data_9HRC # _entry.id 9HRC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9HRC pdb_00009hrc 10.2210/pdb9hrc/pdb WWPDB D_1292144093 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-03-12 ? 2 'Structure model' 1 1 2025-03-26 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9HRC _pdbx_database_status.recvd_initial_deposition_date 2024-12-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 3 _pdbx_contact_author.email gary-schiltz@northwestern.edu _pdbx_contact_author.name_first Gary _pdbx_contact_author.name_last Schiltz _pdbx_contact_author.name_mi E. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4180-5051 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Schiltz, G.E.' 1 0000-0003-4180-5051 'Vagadia, P.V.' 2 0009-0006-2176-0828 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 68 _citation.language ? _citation.page_first 5824 _citation.page_last 5844 _citation.title 'Discovery of Potent and Selective MNK Kinase Inhibitors for the Treatment of Leukemia.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.4c03158 _citation.pdbx_database_id_PubMed 40033556 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vagadia, P.P.' 1 ? primary 'Izquierdo-Ferrer, J.' 2 ? primary 'Mazewski, C.' 3 ? primary 'Blyth, G.' 4 ? primary 'Beauchamp, E.M.' 5 ? primary 'Clutter, M.R.' 6 ? primary 'Stern, C.L.' 7 ? primary 'Mishra, R.K.' 8 ? primary 'Nahotko, D.' 9 ? primary 'Small, S.' 10 ? primary 'Eckerdt, F.' 11 ? primary 'Platanias, L.C.' 12 ? primary 'Schiltz, G.E.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MAP kinase-interacting serine/threonine-protein kinase 2' 35604.461 1 2.7.11.1 D228G ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn '1-[5-chloranyl-4-[(3~{R})-pyrrolidin-3-yl]oxy-pyrimidin-2-yl]benzimidazole' 315.758 1 ? ? ? ? 5 water nat water 18.015 19 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAP kinase signal-integrating kinase 2,MAPK signal-integrating kinase 2,Mnk2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSTDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFREVEMLYQCQGHRNVLELIEFF EEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFGL GSGIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCGSDCGWDRGE ACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWVQGCAPENTLPTPMVLQR ; _entity_poly.pdbx_seq_one_letter_code_can ;GSTDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFREVEMLYQCQGHRNVLELIEFF EEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFGL GSGIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCGSDCGWDRGE ACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWVQGCAPENTLPTPMVLQR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 GLYCEROL GOL 4 '1-[5-chloranyl-4-[(3~{R})-pyrrolidin-3-yl]oxy-pyrimidin-2-yl]benzimidazole' A1IWO 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 THR n 1 4 ASP n 1 5 SER n 1 6 PHE n 1 7 SER n 1 8 GLY n 1 9 ARG n 1 10 PHE n 1 11 GLU n 1 12 ASP n 1 13 VAL n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLN n 1 18 GLU n 1 19 ASP n 1 20 VAL n 1 21 LEU n 1 22 GLY n 1 23 GLU n 1 24 GLY n 1 25 ALA n 1 26 HIS n 1 27 ALA n 1 28 ARG n 1 29 VAL n 1 30 GLN n 1 31 THR n 1 32 CYS n 1 33 ILE n 1 34 ASN n 1 35 LEU n 1 36 ILE n 1 37 THR n 1 38 SER n 1 39 GLN n 1 40 GLU n 1 41 TYR n 1 42 ALA n 1 43 VAL n 1 44 LYS n 1 45 ILE n 1 46 ILE n 1 47 GLU n 1 48 LYS n 1 49 GLN n 1 50 PRO n 1 51 GLY n 1 52 HIS n 1 53 ILE n 1 54 ARG n 1 55 SER n 1 56 ARG n 1 57 VAL n 1 58 PHE n 1 59 ARG n 1 60 GLU n 1 61 VAL n 1 62 GLU n 1 63 MET n 1 64 LEU n 1 65 TYR n 1 66 GLN n 1 67 CYS n 1 68 GLN n 1 69 GLY n 1 70 HIS n 1 71 ARG n 1 72 ASN n 1 73 VAL n 1 74 LEU n 1 75 GLU n 1 76 LEU n 1 77 ILE n 1 78 GLU n 1 79 PHE n 1 80 PHE n 1 81 GLU n 1 82 GLU n 1 83 GLU n 1 84 ASP n 1 85 ARG n 1 86 PHE n 1 87 TYR n 1 88 LEU n 1 89 VAL n 1 90 PHE n 1 91 GLU n 1 92 LYS n 1 93 MET n 1 94 ARG n 1 95 GLY n 1 96 GLY n 1 97 SER n 1 98 ILE n 1 99 LEU n 1 100 SER n 1 101 HIS n 1 102 ILE n 1 103 HIS n 1 104 LYS n 1 105 ARG n 1 106 ARG n 1 107 HIS n 1 108 PHE n 1 109 ASN n 1 110 GLU n 1 111 LEU n 1 112 GLU n 1 113 ALA n 1 114 SER n 1 115 VAL n 1 116 VAL n 1 117 VAL n 1 118 GLN n 1 119 ASP n 1 120 VAL n 1 121 ALA n 1 122 SER n 1 123 ALA n 1 124 LEU n 1 125 ASP n 1 126 PHE n 1 127 LEU n 1 128 HIS n 1 129 ASN n 1 130 LYS n 1 131 GLY n 1 132 ILE n 1 133 ALA n 1 134 HIS n 1 135 ARG n 1 136 ASP n 1 137 LEU n 1 138 LYS n 1 139 PRO n 1 140 GLU n 1 141 ASN n 1 142 ILE n 1 143 LEU n 1 144 CYS n 1 145 GLU n 1 146 HIS n 1 147 PRO n 1 148 ASN n 1 149 GLN n 1 150 VAL n 1 151 SER n 1 152 PRO n 1 153 VAL n 1 154 LYS n 1 155 ILE n 1 156 CYS n 1 157 ASP n 1 158 PHE n 1 159 GLY n 1 160 LEU n 1 161 GLY n 1 162 SER n 1 163 GLY n 1 164 ILE n 1 165 LYS n 1 166 LEU n 1 167 ASN n 1 168 GLY n 1 169 ASP n 1 170 CYS n 1 171 SER n 1 172 PRO n 1 173 ILE n 1 174 SER n 1 175 THR n 1 176 PRO n 1 177 GLU n 1 178 LEU n 1 179 LEU n 1 180 THR n 1 181 PRO n 1 182 CYS n 1 183 GLY n 1 184 SER n 1 185 ALA n 1 186 GLU n 1 187 TYR n 1 188 MET n 1 189 ALA n 1 190 PRO n 1 191 GLU n 1 192 VAL n 1 193 VAL n 1 194 GLU n 1 195 ALA n 1 196 PHE n 1 197 SER n 1 198 GLU n 1 199 GLU n 1 200 ALA n 1 201 SER n 1 202 ILE n 1 203 TYR n 1 204 ASP n 1 205 LYS n 1 206 ARG n 1 207 CYS n 1 208 ASP n 1 209 LEU n 1 210 TRP n 1 211 SER n 1 212 LEU n 1 213 GLY n 1 214 VAL n 1 215 ILE n 1 216 LEU n 1 217 TYR n 1 218 ILE n 1 219 LEU n 1 220 LEU n 1 221 SER n 1 222 GLY n 1 223 TYR n 1 224 PRO n 1 225 PRO n 1 226 PHE n 1 227 VAL n 1 228 GLY n 1 229 ARG n 1 230 CYS n 1 231 GLY n 1 232 SER n 1 233 ASP n 1 234 CYS n 1 235 GLY n 1 236 TRP n 1 237 ASP n 1 238 ARG n 1 239 GLY n 1 240 GLU n 1 241 ALA n 1 242 CYS n 1 243 PRO n 1 244 ALA n 1 245 CYS n 1 246 GLN n 1 247 ASN n 1 248 MET n 1 249 LEU n 1 250 PHE n 1 251 GLU n 1 252 SER n 1 253 ILE n 1 254 GLN n 1 255 GLU n 1 256 GLY n 1 257 LYS n 1 258 TYR n 1 259 GLU n 1 260 PHE n 1 261 PRO n 1 262 ASP n 1 263 LYS n 1 264 ASP n 1 265 TRP n 1 266 ALA n 1 267 HIS n 1 268 ILE n 1 269 SER n 1 270 CYS n 1 271 ALA n 1 272 ALA n 1 273 LYS n 1 274 ASP n 1 275 LEU n 1 276 ILE n 1 277 SER n 1 278 LYS n 1 279 LEU n 1 280 LEU n 1 281 VAL n 1 282 ARG n 1 283 ASP n 1 284 ALA n 1 285 LYS n 1 286 GLN n 1 287 ARG n 1 288 LEU n 1 289 SER n 1 290 ALA n 1 291 ALA n 1 292 GLN n 1 293 VAL n 1 294 LEU n 1 295 GLN n 1 296 HIS n 1 297 PRO n 1 298 TRP n 1 299 VAL n 1 300 GLN n 1 301 GLY n 1 302 CYS n 1 303 ALA n 1 304 PRO n 1 305 GLU n 1 306 ASN n 1 307 THR n 1 308 LEU n 1 309 PRO n 1 310 THR n 1 311 PRO n 1 312 MET n 1 313 VAL n 1 314 LEU n 1 315 GLN n 1 316 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 316 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MKNK2, GPRK7, MNK2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1IWO non-polymer . '1-[5-chloranyl-4-[(3~{R})-pyrrolidin-3-yl]oxy-pyrimidin-2-yl]benzimidazole' ? 'C15 H14 Cl N5 O' 315.758 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 70 70 GLY GLY A . n A 1 2 SER 2 71 71 SER SER A . n A 1 3 THR 3 72 72 THR THR A . n A 1 4 ASP 4 73 73 ASP ASP A . n A 1 5 SER 5 74 74 SER SER A . n A 1 6 PHE 6 75 75 PHE PHE A . n A 1 7 SER 7 76 76 SER SER A . n A 1 8 GLY 8 77 77 GLY GLY A . n A 1 9 ARG 9 78 78 ARG ARG A . n A 1 10 PHE 10 79 79 PHE PHE A . n A 1 11 GLU 11 80 80 GLU GLU A . n A 1 12 ASP 12 81 81 ASP ASP A . n A 1 13 VAL 13 82 82 VAL VAL A . n A 1 14 TYR 14 83 83 TYR TYR A . n A 1 15 GLN 15 84 84 GLN GLN A . n A 1 16 LEU 16 85 85 LEU LEU A . n A 1 17 GLN 17 86 86 GLN GLN A . n A 1 18 GLU 18 87 87 GLU GLU A . n A 1 19 ASP 19 88 88 ASP ASP A . n A 1 20 VAL 20 89 89 VAL VAL A . n A 1 21 LEU 21 90 90 LEU LEU A . n A 1 22 GLY 22 91 91 GLY GLY A . n A 1 23 GLU 23 92 92 GLU GLU A . n A 1 24 GLY 24 93 93 GLY GLY A . n A 1 25 ALA 25 94 94 ALA ALA A . n A 1 26 HIS 26 95 95 HIS HIS A . n A 1 27 ALA 27 96 96 ALA ALA A . n A 1 28 ARG 28 97 97 ARG ARG A . n A 1 29 VAL 29 98 98 VAL VAL A . n A 1 30 GLN 30 99 99 GLN GLN A . n A 1 31 THR 31 100 100 THR THR A . n A 1 32 CYS 32 101 101 CYS CYS A . n A 1 33 ILE 33 102 102 ILE ILE A . n A 1 34 ASN 34 103 103 ASN ASN A . n A 1 35 LEU 35 104 104 LEU LEU A . n A 1 36 ILE 36 105 105 ILE ILE A . n A 1 37 THR 37 106 106 THR THR A . n A 1 38 SER 38 107 107 SER SER A . n A 1 39 GLN 39 108 108 GLN GLN A . n A 1 40 GLU 40 109 109 GLU GLU A . n A 1 41 TYR 41 110 110 TYR TYR A . n A 1 42 ALA 42 111 111 ALA ALA A . n A 1 43 VAL 43 112 112 VAL VAL A . n A 1 44 LYS 44 113 113 LYS LYS A . n A 1 45 ILE 45 114 114 ILE ILE A . n A 1 46 ILE 46 115 115 ILE ILE A . n A 1 47 GLU 47 116 116 GLU GLU A . n A 1 48 LYS 48 117 117 LYS LYS A . n A 1 49 GLN 49 118 118 GLN GLN A . n A 1 50 PRO 50 119 119 PRO PRO A . n A 1 51 GLY 51 120 120 GLY GLY A . n A 1 52 HIS 52 121 121 HIS HIS A . n A 1 53 ILE 53 122 122 ILE ILE A . n A 1 54 ARG 54 123 123 ARG ARG A . n A 1 55 SER 55 124 124 SER SER A . n A 1 56 ARG 56 125 125 ARG ARG A . n A 1 57 VAL 57 126 126 VAL VAL A . n A 1 58 PHE 58 127 127 PHE PHE A . n A 1 59 ARG 59 128 128 ARG ARG A . n A 1 60 GLU 60 129 129 GLU GLU A . n A 1 61 VAL 61 130 130 VAL VAL A . n A 1 62 GLU 62 131 131 GLU GLU A . n A 1 63 MET 63 132 132 MET MET A . n A 1 64 LEU 64 133 133 LEU LEU A . n A 1 65 TYR 65 134 134 TYR TYR A . n A 1 66 GLN 66 135 135 GLN GLN A . n A 1 67 CYS 67 136 136 CYS CYS A . n A 1 68 GLN 68 137 137 GLN GLN A . n A 1 69 GLY 69 138 138 GLY GLY A . n A 1 70 HIS 70 139 139 HIS HIS A . n A 1 71 ARG 71 140 140 ARG ARG A . n A 1 72 ASN 72 141 141 ASN ASN A . n A 1 73 VAL 73 142 142 VAL VAL A . n A 1 74 LEU 74 143 143 LEU LEU A . n A 1 75 GLU 75 144 144 GLU GLU A . n A 1 76 LEU 76 145 145 LEU LEU A . n A 1 77 ILE 77 146 146 ILE ILE A . n A 1 78 GLU 78 147 147 GLU GLU A . n A 1 79 PHE 79 148 148 PHE PHE A . n A 1 80 PHE 80 149 149 PHE PHE A . n A 1 81 GLU 81 150 150 GLU GLU A . n A 1 82 GLU 82 151 151 GLU GLU A . n A 1 83 GLU 83 152 152 GLU GLU A . n A 1 84 ASP 84 153 153 ASP ASP A . n A 1 85 ARG 85 154 154 ARG ARG A . n A 1 86 PHE 86 155 155 PHE PHE A . n A 1 87 TYR 87 156 156 TYR TYR A . n A 1 88 LEU 88 157 157 LEU LEU A . n A 1 89 VAL 89 158 158 VAL VAL A . n A 1 90 PHE 90 159 159 PHE PHE A . n A 1 91 GLU 91 160 160 GLU GLU A . n A 1 92 LYS 92 161 161 LYS LYS A . n A 1 93 MET 93 162 162 MET MET A . n A 1 94 ARG 94 163 163 ARG ARG A . n A 1 95 GLY 95 164 164 GLY GLY A . n A 1 96 GLY 96 165 165 GLY GLY A . n A 1 97 SER 97 166 166 SER SER A . n A 1 98 ILE 98 167 167 ILE ILE A . n A 1 99 LEU 99 168 168 LEU LEU A . n A 1 100 SER 100 169 169 SER SER A . n A 1 101 HIS 101 170 170 HIS HIS A . n A 1 102 ILE 102 171 171 ILE ILE A . n A 1 103 HIS 103 172 172 HIS HIS A . n A 1 104 LYS 104 173 173 LYS LYS A . n A 1 105 ARG 105 174 174 ARG ARG A . n A 1 106 ARG 106 175 175 ARG ARG A . n A 1 107 HIS 107 176 176 HIS HIS A . n A 1 108 PHE 108 177 177 PHE PHE A . n A 1 109 ASN 109 178 178 ASN ASN A . n A 1 110 GLU 110 179 179 GLU GLU A . n A 1 111 LEU 111 180 180 LEU LEU A . n A 1 112 GLU 112 181 181 GLU GLU A . n A 1 113 ALA 113 182 182 ALA ALA A . n A 1 114 SER 114 183 183 SER SER A . n A 1 115 VAL 115 184 184 VAL VAL A . n A 1 116 VAL 116 185 185 VAL VAL A . n A 1 117 VAL 117 186 186 VAL VAL A . n A 1 118 GLN 118 187 187 GLN GLN A . n A 1 119 ASP 119 188 188 ASP ASP A . n A 1 120 VAL 120 189 189 VAL VAL A . n A 1 121 ALA 121 190 190 ALA ALA A . n A 1 122 SER 122 191 191 SER SER A . n A 1 123 ALA 123 192 192 ALA ALA A . n A 1 124 LEU 124 193 193 LEU LEU A . n A 1 125 ASP 125 194 194 ASP ASP A . n A 1 126 PHE 126 195 195 PHE PHE A . n A 1 127 LEU 127 196 196 LEU LEU A . n A 1 128 HIS 128 197 197 HIS HIS A . n A 1 129 ASN 129 198 198 ASN ASN A . n A 1 130 LYS 130 199 199 LYS LYS A . n A 1 131 GLY 131 200 200 GLY GLY A . n A 1 132 ILE 132 201 201 ILE ILE A . n A 1 133 ALA 133 202 202 ALA ALA A . n A 1 134 HIS 134 203 203 HIS HIS A . n A 1 135 ARG 135 204 204 ARG ARG A . n A 1 136 ASP 136 205 205 ASP ASP A . n A 1 137 LEU 137 206 206 LEU LEU A . n A 1 138 LYS 138 207 207 LYS LYS A . n A 1 139 PRO 139 208 208 PRO PRO A . n A 1 140 GLU 140 209 209 GLU GLU A . n A 1 141 ASN 141 210 210 ASN ASN A . n A 1 142 ILE 142 211 211 ILE ILE A . n A 1 143 LEU 143 212 212 LEU LEU A . n A 1 144 CYS 144 213 213 CYS CYS A . n A 1 145 GLU 145 214 214 GLU GLU A . n A 1 146 HIS 146 215 215 HIS HIS A . n A 1 147 PRO 147 216 216 PRO PRO A . n A 1 148 ASN 148 217 217 ASN ASN A . n A 1 149 GLN 149 218 218 GLN GLN A . n A 1 150 VAL 150 219 219 VAL VAL A . n A 1 151 SER 151 220 220 SER SER A . n A 1 152 PRO 152 221 221 PRO PRO A . n A 1 153 VAL 153 222 222 VAL VAL A . n A 1 154 LYS 154 223 223 LYS LYS A . n A 1 155 ILE 155 224 224 ILE ILE A . n A 1 156 CYS 156 225 225 CYS CYS A . n A 1 157 ASP 157 226 226 ASP ASP A . n A 1 158 PHE 158 227 227 PHE PHE A . n A 1 159 GLY 159 228 228 GLY GLY A . n A 1 160 LEU 160 229 229 LEU LEU A . n A 1 161 GLY 161 230 230 GLY GLY A . n A 1 162 SER 162 231 231 SER SER A . n A 1 163 GLY 163 232 232 GLY GLY A . n A 1 164 ILE 164 233 ? ? ? A . n A 1 165 LYS 165 234 ? ? ? A . n A 1 166 LEU 166 235 ? ? ? A . n A 1 167 ASN 167 236 ? ? ? A . n A 1 168 GLY 168 237 ? ? ? A . n A 1 169 ASP 169 238 ? ? ? A . n A 1 170 CYS 170 239 ? ? ? A . n A 1 171 SER 171 240 ? ? ? A . n A 1 172 PRO 172 241 ? ? ? A . n A 1 173 ILE 173 242 ? ? ? A . n A 1 174 SER 174 243 ? ? ? A . n A 1 175 THR 175 244 ? ? ? A . n A 1 176 PRO 176 245 ? ? ? A . n A 1 177 GLU 177 246 ? ? ? A . n A 1 178 LEU 178 247 ? ? ? A . n A 1 179 LEU 179 248 ? ? ? A . n A 1 180 THR 180 249 249 THR THR A . n A 1 181 PRO 181 250 250 PRO PRO A . n A 1 182 CYS 182 251 251 CYS CYS A . n A 1 183 GLY 183 252 252 GLY GLY A . n A 1 184 SER 184 253 253 SER SER A . n A 1 185 ALA 185 254 254 ALA ALA A . n A 1 186 GLU 186 255 255 GLU GLU A . n A 1 187 TYR 187 256 256 TYR TYR A . n A 1 188 MET 188 257 257 MET MET A . n A 1 189 ALA 189 258 258 ALA ALA A . n A 1 190 PRO 190 259 259 PRO PRO A . n A 1 191 GLU 191 260 260 GLU GLU A . n A 1 192 VAL 192 261 261 VAL VAL A . n A 1 193 VAL 193 262 262 VAL VAL A . n A 1 194 GLU 194 263 263 GLU GLU A . n A 1 195 ALA 195 264 264 ALA ALA A . n A 1 196 PHE 196 265 265 PHE PHE A . n A 1 197 SER 197 266 266 SER SER A . n A 1 198 GLU 198 267 267 GLU GLU A . n A 1 199 GLU 199 268 268 GLU GLU A . n A 1 200 ALA 200 269 269 ALA ALA A . n A 1 201 SER 201 270 270 SER SER A . n A 1 202 ILE 202 271 271 ILE ILE A . n A 1 203 TYR 203 272 272 TYR TYR A . n A 1 204 ASP 204 273 273 ASP ASP A . n A 1 205 LYS 205 274 274 LYS LYS A . n A 1 206 ARG 206 275 275 ARG ARG A . n A 1 207 CYS 207 276 276 CYS CYS A . n A 1 208 ASP 208 277 277 ASP ASP A . n A 1 209 LEU 209 278 278 LEU LEU A . n A 1 210 TRP 210 279 279 TRP TRP A . n A 1 211 SER 211 280 280 SER SER A . n A 1 212 LEU 212 281 281 LEU LEU A . n A 1 213 GLY 213 282 282 GLY GLY A . n A 1 214 VAL 214 283 283 VAL VAL A . n A 1 215 ILE 215 284 284 ILE ILE A . n A 1 216 LEU 216 285 285 LEU LEU A . n A 1 217 TYR 217 286 286 TYR TYR A . n A 1 218 ILE 218 287 287 ILE ILE A . n A 1 219 LEU 219 288 288 LEU LEU A . n A 1 220 LEU 220 289 289 LEU LEU A . n A 1 221 SER 221 290 290 SER SER A . n A 1 222 GLY 222 291 291 GLY GLY A . n A 1 223 TYR 223 292 292 TYR TYR A . n A 1 224 PRO 224 293 293 PRO PRO A . n A 1 225 PRO 225 294 294 PRO PRO A . n A 1 226 PHE 226 295 295 PHE PHE A . n A 1 227 VAL 227 296 296 VAL VAL A . n A 1 228 GLY 228 297 297 GLY GLY A . n A 1 229 ARG 229 298 298 ARG ARG A . n A 1 230 CYS 230 299 299 CYS CYS A . n A 1 231 GLY 231 300 300 GLY GLY A . n A 1 232 SER 232 301 ? ? ? A . n A 1 233 ASP 233 302 ? ? ? A . n A 1 234 CYS 234 303 303 CYS CYS A . n A 1 235 GLY 235 304 304 GLY GLY A . n A 1 236 TRP 236 305 ? ? ? A . n A 1 237 ASP 237 306 ? ? ? A . n A 1 238 ARG 238 307 ? ? ? A . n A 1 239 GLY 239 308 ? ? ? A . n A 1 240 GLU 240 309 309 GLU GLU A . n A 1 241 ALA 241 310 310 ALA ALA A . n A 1 242 CYS 242 311 311 CYS CYS A . n A 1 243 PRO 243 312 312 PRO PRO A . n A 1 244 ALA 244 313 313 ALA ALA A . n A 1 245 CYS 245 314 314 CYS CYS A . n A 1 246 GLN 246 315 315 GLN GLN A . n A 1 247 ASN 247 316 316 ASN ASN A . n A 1 248 MET 248 317 317 MET MET A . n A 1 249 LEU 249 318 318 LEU LEU A . n A 1 250 PHE 250 319 319 PHE PHE A . n A 1 251 GLU 251 320 320 GLU GLU A . n A 1 252 SER 252 321 321 SER SER A . n A 1 253 ILE 253 322 322 ILE ILE A . n A 1 254 GLN 254 323 323 GLN GLN A . n A 1 255 GLU 255 324 324 GLU GLU A . n A 1 256 GLY 256 325 325 GLY GLY A . n A 1 257 LYS 257 326 326 LYS LYS A . n A 1 258 TYR 258 327 327 TYR TYR A . n A 1 259 GLU 259 328 328 GLU GLU A . n A 1 260 PHE 260 329 329 PHE PHE A . n A 1 261 PRO 261 330 330 PRO PRO A . n A 1 262 ASP 262 331 331 ASP ASP A . n A 1 263 LYS 263 332 332 LYS LYS A . n A 1 264 ASP 264 333 333 ASP ASP A . n A 1 265 TRP 265 334 334 TRP TRP A . n A 1 266 ALA 266 335 335 ALA ALA A . n A 1 267 HIS 267 336 336 HIS HIS A . n A 1 268 ILE 268 337 337 ILE ILE A . n A 1 269 SER 269 338 338 SER SER A . n A 1 270 CYS 270 339 339 CYS CYS A . n A 1 271 ALA 271 340 340 ALA ALA A . n A 1 272 ALA 272 341 341 ALA ALA A . n A 1 273 LYS 273 342 342 LYS LYS A . n A 1 274 ASP 274 343 343 ASP ASP A . n A 1 275 LEU 275 344 344 LEU LEU A . n A 1 276 ILE 276 345 345 ILE ILE A . n A 1 277 SER 277 346 346 SER SER A . n A 1 278 LYS 278 347 347 LYS LYS A . n A 1 279 LEU 279 348 348 LEU LEU A . n A 1 280 LEU 280 349 349 LEU LEU A . n A 1 281 VAL 281 350 350 VAL VAL A . n A 1 282 ARG 282 351 351 ARG ARG A . n A 1 283 ASP 283 352 352 ASP ASP A . n A 1 284 ALA 284 353 353 ALA ALA A . n A 1 285 LYS 285 354 354 LYS LYS A . n A 1 286 GLN 286 355 355 GLN GLN A . n A 1 287 ARG 287 356 356 ARG ARG A . n A 1 288 LEU 288 357 357 LEU LEU A . n A 1 289 SER 289 358 358 SER SER A . n A 1 290 ALA 290 359 359 ALA ALA A . n A 1 291 ALA 291 360 360 ALA ALA A . n A 1 292 GLN 292 361 361 GLN GLN A . n A 1 293 VAL 293 362 362 VAL VAL A . n A 1 294 LEU 294 363 363 LEU LEU A . n A 1 295 GLN 295 364 364 GLN GLN A . n A 1 296 HIS 296 365 365 HIS HIS A . n A 1 297 PRO 297 366 366 PRO PRO A . n A 1 298 TRP 298 367 367 TRP TRP A . n A 1 299 VAL 299 368 368 VAL VAL A . n A 1 300 GLN 300 369 369 GLN GLN A . n A 1 301 GLY 301 370 370 GLY GLY A . n A 1 302 CYS 302 371 371 CYS CYS A . n A 1 303 ALA 303 372 372 ALA ALA A . n A 1 304 PRO 304 373 373 PRO PRO A . n A 1 305 GLU 305 374 374 GLU GLU A . n A 1 306 ASN 306 375 375 ASN ASN A . n A 1 307 THR 307 376 ? ? ? A . n A 1 308 LEU 308 377 ? ? ? A . n A 1 309 PRO 309 378 ? ? ? A . n A 1 310 THR 310 379 ? ? ? A . n A 1 311 PRO 311 380 ? ? ? A . n A 1 312 MET 312 381 ? ? ? A . n A 1 313 VAL 313 382 ? ? ? A . n A 1 314 LEU 314 383 ? ? ? A . n A 1 315 GLN 315 384 ? ? ? A . n A 1 316 ARG 316 385 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1IWO _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1IWO _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 401 ZN ZN A . C 3 GOL 1 402 501 GOL GOL A . D 4 A1IWO 1 403 2001 A1IWO LIG A . E 5 HOH 1 501 17 HOH HOH A . E 5 HOH 2 502 7 HOH HOH A . E 5 HOH 3 503 2 HOH HOH A . E 5 HOH 4 504 6 HOH HOH A . E 5 HOH 5 505 9 HOH HOH A . E 5 HOH 6 506 19 HOH HOH A . E 5 HOH 7 507 5 HOH HOH A . E 5 HOH 8 508 18 HOH HOH A . E 5 HOH 9 509 10 HOH HOH A . E 5 HOH 10 510 3 HOH HOH A . E 5 HOH 11 511 15 HOH HOH A . E 5 HOH 12 512 4 HOH HOH A . E 5 HOH 13 513 8 HOH HOH A . E 5 HOH 14 514 1 HOH HOH A . E 5 HOH 15 515 13 HOH HOH A . E 5 HOH 16 516 14 HOH HOH A . E 5 HOH 17 517 12 HOH HOH A . E 5 HOH 18 518 20 HOH HOH A . E 5 HOH 19 519 16 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 20170601 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0415 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9HRC _cell.details ? _cell.formula_units_Z ? _cell.length_a 106.927 _cell.length_a_esd ? _cell.length_b 106.927 _cell.length_b_esd ? _cell.length_c 69.952 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9HRC _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9HRC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.06 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.1 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.02 M Magnesium Chloride, 0.1 M HEPES-NaOH pH 7.1 and 29% w/v Sodium Polyacrylate 5100' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-04-22 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976254 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'MAX IV BEAMLINE BioMAX' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.976254 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BioMAX _diffrn_source.pdbx_synchrotron_site 'MAX IV' # _reflns.B_iso_Wilson_estimate 77.3 _reflns.entry_id 9HRC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.16 _reflns.d_resolution_low 55.82 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8187 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.150 _reflns.pdbx_Rpim_I_all 0.045 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.143 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 3.16 3.38 ? 2.8 ? ? ? ? 1461 ? ? ? ? ? ? ? ? ? ? ? 20.9 ? ? ? 1.241 0.374 ? 1 1 0.864 ? ? 100.0 ? 1.183 ? ? ? ? ? ? ? ? ? 8.94 55.82 ? 39.6 ? ? ? ? 407 ? ? ? ? ? ? ? ? ? ? ? 18.2 ? ? ? 0.071 0.022 ? 2 1 0.998 ? ? 99.8 ? 0.068 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -3.735 _refine.aniso_B[1][2] -1.868 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -3.735 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 12.117 _refine.B_iso_max ? _refine.B_iso_mean 99.436 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.958 _refine.correlation_coeff_Fo_to_Fc_free 0.922 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9HRC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.161 _refine.ls_d_res_low 35.002 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8166 _refine.ls_number_reflns_R_free 383 _refine.ls_number_reflns_R_work 7783 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.902 _refine.ls_percent_reflns_R_free 4.690 _refine.ls_R_factor_all 0.186 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2434 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1831 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.425 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 19.246 _refine.overall_SU_ML 0.321 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2249 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 2297 _refine_hist.d_res_high 3.161 _refine_hist.d_res_low 35.002 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 0.012 2331 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 2158 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 0.768 1.667 3143 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.270 1.590 4974 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.736 5.000 280 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 4.571 5.000 15 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.865 10.000 393 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 4.539 10.000 4 ? r_dihedral_angle_other_3_deg ? ? 'X-RAY DIFFRACTION' ? 12.102 10.000 116 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.038 0.200 333 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 2737 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 540 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.200 0.200 527 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.176 0.200 2115 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.176 0.200 1140 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.076 0.200 1204 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.149 0.200 64 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.097 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.101 0.200 20 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.119 0.200 89 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.108 0.200 5 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 4.474 10.119 1132 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.470 10.119 1132 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 7.541 18.142 1410 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 7.539 18.139 1411 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.266 10.276 1199 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.264 10.273 1200 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 7.250 18.762 1733 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.248 18.757 1734 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 12.076 102.790 2684 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 12.074 102.774 2685 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.161 3.243 588 . 34 554 100.0000 . 0.308 . . 0.306 . . . . . 0.282 . 20 . 0.927 0.936 0.344 'X-RAY DIFFRACTION' 3.243 3.331 587 . 25 562 100.0000 . 0.277 . . 0.274 . . . . . 0.248 . 20 . 0.942 0.928 0.357 'X-RAY DIFFRACTION' 3.331 3.426 559 . 24 535 100.0000 . 0.251 . . 0.250 . . . . . 0.224 . 20 . 0.955 0.945 0.271 'X-RAY DIFFRACTION' 3.426 3.531 543 . 27 516 100.0000 . 0.237 . . 0.225 . . . . . 0.206 . 20 . 0.963 0.847 0.513 'X-RAY DIFFRACTION' 3.531 3.645 514 . 18 496 100.0000 . 0.211 . . 0.211 . . . . . 0.192 . 20 . 0.970 0.962 0.204 'X-RAY DIFFRACTION' 3.645 3.772 521 . 31 490 100.0000 . 0.199 . . 0.194 . . . . . 0.174 . 20 . 0.974 0.952 0.277 'X-RAY DIFFRACTION' 3.772 3.912 487 . 24 463 100.0000 . 0.183 . . 0.181 . . . . . 0.163 . 20 . 0.978 0.966 0.240 'X-RAY DIFFRACTION' 3.912 4.070 479 . 24 455 100.0000 . 0.168 . . 0.167 . . . . . 0.154 . 20 . 0.982 0.978 0.192 'X-RAY DIFFRACTION' 4.070 4.248 463 . 25 438 100.0000 . 0.148 . . 0.144 . . . . . 0.138 . 20 . 0.987 0.958 0.246 'X-RAY DIFFRACTION' 4.248 4.453 439 . 14 425 100.0000 . 0.143 . . 0.142 . . . . . 0.136 . 20 . 0.986 0.982 0.182 'X-RAY DIFFRACTION' 4.453 4.689 415 . 23 392 100.0000 . 0.147 . . 0.147 . . . . . 0.141 . 20 . 0.987 0.984 0.140 'X-RAY DIFFRACTION' 4.689 4.968 397 . 21 376 100.0000 . 0.141 . . 0.139 . . . . . 0.136 . 20 . 0.988 0.978 0.189 'X-RAY DIFFRACTION' 4.968 5.303 381 . 23 358 100.0000 . 0.183 . . 0.176 . . . . . 0.175 . 20 . 0.983 0.937 0.275 'X-RAY DIFFRACTION' 5.303 5.717 346 . 9 337 100.0000 . 0.202 . . 0.205 . . . . . 0.200 . 20 . 0.972 0.992 0.125 'X-RAY DIFFRACTION' 5.717 6.246 331 . 15 316 100.0000 . 0.225 . . 0.223 . . . . . 0.219 . 20 . 0.970 0.966 0.275 'X-RAY DIFFRACTION' 6.246 6.956 295 . 15 280 100.0000 . 0.201 . . 0.196 . . . . . 0.196 . 20 . 0.977 0.952 0.307 'X-RAY DIFFRACTION' 6.956 7.980 281 . 14 267 100.0000 . 0.176 . . 0.170 . . . . . 0.187 . 20 . 0.981 0.961 0.275 'X-RAY DIFFRACTION' 7.980 9.649 224 . 5 219 100.0000 . 0.158 . . 0.158 . . . . . 0.171 . 20 . 0.983 0.990 0.166 'X-RAY DIFFRACTION' 9.649 13.155 190 . 5 185 100.0000 . 0.143 . . 0.144 . . . . . 0.165 . 20 . 0.987 0.994 0.097 'X-RAY DIFFRACTION' 13.155 35.002 126 . 7 119 100.0000 . 0.272 . . 0.266 . . . . . 0.275 . 20 . 0.951 0.887 0.394 # _struct.entry_id 9HRC _struct.title 'Structure of MNK2 in complex with inhibitor NUCC-0201049' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9HRC _struct_keywords.text 'MNK2, inhibitor, NUCC-020149, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MKNK2_HUMAN _struct_ref.pdbx_db_accession Q9HBH9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFREVEMLYQCQGHRNVLELIEFFEE EDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGS GIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCGSDCGWDRGEAC PACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWVQGCAPENTLPTPMVLQR ; _struct_ref.pdbx_align_begin 72 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9HRC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 316 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HBH9 _struct_ref_seq.db_align_beg 72 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 385 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 72 _struct_ref_seq.pdbx_auth_seq_align_end 385 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9HRC GLY A 1 ? UNP Q9HBH9 ? ? 'expression tag' 70 1 1 9HRC SER A 2 ? UNP Q9HBH9 ? ? 'expression tag' 71 2 1 9HRC GLY A 159 ? UNP Q9HBH9 ASP 228 'engineered mutation' 228 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 250 ? 1 MORE -0 ? 1 'SSA (A^2)' 16320 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 9 ? VAL A 13 ? ARG A 78 VAL A 82 1 ? 5 HELX_P HELX_P2 AA2 ARG A 54 ? CYS A 67 ? ARG A 123 CYS A 136 1 ? 14 HELX_P HELX_P3 AA3 ILE A 98 ? ARG A 106 ? ILE A 167 ARG A 175 1 ? 9 HELX_P HELX_P4 AA4 ASN A 109 ? LYS A 130 ? ASN A 178 LYS A 199 1 ? 22 HELX_P HELX_P5 AA5 LYS A 138 ? GLU A 140 ? LYS A 207 GLU A 209 5 ? 3 HELX_P HELX_P6 AA6 GLY A 183 ? MET A 188 ? GLY A 252 MET A 257 5 ? 6 HELX_P HELX_P7 AA7 ALA A 189 ? ALA A 195 ? ALA A 258 ALA A 264 1 ? 7 HELX_P HELX_P8 AA8 SER A 197 ? ASP A 204 ? SER A 266 ASP A 273 1 ? 8 HELX_P HELX_P9 AA9 ARG A 206 ? GLY A 222 ? ARG A 275 GLY A 291 1 ? 17 HELX_P HELX_P10 AB1 CYS A 242 ? GLY A 256 ? CYS A 311 GLY A 325 1 ? 15 HELX_P HELX_P11 AB2 PRO A 261 ? ALA A 266 ? PRO A 330 ALA A 335 1 ? 6 HELX_P HELX_P12 AB3 SER A 269 ? LEU A 280 ? SER A 338 LEU A 349 1 ? 12 HELX_P HELX_P13 AB4 SER A 289 ? LEU A 294 ? SER A 358 LEU A 363 1 ? 6 HELX_P HELX_P14 AB5 HIS A 296 ? GLY A 301 ? HIS A 365 GLY A 370 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 230 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 299 A ZN 401 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc2 metalc ? ? A CYS 234 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 303 A ZN 401 1_555 ? ? ? ? ? ? ? 2.344 ? ? metalc3 metalc ? ? A CYS 242 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 311 A ZN 401 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc4 metalc ? ? A CYS 245 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 314 A ZN 401 1_555 ? ? ? ? ? ? ? 2.350 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 230 ? A CYS 299 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 234 ? A CYS 303 ? 1_555 97.0 ? 2 SG ? A CYS 230 ? A CYS 299 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 242 ? A CYS 311 ? 1_555 134.6 ? 3 SG ? A CYS 234 ? A CYS 303 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 242 ? A CYS 311 ? 1_555 115.5 ? 4 SG ? A CYS 230 ? A CYS 299 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 245 ? A CYS 314 ? 1_555 90.2 ? 5 SG ? A CYS 234 ? A CYS 303 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 245 ? A CYS 314 ? 1_555 112.1 ? 6 SG ? A CYS 242 ? A CYS 311 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 SG ? A CYS 245 ? A CYS 314 ? 1_555 104.4 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 151 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 220 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 152 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 221 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -12.96 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 14 ? LEU A 16 ? TYR A 83 LEU A 85 AA1 2 ARG A 28 ? ASN A 34 ? ARG A 97 ASN A 103 AA1 3 GLY A 22 ? GLU A 23 ? GLY A 91 GLU A 92 AA2 1 TYR A 14 ? LEU A 16 ? TYR A 83 LEU A 85 AA2 2 ARG A 28 ? ASN A 34 ? ARG A 97 ASN A 103 AA2 3 GLU A 40 ? GLU A 47 ? GLU A 109 GLU A 116 AA2 4 ARG A 85 ? GLU A 91 ? ARG A 154 GLU A 160 AA2 5 LEU A 76 ? GLU A 81 ? LEU A 145 GLU A 150 AA3 1 GLY A 96 ? SER A 97 ? GLY A 165 SER A 166 AA3 2 ILE A 142 ? CYS A 144 ? ILE A 211 CYS A 213 AA3 3 VAL A 153 ? ILE A 155 ? VAL A 222 ILE A 224 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 15 ? N GLN A 84 O ILE A 33 ? O ILE A 102 AA1 2 3 O VAL A 29 ? O VAL A 98 N GLY A 22 ? N GLY A 91 AA2 1 2 N GLN A 15 ? N GLN A 84 O ILE A 33 ? O ILE A 102 AA2 2 3 N CYS A 32 ? N CYS A 101 O TYR A 41 ? O TYR A 110 AA2 3 4 N LYS A 44 ? N LYS A 113 O LEU A 88 ? O LEU A 157 AA2 4 5 O VAL A 89 ? O VAL A 158 N ILE A 77 ? N ILE A 146 AA3 1 2 N GLY A 96 ? N GLY A 165 O CYS A 144 ? O CYS A 213 AA3 2 3 N LEU A 143 ? N LEU A 212 O LYS A 154 ? O LYS A 223 # _pdbx_entry_details.entry_id 9HRC _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 72 ? ? -103.13 47.89 2 1 PHE A 75 ? ? -133.58 -54.18 3 1 PRO A 119 ? ? -65.97 95.55 4 1 HIS A 121 ? ? -71.74 -159.24 5 1 ARG A 175 ? ? 75.62 -55.43 6 1 ASP A 205 ? ? -160.93 52.17 7 1 CYS A 251 ? ? 70.21 173.07 8 1 GLN A 369 ? ? -104.76 -61.31 9 1 GLU A 374 ? ? 53.22 -116.10 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 233 ? A ILE 164 2 1 Y 1 A LYS 234 ? A LYS 165 3 1 Y 1 A LEU 235 ? A LEU 166 4 1 Y 1 A ASN 236 ? A ASN 167 5 1 Y 1 A GLY 237 ? A GLY 168 6 1 Y 1 A ASP 238 ? A ASP 169 7 1 Y 1 A CYS 239 ? A CYS 170 8 1 Y 1 A SER 240 ? A SER 171 9 1 Y 1 A PRO 241 ? A PRO 172 10 1 Y 1 A ILE 242 ? A ILE 173 11 1 Y 1 A SER 243 ? A SER 174 12 1 Y 1 A THR 244 ? A THR 175 13 1 Y 1 A PRO 245 ? A PRO 176 14 1 Y 1 A GLU 246 ? A GLU 177 15 1 Y 1 A LEU 247 ? A LEU 178 16 1 Y 1 A LEU 248 ? A LEU 179 17 1 Y 1 A SER 301 ? A SER 232 18 1 Y 1 A ASP 302 ? A ASP 233 19 1 Y 1 A TRP 305 ? A TRP 236 20 1 Y 1 A ASP 306 ? A ASP 237 21 1 Y 1 A ARG 307 ? A ARG 238 22 1 Y 1 A GLY 308 ? A GLY 239 23 1 Y 1 A THR 376 ? A THR 307 24 1 Y 1 A LEU 377 ? A LEU 308 25 1 Y 1 A PRO 378 ? A PRO 309 26 1 Y 1 A THR 379 ? A THR 310 27 1 Y 1 A PRO 380 ? A PRO 311 28 1 Y 1 A MET 381 ? A MET 312 29 1 Y 1 A VAL 382 ? A VAL 313 30 1 Y 1 A LEU 383 ? A LEU 314 31 1 Y 1 A GLN 384 ? A GLN 315 32 1 Y 1 A ARG 385 ? A ARG 316 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1IWO N1 N Y N 1 A1IWO N3 N Y N 2 A1IWO C4 C N R 3 A1IWO C5 C N N 4 A1IWO C6 C N N 5 A1IWO C7 C N N 6 A1IWO C8 C Y N 7 A1IWO C10 C Y N 8 A1IWO C13 C Y N 9 A1IWO CL CL N N 10 A1IWO C C Y N 11 A1IWO C3 C Y N 12 A1IWO O O N N 13 A1IWO N2 N N N 14 A1IWO C2 C Y N 15 A1IWO N N Y N 16 A1IWO C1 C Y N 17 A1IWO C14 C Y N 18 A1IWO C9 C Y N 19 A1IWO N4 N Y N 20 A1IWO C12 C Y N 21 A1IWO C11 C Y N 22 A1IWO H H N N 23 A1IWO H2 H N N 24 A1IWO H3 H N N 25 A1IWO H4 H N N 26 A1IWO H5 H N N 27 A1IWO H7 H N N 28 A1IWO H8 H N N 29 A1IWO H9 H N N 30 A1IWO H10 H N N 31 A1IWO H13 H N N 32 A1IWO H6 H N N 33 A1IWO H1 H N N 34 A1IWO H12 H N N 35 A1IWO H11 H N N 36 ALA N N N N 37 ALA CA C N S 38 ALA C C N N 39 ALA O O N N 40 ALA CB C N N 41 ALA OXT O N N 42 ALA H H N N 43 ALA H2 H N N 44 ALA HA H N N 45 ALA HB1 H N N 46 ALA HB2 H N N 47 ALA HB3 H N N 48 ALA HXT H N N 49 ARG N N N N 50 ARG CA C N S 51 ARG C C N N 52 ARG O O N N 53 ARG CB C N N 54 ARG CG C N N 55 ARG CD C N N 56 ARG NE N N N 57 ARG CZ C N N 58 ARG NH1 N N N 59 ARG NH2 N N N 60 ARG OXT O N N 61 ARG H H N N 62 ARG H2 H N N 63 ARG HA H N N 64 ARG HB2 H N N 65 ARG HB3 H N N 66 ARG HG2 H N N 67 ARG HG3 H N N 68 ARG HD2 H N N 69 ARG HD3 H N N 70 ARG HE H N N 71 ARG HH11 H N N 72 ARG HH12 H N N 73 ARG HH21 H N N 74 ARG HH22 H N N 75 ARG HXT H N N 76 ASN N N N N 77 ASN CA C N S 78 ASN C C N N 79 ASN O O N N 80 ASN CB C N N 81 ASN CG C N N 82 ASN OD1 O N N 83 ASN ND2 N N N 84 ASN OXT O N N 85 ASN H H N N 86 ASN H2 H N N 87 ASN HA H N N 88 ASN HB2 H N N 89 ASN HB3 H N N 90 ASN HD21 H N N 91 ASN HD22 H N N 92 ASN HXT H N N 93 ASP N N N N 94 ASP CA C N S 95 ASP C C N N 96 ASP O O N N 97 ASP CB C N N 98 ASP CG C N N 99 ASP OD1 O N N 100 ASP OD2 O N N 101 ASP OXT O N N 102 ASP H H N N 103 ASP H2 H N N 104 ASP HA H N N 105 ASP HB2 H N N 106 ASP HB3 H N N 107 ASP HD2 H N N 108 ASP HXT H N N 109 CYS N N N N 110 CYS CA C N R 111 CYS C C N N 112 CYS O O N N 113 CYS CB C N N 114 CYS SG S N N 115 CYS OXT O N N 116 CYS H H N N 117 CYS H2 H N N 118 CYS HA H N N 119 CYS HB2 H N N 120 CYS HB3 H N N 121 CYS HG H N N 122 CYS HXT H N N 123 GLN N N N N 124 GLN CA C N S 125 GLN C C N N 126 GLN O O N N 127 GLN CB C N N 128 GLN CG C N N 129 GLN CD C N N 130 GLN OE1 O N N 131 GLN NE2 N N N 132 GLN OXT O N N 133 GLN H H N N 134 GLN H2 H N N 135 GLN HA H N N 136 GLN HB2 H N N 137 GLN HB3 H N N 138 GLN HG2 H N N 139 GLN HG3 H N N 140 GLN HE21 H N N 141 GLN HE22 H N N 142 GLN HXT H N N 143 GLU N N N N 144 GLU CA C N S 145 GLU C C N N 146 GLU O O N N 147 GLU CB C N N 148 GLU CG C N N 149 GLU CD C N N 150 GLU OE1 O N N 151 GLU OE2 O N N 152 GLU OXT O N N 153 GLU H H N N 154 GLU H2 H N N 155 GLU HA H N N 156 GLU HB2 H N N 157 GLU HB3 H N N 158 GLU HG2 H N N 159 GLU HG3 H N N 160 GLU HE2 H N N 161 GLU HXT H N N 162 GLY N N N N 163 GLY CA C N N 164 GLY C C N N 165 GLY O O N N 166 GLY OXT O N N 167 GLY H H N N 168 GLY H2 H N N 169 GLY HA2 H N N 170 GLY HA3 H N N 171 GLY HXT H N N 172 GOL C1 C N N 173 GOL O1 O N N 174 GOL C2 C N N 175 GOL O2 O N N 176 GOL C3 C N N 177 GOL O3 O N N 178 GOL H11 H N N 179 GOL H12 H N N 180 GOL HO1 H N N 181 GOL H2 H N N 182 GOL HO2 H N N 183 GOL H31 H N N 184 GOL H32 H N N 185 GOL HO3 H N N 186 HIS N N N N 187 HIS CA C N S 188 HIS C C N N 189 HIS O O N N 190 HIS CB C N N 191 HIS CG C Y N 192 HIS ND1 N Y N 193 HIS CD2 C Y N 194 HIS CE1 C Y N 195 HIS NE2 N Y N 196 HIS OXT O N N 197 HIS H H N N 198 HIS H2 H N N 199 HIS HA H N N 200 HIS HB2 H N N 201 HIS HB3 H N N 202 HIS HD1 H N N 203 HIS HD2 H N N 204 HIS HE1 H N N 205 HIS HE2 H N N 206 HIS HXT H N N 207 HOH O O N N 208 HOH H1 H N N 209 HOH H2 H N N 210 ILE N N N N 211 ILE CA C N S 212 ILE C C N N 213 ILE O O N N 214 ILE CB C N S 215 ILE CG1 C N N 216 ILE CG2 C N N 217 ILE CD1 C N N 218 ILE OXT O N N 219 ILE H H N N 220 ILE H2 H N N 221 ILE HA H N N 222 ILE HB H N N 223 ILE HG12 H N N 224 ILE HG13 H N N 225 ILE HG21 H N N 226 ILE HG22 H N N 227 ILE HG23 H N N 228 ILE HD11 H N N 229 ILE HD12 H N N 230 ILE HD13 H N N 231 ILE HXT H N N 232 LEU N N N N 233 LEU CA C N S 234 LEU C C N N 235 LEU O O N N 236 LEU CB C N N 237 LEU CG C N N 238 LEU CD1 C N N 239 LEU CD2 C N N 240 LEU OXT O N N 241 LEU H H N N 242 LEU H2 H N N 243 LEU HA H N N 244 LEU HB2 H N N 245 LEU HB3 H N N 246 LEU HG H N N 247 LEU HD11 H N N 248 LEU HD12 H N N 249 LEU HD13 H N N 250 LEU HD21 H N N 251 LEU HD22 H N N 252 LEU HD23 H N N 253 LEU HXT H N N 254 LYS N N N N 255 LYS CA C N S 256 LYS C C N N 257 LYS O O N N 258 LYS CB C N N 259 LYS CG C N N 260 LYS CD C N N 261 LYS CE C N N 262 LYS NZ N N N 263 LYS OXT O N N 264 LYS H H N N 265 LYS H2 H N N 266 LYS HA H N N 267 LYS HB2 H N N 268 LYS HB3 H N N 269 LYS HG2 H N N 270 LYS HG3 H N N 271 LYS HD2 H N N 272 LYS HD3 H N N 273 LYS HE2 H N N 274 LYS HE3 H N N 275 LYS HZ1 H N N 276 LYS HZ2 H N N 277 LYS HZ3 H N N 278 LYS HXT H N N 279 MET N N N N 280 MET CA C N S 281 MET C C N N 282 MET O O N N 283 MET CB C N N 284 MET CG C N N 285 MET SD S N N 286 MET CE C N N 287 MET OXT O N N 288 MET H H N N 289 MET H2 H N N 290 MET HA H N N 291 MET HB2 H N N 292 MET HB3 H N N 293 MET HG2 H N N 294 MET HG3 H N N 295 MET HE1 H N N 296 MET HE2 H N N 297 MET HE3 H N N 298 MET HXT H N N 299 PHE N N N N 300 PHE CA C N S 301 PHE C C N N 302 PHE O O N N 303 PHE CB C N N 304 PHE CG C Y N 305 PHE CD1 C Y N 306 PHE CD2 C Y N 307 PHE CE1 C Y N 308 PHE CE2 C Y N 309 PHE CZ C Y N 310 PHE OXT O N N 311 PHE H H N N 312 PHE H2 H N N 313 PHE HA H N N 314 PHE HB2 H N N 315 PHE HB3 H N N 316 PHE HD1 H N N 317 PHE HD2 H N N 318 PHE HE1 H N N 319 PHE HE2 H N N 320 PHE HZ H N N 321 PHE HXT H N N 322 PRO N N N N 323 PRO CA C N S 324 PRO C C N N 325 PRO O O N N 326 PRO CB C N N 327 PRO CG C N N 328 PRO CD C N N 329 PRO OXT O N N 330 PRO H H N N 331 PRO HA H N N 332 PRO HB2 H N N 333 PRO HB3 H N N 334 PRO HG2 H N N 335 PRO HG3 H N N 336 PRO HD2 H N N 337 PRO HD3 H N N 338 PRO HXT H N N 339 SER N N N N 340 SER CA C N S 341 SER C C N N 342 SER O O N N 343 SER CB C N N 344 SER OG O N N 345 SER OXT O N N 346 SER H H N N 347 SER H2 H N N 348 SER HA H N N 349 SER HB2 H N N 350 SER HB3 H N N 351 SER HG H N N 352 SER HXT H N N 353 THR N N N N 354 THR CA C N S 355 THR C C N N 356 THR O O N N 357 THR CB C N R 358 THR OG1 O N N 359 THR CG2 C N N 360 THR OXT O N N 361 THR H H N N 362 THR H2 H N N 363 THR HA H N N 364 THR HB H N N 365 THR HG1 H N N 366 THR HG21 H N N 367 THR HG22 H N N 368 THR HG23 H N N 369 THR HXT H N N 370 TRP N N N N 371 TRP CA C N S 372 TRP C C N N 373 TRP O O N N 374 TRP CB C N N 375 TRP CG C Y N 376 TRP CD1 C Y N 377 TRP CD2 C Y N 378 TRP NE1 N Y N 379 TRP CE2 C Y N 380 TRP CE3 C Y N 381 TRP CZ2 C Y N 382 TRP CZ3 C Y N 383 TRP CH2 C Y N 384 TRP OXT O N N 385 TRP H H N N 386 TRP H2 H N N 387 TRP HA H N N 388 TRP HB2 H N N 389 TRP HB3 H N N 390 TRP HD1 H N N 391 TRP HE1 H N N 392 TRP HE3 H N N 393 TRP HZ2 H N N 394 TRP HZ3 H N N 395 TRP HH2 H N N 396 TRP HXT H N N 397 TYR N N N N 398 TYR CA C N S 399 TYR C C N N 400 TYR O O N N 401 TYR CB C N N 402 TYR CG C Y N 403 TYR CD1 C Y N 404 TYR CD2 C Y N 405 TYR CE1 C Y N 406 TYR CE2 C Y N 407 TYR CZ C Y N 408 TYR OH O N N 409 TYR OXT O N N 410 TYR H H N N 411 TYR H2 H N N 412 TYR HA H N N 413 TYR HB2 H N N 414 TYR HB3 H N N 415 TYR HD1 H N N 416 TYR HD2 H N N 417 TYR HE1 H N N 418 TYR HE2 H N N 419 TYR HH H N N 420 TYR HXT H N N 421 VAL N N N N 422 VAL CA C N S 423 VAL C C N N 424 VAL O O N N 425 VAL CB C N N 426 VAL CG1 C N N 427 VAL CG2 C N N 428 VAL OXT O N N 429 VAL H H N N 430 VAL H2 H N N 431 VAL HA H N N 432 VAL HB H N N 433 VAL HG11 H N N 434 VAL HG12 H N N 435 VAL HG13 H N N 436 VAL HG21 H N N 437 VAL HG22 H N N 438 VAL HG23 H N N 439 VAL HXT H N N 440 ZN ZN ZN N N 441 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1IWO C CL sing N N 1 A1IWO C C1 doub Y N 2 A1IWO C1 N sing Y N 3 A1IWO N C2 doub Y N 4 A1IWO C2 N1 sing Y N 5 A1IWO N1 C3 doub Y N 6 A1IWO C3 C sing Y N 7 A1IWO O C3 sing N N 8 A1IWO C4 O sing N N 9 A1IWO C4 C5 sing N N 10 A1IWO C5 C6 sing N N 11 A1IWO C6 N2 sing N N 12 A1IWO N2 C7 sing N N 13 A1IWO C7 C4 sing N N 14 A1IWO N3 C2 sing N N 15 A1IWO N3 C8 sing Y N 16 A1IWO C8 N4 doub Y N 17 A1IWO N4 C9 sing Y N 18 A1IWO C9 C10 doub Y N 19 A1IWO C10 C11 sing Y N 20 A1IWO C11 C12 doub Y N 21 A1IWO C12 C13 sing Y N 22 A1IWO C13 C14 doub Y N 23 A1IWO C14 N3 sing Y N 24 A1IWO C9 C14 sing Y N 25 A1IWO C4 H sing N N 26 A1IWO C5 H2 sing N N 27 A1IWO C5 H3 sing N N 28 A1IWO C6 H4 sing N N 29 A1IWO C6 H5 sing N N 30 A1IWO C7 H7 sing N N 31 A1IWO C7 H8 sing N N 32 A1IWO C8 H9 sing N N 33 A1IWO C10 H10 sing N N 34 A1IWO C13 H13 sing N N 35 A1IWO N2 H6 sing N N 36 A1IWO C1 H1 sing N N 37 A1IWO C12 H12 sing N N 38 A1IWO C11 H11 sing N N 39 ALA N CA sing N N 40 ALA N H sing N N 41 ALA N H2 sing N N 42 ALA CA C sing N N 43 ALA CA CB sing N N 44 ALA CA HA sing N N 45 ALA C O doub N N 46 ALA C OXT sing N N 47 ALA CB HB1 sing N N 48 ALA CB HB2 sing N N 49 ALA CB HB3 sing N N 50 ALA OXT HXT sing N N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 CYS N CA sing N N 109 CYS N H sing N N 110 CYS N H2 sing N N 111 CYS CA C sing N N 112 CYS CA CB sing N N 113 CYS CA HA sing N N 114 CYS C O doub N N 115 CYS C OXT sing N N 116 CYS CB SG sing N N 117 CYS CB HB2 sing N N 118 CYS CB HB3 sing N N 119 CYS SG HG sing N N 120 CYS OXT HXT sing N N 121 GLN N CA sing N N 122 GLN N H sing N N 123 GLN N H2 sing N N 124 GLN CA C sing N N 125 GLN CA CB sing N N 126 GLN CA HA sing N N 127 GLN C O doub N N 128 GLN C OXT sing N N 129 GLN CB CG sing N N 130 GLN CB HB2 sing N N 131 GLN CB HB3 sing N N 132 GLN CG CD sing N N 133 GLN CG HG2 sing N N 134 GLN CG HG3 sing N N 135 GLN CD OE1 doub N N 136 GLN CD NE2 sing N N 137 GLN NE2 HE21 sing N N 138 GLN NE2 HE22 sing N N 139 GLN OXT HXT sing N N 140 GLU N CA sing N N 141 GLU N H sing N N 142 GLU N H2 sing N N 143 GLU CA C sing N N 144 GLU CA CB sing N N 145 GLU CA HA sing N N 146 GLU C O doub N N 147 GLU C OXT sing N N 148 GLU CB CG sing N N 149 GLU CB HB2 sing N N 150 GLU CB HB3 sing N N 151 GLU CG CD sing N N 152 GLU CG HG2 sing N N 153 GLU CG HG3 sing N N 154 GLU CD OE1 doub N N 155 GLU CD OE2 sing N N 156 GLU OE2 HE2 sing N N 157 GLU OXT HXT sing N N 158 GLY N CA sing N N 159 GLY N H sing N N 160 GLY N H2 sing N N 161 GLY CA C sing N N 162 GLY CA HA2 sing N N 163 GLY CA HA3 sing N N 164 GLY C O doub N N 165 GLY C OXT sing N N 166 GLY OXT HXT sing N N 167 GOL C1 O1 sing N N 168 GOL C1 C2 sing N N 169 GOL C1 H11 sing N N 170 GOL C1 H12 sing N N 171 GOL O1 HO1 sing N N 172 GOL C2 O2 sing N N 173 GOL C2 C3 sing N N 174 GOL C2 H2 sing N N 175 GOL O2 HO2 sing N N 176 GOL C3 O3 sing N N 177 GOL C3 H31 sing N N 178 GOL C3 H32 sing N N 179 GOL O3 HO3 sing N N 180 HIS N CA sing N N 181 HIS N H sing N N 182 HIS N H2 sing N N 183 HIS CA C sing N N 184 HIS CA CB sing N N 185 HIS CA HA sing N N 186 HIS C O doub N N 187 HIS C OXT sing N N 188 HIS CB CG sing N N 189 HIS CB HB2 sing N N 190 HIS CB HB3 sing N N 191 HIS CG ND1 sing Y N 192 HIS CG CD2 doub Y N 193 HIS ND1 CE1 doub Y N 194 HIS ND1 HD1 sing N N 195 HIS CD2 NE2 sing Y N 196 HIS CD2 HD2 sing N N 197 HIS CE1 NE2 sing Y N 198 HIS CE1 HE1 sing N N 199 HIS NE2 HE2 sing N N 200 HIS OXT HXT sing N N 201 HOH O H1 sing N N 202 HOH O H2 sing N N 203 ILE N CA sing N N 204 ILE N H sing N N 205 ILE N H2 sing N N 206 ILE CA C sing N N 207 ILE CA CB sing N N 208 ILE CA HA sing N N 209 ILE C O doub N N 210 ILE C OXT sing N N 211 ILE CB CG1 sing N N 212 ILE CB CG2 sing N N 213 ILE CB HB sing N N 214 ILE CG1 CD1 sing N N 215 ILE CG1 HG12 sing N N 216 ILE CG1 HG13 sing N N 217 ILE CG2 HG21 sing N N 218 ILE CG2 HG22 sing N N 219 ILE CG2 HG23 sing N N 220 ILE CD1 HD11 sing N N 221 ILE CD1 HD12 sing N N 222 ILE CD1 HD13 sing N N 223 ILE OXT HXT sing N N 224 LEU N CA sing N N 225 LEU N H sing N N 226 LEU N H2 sing N N 227 LEU CA C sing N N 228 LEU CA CB sing N N 229 LEU CA HA sing N N 230 LEU C O doub N N 231 LEU C OXT sing N N 232 LEU CB CG sing N N 233 LEU CB HB2 sing N N 234 LEU CB HB3 sing N N 235 LEU CG CD1 sing N N 236 LEU CG CD2 sing N N 237 LEU CG HG sing N N 238 LEU CD1 HD11 sing N N 239 LEU CD1 HD12 sing N N 240 LEU CD1 HD13 sing N N 241 LEU CD2 HD21 sing N N 242 LEU CD2 HD22 sing N N 243 LEU CD2 HD23 sing N N 244 LEU OXT HXT sing N N 245 LYS N CA sing N N 246 LYS N H sing N N 247 LYS N H2 sing N N 248 LYS CA C sing N N 249 LYS CA CB sing N N 250 LYS CA HA sing N N 251 LYS C O doub N N 252 LYS C OXT sing N N 253 LYS CB CG sing N N 254 LYS CB HB2 sing N N 255 LYS CB HB3 sing N N 256 LYS CG CD sing N N 257 LYS CG HG2 sing N N 258 LYS CG HG3 sing N N 259 LYS CD CE sing N N 260 LYS CD HD2 sing N N 261 LYS CD HD3 sing N N 262 LYS CE NZ sing N N 263 LYS CE HE2 sing N N 264 LYS CE HE3 sing N N 265 LYS NZ HZ1 sing N N 266 LYS NZ HZ2 sing N N 267 LYS NZ HZ3 sing N N 268 LYS OXT HXT sing N N 269 MET N CA sing N N 270 MET N H sing N N 271 MET N H2 sing N N 272 MET CA C sing N N 273 MET CA CB sing N N 274 MET CA HA sing N N 275 MET C O doub N N 276 MET C OXT sing N N 277 MET CB CG sing N N 278 MET CB HB2 sing N N 279 MET CB HB3 sing N N 280 MET CG SD sing N N 281 MET CG HG2 sing N N 282 MET CG HG3 sing N N 283 MET SD CE sing N N 284 MET CE HE1 sing N N 285 MET CE HE2 sing N N 286 MET CE HE3 sing N N 287 MET OXT HXT sing N N 288 PHE N CA sing N N 289 PHE N H sing N N 290 PHE N H2 sing N N 291 PHE CA C sing N N 292 PHE CA CB sing N N 293 PHE CA HA sing N N 294 PHE C O doub N N 295 PHE C OXT sing N N 296 PHE CB CG sing N N 297 PHE CB HB2 sing N N 298 PHE CB HB3 sing N N 299 PHE CG CD1 doub Y N 300 PHE CG CD2 sing Y N 301 PHE CD1 CE1 sing Y N 302 PHE CD1 HD1 sing N N 303 PHE CD2 CE2 doub Y N 304 PHE CD2 HD2 sing N N 305 PHE CE1 CZ doub Y N 306 PHE CE1 HE1 sing N N 307 PHE CE2 CZ sing Y N 308 PHE CE2 HE2 sing N N 309 PHE CZ HZ sing N N 310 PHE OXT HXT sing N N 311 PRO N CA sing N N 312 PRO N CD sing N N 313 PRO N H sing N N 314 PRO CA C sing N N 315 PRO CA CB sing N N 316 PRO CA HA sing N N 317 PRO C O doub N N 318 PRO C OXT sing N N 319 PRO CB CG sing N N 320 PRO CB HB2 sing N N 321 PRO CB HB3 sing N N 322 PRO CG CD sing N N 323 PRO CG HG2 sing N N 324 PRO CG HG3 sing N N 325 PRO CD HD2 sing N N 326 PRO CD HD3 sing N N 327 PRO OXT HXT sing N N 328 SER N CA sing N N 329 SER N H sing N N 330 SER N H2 sing N N 331 SER CA C sing N N 332 SER CA CB sing N N 333 SER CA HA sing N N 334 SER C O doub N N 335 SER C OXT sing N N 336 SER CB OG sing N N 337 SER CB HB2 sing N N 338 SER CB HB3 sing N N 339 SER OG HG sing N N 340 SER OXT HXT sing N N 341 THR N CA sing N N 342 THR N H sing N N 343 THR N H2 sing N N 344 THR CA C sing N N 345 THR CA CB sing N N 346 THR CA HA sing N N 347 THR C O doub N N 348 THR C OXT sing N N 349 THR CB OG1 sing N N 350 THR CB CG2 sing N N 351 THR CB HB sing N N 352 THR OG1 HG1 sing N N 353 THR CG2 HG21 sing N N 354 THR CG2 HG22 sing N N 355 THR CG2 HG23 sing N N 356 THR OXT HXT sing N N 357 TRP N CA sing N N 358 TRP N H sing N N 359 TRP N H2 sing N N 360 TRP CA C sing N N 361 TRP CA CB sing N N 362 TRP CA HA sing N N 363 TRP C O doub N N 364 TRP C OXT sing N N 365 TRP CB CG sing N N 366 TRP CB HB2 sing N N 367 TRP CB HB3 sing N N 368 TRP CG CD1 doub Y N 369 TRP CG CD2 sing Y N 370 TRP CD1 NE1 sing Y N 371 TRP CD1 HD1 sing N N 372 TRP CD2 CE2 doub Y N 373 TRP CD2 CE3 sing Y N 374 TRP NE1 CE2 sing Y N 375 TRP NE1 HE1 sing N N 376 TRP CE2 CZ2 sing Y N 377 TRP CE3 CZ3 doub Y N 378 TRP CE3 HE3 sing N N 379 TRP CZ2 CH2 doub Y N 380 TRP CZ2 HZ2 sing N N 381 TRP CZ3 CH2 sing Y N 382 TRP CZ3 HZ3 sing N N 383 TRP CH2 HH2 sing N N 384 TRP OXT HXT sing N N 385 TYR N CA sing N N 386 TYR N H sing N N 387 TYR N H2 sing N N 388 TYR CA C sing N N 389 TYR CA CB sing N N 390 TYR CA HA sing N N 391 TYR C O doub N N 392 TYR C OXT sing N N 393 TYR CB CG sing N N 394 TYR CB HB2 sing N N 395 TYR CB HB3 sing N N 396 TYR CG CD1 doub Y N 397 TYR CG CD2 sing Y N 398 TYR CD1 CE1 sing Y N 399 TYR CD1 HD1 sing N N 400 TYR CD2 CE2 doub Y N 401 TYR CD2 HD2 sing N N 402 TYR CE1 CZ doub Y N 403 TYR CE1 HE1 sing N N 404 TYR CE2 CZ sing Y N 405 TYR CE2 HE2 sing N N 406 TYR CZ OH sing N N 407 TYR OH HH sing N N 408 TYR OXT HXT sing N N 409 VAL N CA sing N N 410 VAL N H sing N N 411 VAL N H2 sing N N 412 VAL CA C sing N N 413 VAL CA CB sing N N 414 VAL CA HA sing N N 415 VAL C O doub N N 416 VAL C OXT sing N N 417 VAL CB CG1 sing N N 418 VAL CB CG2 sing N N 419 VAL CB HB sing N N 420 VAL CG1 HG11 sing N N 421 VAL CG1 HG12 sing N N 422 VAL CG1 HG13 sing N N 423 VAL CG2 HG21 sing N N 424 VAL CG2 HG22 sing N N 425 VAL CG2 HG23 sing N N 426 VAL OXT HXT sing N N 427 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'Unpublished structure' # _atom_sites.entry_id 9HRC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.009352 _atom_sites.fract_transf_matrix[1][2] 0.005399 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010799 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014296 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 CL 17 17 11.4601 0.0104 7.1962 1.1662 6.2554 18.5194 1.6455 47.7784 -9.3452 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0486 ZN 30 30 14.0812 3.2655 7.0352 0.2333 5.1677 10.3163 2.4112 58.7097 1.0033 # loop_ #