242 SER C OXT sing N N 243 SER CB OG sing N N 244 SER CB HB2 sing N N 245 SER CB HB3 sing N N 246 SER OG HG sing N N 247 SER OXT HXT sing N N 248 THR N CA sing N N 249 THR N H sing N N 250 THR N H2 sing N N 251 THR CA C sing N N 252 THR CA CB sing N N 253 THR CA HA sing N N 254 THR C O doub N N 255 THR C OXT sing N N 256 THR CB OG1 sing N N 257 THR CB CG2 sing N N 258 THR CB HB sing N N 259 THR OG1 HG1 sing N N 260 THR CG2 HG21 sing N N 261 THR CG2 HG22 sing N N 262 THR CG2 HG23 sing N N 263 THR OXT HXT sing N N 264 TRP N CA sing N N 265 TRP N H sing N N 266 TRP N H2 sing N N 267 TRP CA C sing N N 268 TRP CA CB sing N N 269 TRP CA HA sing N N 270 TRP C O doub N N 271 TRP C OXT sing N N 272 TRP CB CG sing N N 273 TRP CB HB2 sing N N 274 TRP CB HB3 sing N N 275 TRP CG CD1 doub Y N 276 TRP CG CD2 sing Y N 277 TRP CD1 NE1 sing Y N 278 TRP CD1 HD1 sing N N 279 TRP CD2 CE2 doub Y N 280 TRP CD2 CE3 sing Y N 281 TRP NE1 CE2 sing Y N 282 TRP NE1 HE1 sing N N 283 TRP CE2 CZ2 sing Y N 284 TRP CE3 CZ3 doub Y N 285 TRP CE3 HE3 sing N N 286 TRP CZ2 CH2 doub Y N 287 TRP CZ2 HZ2 sing N N 288 TRP CZ3 CH2 sing Y N 289 TRP CZ3 HZ3 sing N N 290 TRP CH2 HH2 sing N N 291 TRP OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 600 'TXI cryoprobe' 2 AVANCE ? Bruker 800 'TCI cryoprobe' 3 AVANCE ? Bruker 900 'TCI cryoprobe' # _atom_sites.entry_id 9HDI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #