data_9HSH # _entry.id 9HSH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.401 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9HSH pdb_00009hsh 10.2210/pdb9hsh/pdb WWPDB D_1292144101 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _database_PDB_caveat.id 1 _database_PDB_caveat.text ;CTP A 801 HAS WRONG CHIRALITY AT ATOM C4' ; # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9HSH _pdbx_database_status.recvd_initial_deposition_date 2024-12-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 9HSB _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 1 _pdbx_contact_author.email guichou@cbs.cnrs.fr _pdbx_contact_author.name_first Jean-Francois _pdbx_contact_author.name_last Guichou _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7699-3235 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Audebert, S.' 1 0000-0003-4914-4438 'Gelin, M.' 2 0000-0003-1320-8663 'Guichou, J.-F.' 3 0000-0002-7699-3235 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with Cytidine-triphosphate ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Audebert, S.' 1 0000-0003-4914-4438 primary 'Gelin, M.' 2 0000-0003-1320-8663 primary 'Guichou, J.-F.' 3 0000-0002-7699-3235 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'choline-phosphate cytidylyltransferase' 20646.949 1 2.7.7.15 ? ? 'Deletion of a lysine rich loop (720 - 737)' 2 non-polymer syn "CYTIDINE-5'-TRIPHOSPHATE" 483.156 1 ? ? ? ? 3 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 4 water nat water 18.015 83 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR TEGVSTTDLIVRILKNYED ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR TEGVSTTDLIVRILKNYED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "CYTIDINE-5'-TRIPHOSPHATE" CTP 3 'MANGANESE (II) ION' MN 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ALA n 1 5 VAL n 1 6 PRO n 1 7 ASP n 1 8 ASP n 1 9 ASP n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 ASP n 1 14 ASN n 1 15 SER n 1 16 ASN n 1 17 ASP n 1 18 GLU n 1 19 SER n 1 20 GLU n 1 21 TYR n 1 22 GLU n 1 23 SER n 1 24 SER n 1 25 GLN n 1 26 MET n 1 27 ASP n 1 28 SER n 1 29 GLU n 1 30 LYS n 1 31 ASN n 1 32 LYS n 1 33 GLY n 1 34 SER n 1 35 ILE n 1 36 LYS n 1 37 ASN n 1 38 SER n 1 39 LYS n 1 40 ASN n 1 41 VAL n 1 42 VAL n 1 43 ILE n 1 44 TYR n 1 45 ALA n 1 46 ASP n 1 47 GLY n 1 48 VAL n 1 49 TYR n 1 50 ASP n 1 51 MET n 1 52 LEU n 1 53 HIS n 1 54 LEU n 1 55 GLY n 1 56 HIS n 1 57 MET n 1 58 LYS n 1 59 GLN n 1 60 LEU n 1 61 GLU n 1 62 GLN n 1 63 ALA n 1 64 LYS n 1 65 LYS n 1 66 LEU n 1 67 PHE n 1 68 GLU n 1 69 ASN n 1 70 THR n 1 71 THR n 1 72 LEU n 1 73 ILE n 1 74 VAL n 1 75 GLY n 1 76 VAL n 1 77 THR n 1 78 SER n 1 79 ASP n 1 80 ASN n 1 81 GLU n 1 82 THR n 1 83 LYS n 1 84 LEU n 1 85 PHE n 1 86 LYS n 1 87 GLY n 1 88 GLN n 1 89 VAL n 1 90 VAL n 1 91 GLN n 1 92 THR n 1 93 LEU n 1 94 GLU n 1 95 GLU n 1 96 ARG n 1 97 THR n 1 98 GLU n 1 99 THR n 1 100 LEU n 1 101 LYS n 1 102 HIS n 1 103 ILE n 1 104 ARG n 1 105 TRP n 1 106 VAL n 1 107 ASP n 1 108 GLU n 1 109 ILE n 1 110 ILE n 1 111 SER n 1 112 PRO n 1 113 CYS n 1 114 PRO n 1 115 TRP n 1 116 VAL n 1 117 VAL n 1 118 THR n 1 119 PRO n 1 120 GLU n 1 121 PHE n 1 122 LEU n 1 123 GLU n 1 124 LYS n 1 125 TYR n 1 126 LYS n 1 127 ILE n 1 128 ASP n 1 129 TYR n 1 130 VAL n 1 131 ALA n 1 132 HIS n 1 133 ASP n 1 134 ASP n 1 135 ILE n 1 136 PRO n 1 137 TYR n 1 138 ALA n 1 139 ASN n 1 140 ASN n 1 141 GLN n 1 142 LYS n 1 143 GLU n 1 144 ASP n 1 145 ILE n 1 146 TYR n 1 147 ALA n 1 148 TRP n 1 149 LEU n 1 150 LYS n 1 151 ARG n 1 152 ALA n 1 153 GLY n 1 154 LYS n 1 155 PHE n 1 156 LYS n 1 157 ALA n 1 158 THR n 1 159 GLN n 1 160 ARG n 1 161 THR n 1 162 GLU n 1 163 GLY n 1 164 VAL n 1 165 SER n 1 166 THR n 1 167 THR n 1 168 ASP n 1 169 LEU n 1 170 ILE n 1 171 VAL n 1 172 ARG n 1 173 ILE n 1 174 LEU n 1 175 LYS n 1 176 ASN n 1 177 TYR n 1 178 GLU n 1 179 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 179 _entity_src_gen.gene_src_common_name 'malaria parasite P. falciparum' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PF3D7_1316600 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5833 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CTP non-polymer . "CYTIDINE-5'-TRIPHOSPHATE" ? 'C9 H16 N3 O14 P3' 483.156 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 578 ? ? ? A . n A 1 2 HIS 2 579 ? ? ? A . n A 1 3 MET 3 580 ? ? ? A . n A 1 4 ALA 4 581 ? ? ? A . n A 1 5 VAL 5 582 ? ? ? A . n A 1 6 PRO 6 583 ? ? ? A . n A 1 7 ASP 7 584 ? ? ? A . n A 1 8 ASP 8 585 ? ? ? A . n A 1 9 ASP 9 586 ? ? ? A . n A 1 10 ASP 10 587 ? ? ? A . n A 1 11 ASP 11 588 ? ? ? A . n A 1 12 ASP 12 589 ? ? ? A . n A 1 13 ASP 13 590 ? ? ? A . n A 1 14 ASN 14 591 ? ? ? A . n A 1 15 SER 15 592 ? ? ? A . n A 1 16 ASN 16 593 ? ? ? A . n A 1 17 ASP 17 594 ? ? ? A . n A 1 18 GLU 18 595 ? ? ? A . n A 1 19 SER 19 596 ? ? ? A . n A 1 20 GLU 20 597 ? ? ? A . n A 1 21 TYR 21 598 ? ? ? A . n A 1 22 GLU 22 599 ? ? ? A . n A 1 23 SER 23 600 ? ? ? A . n A 1 24 SER 24 601 ? ? ? A . n A 1 25 GLN 25 602 ? ? ? A . n A 1 26 MET 26 603 ? ? ? A . n A 1 27 ASP 27 604 ? ? ? A . n A 1 28 SER 28 605 ? ? ? A . n A 1 29 GLU 29 606 ? ? ? A . n A 1 30 LYS 30 607 ? ? ? A . n A 1 31 ASN 31 608 ? ? ? A . n A 1 32 LYS 32 609 ? ? ? A . n A 1 33 GLY 33 610 ? ? ? A . n A 1 34 SER 34 611 ? ? ? A . n A 1 35 ILE 35 612 ? ? ? A . n A 1 36 LYS 36 613 ? ? ? A . n A 1 37 ASN 37 614 ? ? ? A . n A 1 38 SER 38 615 ? ? ? A . n A 1 39 LYS 39 616 616 LYS LYS A . n A 1 40 ASN 40 617 617 ASN ASN A . n A 1 41 VAL 41 618 618 VAL VAL A . n A 1 42 VAL 42 619 619 VAL VAL A . n A 1 43 ILE 43 620 620 ILE ILE A . n A 1 44 TYR 44 621 621 TYR TYR A . n A 1 45 ALA 45 622 622 ALA ALA A . n A 1 46 ASP 46 623 623 ASP ASP A . n A 1 47 GLY 47 624 624 GLY GLY A . n A 1 48 VAL 48 625 625 VAL VAL A . n A 1 49 TYR 49 626 626 TYR TYR A . n A 1 50 ASP 50 627 627 ASP ASP A . n A 1 51 MET 51 628 628 MET MET A . n A 1 52 LEU 52 629 629 LEU LEU A . n A 1 53 HIS 53 630 630 HIS HIS A . n A 1 54 LEU 54 631 631 LEU LEU A . n A 1 55 GLY 55 632 632 GLY GLY A . n A 1 56 HIS 56 633 633 HIS HIS A . n A 1 57 MET 57 634 634 MET MET A . n A 1 58 LYS 58 635 635 LYS LYS A . n A 1 59 GLN 59 636 636 GLN GLN A . n A 1 60 LEU 60 637 637 LEU LEU A . n A 1 61 GLU 61 638 638 GLU GLU A . n A 1 62 GLN 62 639 639 GLN GLN A . n A 1 63 ALA 63 640 640 ALA ALA A . n A 1 64 LYS 64 641 641 LYS LYS A . n A 1 65 LYS 65 642 642 LYS LYS A . n A 1 66 LEU 66 643 643 LEU LEU A . n A 1 67 PHE 67 644 644 PHE PHE A . n A 1 68 GLU 68 645 645 GLU GLU A . n A 1 69 ASN 69 646 646 ASN ASN A . n A 1 70 THR 70 647 647 THR THR A . n A 1 71 THR 71 648 648 THR THR A . n A 1 72 LEU 72 649 649 LEU LEU A . n A 1 73 ILE 73 650 650 ILE ILE A . n A 1 74 VAL 74 651 651 VAL VAL A . n A 1 75 GLY 75 652 652 GLY GLY A . n A 1 76 VAL 76 653 653 VAL VAL A . n A 1 77 THR 77 654 654 THR THR A . n A 1 78 SER 78 655 655 SER SER A . n A 1 79 ASP 79 656 656 ASP ASP A . n A 1 80 ASN 80 657 657 ASN ASN A . n A 1 81 GLU 81 658 658 GLU GLU A . n A 1 82 THR 82 659 659 THR THR A . n A 1 83 LYS 83 660 660 LYS LYS A . n A 1 84 LEU 84 661 661 LEU LEU A . n A 1 85 PHE 85 662 662 PHE PHE A . n A 1 86 LYS 86 663 663 LYS LYS A . n A 1 87 GLY 87 664 664 GLY GLY A . n A 1 88 GLN 88 665 665 GLN GLN A . n A 1 89 VAL 89 666 666 VAL VAL A . n A 1 90 VAL 90 667 667 VAL VAL A . n A 1 91 GLN 91 668 668 GLN GLN A . n A 1 92 THR 92 669 669 THR THR A . n A 1 93 LEU 93 670 670 LEU LEU A . n A 1 94 GLU 94 671 671 GLU GLU A . n A 1 95 GLU 95 672 672 GLU GLU A . n A 1 96 ARG 96 673 673 ARG ARG A . n A 1 97 THR 97 674 674 THR THR A . n A 1 98 GLU 98 675 675 GLU GLU A . n A 1 99 THR 99 676 676 THR THR A . n A 1 100 LEU 100 677 677 LEU LEU A . n A 1 101 LYS 101 678 678 LYS LYS A . n A 1 102 HIS 102 679 679 HIS HIS A . n A 1 103 ILE 103 680 680 ILE ILE A . n A 1 104 ARG 104 681 681 ARG ARG A . n A 1 105 TRP 105 682 682 TRP TRP A . n A 1 106 VAL 106 683 683 VAL VAL A . n A 1 107 ASP 107 684 684 ASP ASP A . n A 1 108 GLU 108 685 685 GLU GLU A . n A 1 109 ILE 109 686 686 ILE ILE A . n A 1 110 ILE 110 687 687 ILE ILE A . n A 1 111 SER 111 688 688 SER SER A . n A 1 112 PRO 112 689 689 PRO PRO A . n A 1 113 CYS 113 690 690 CYS CYS A . n A 1 114 PRO 114 691 691 PRO PRO A . n A 1 115 TRP 115 692 692 TRP TRP A . n A 1 116 VAL 116 693 693 VAL VAL A . n A 1 117 VAL 117 694 694 VAL VAL A . n A 1 118 THR 118 695 695 THR THR A . n A 1 119 PRO 119 696 696 PRO PRO A . n A 1 120 GLU 120 697 697 GLU GLU A . n A 1 121 PHE 121 698 698 PHE PHE A . n A 1 122 LEU 122 699 699 LEU LEU A . n A 1 123 GLU 123 700 700 GLU GLU A . n A 1 124 LYS 124 701 701 LYS LYS A . n A 1 125 TYR 125 702 702 TYR TYR A . n A 1 126 LYS 126 703 703 LYS LYS A . n A 1 127 ILE 127 704 704 ILE ILE A . n A 1 128 ASP 128 705 705 ASP ASP A . n A 1 129 TYR 129 706 706 TYR TYR A . n A 1 130 VAL 130 707 707 VAL VAL A . n A 1 131 ALA 131 708 708 ALA ALA A . n A 1 132 HIS 132 709 709 HIS HIS A . n A 1 133 ASP 133 710 710 ASP ASP A . n A 1 134 ASP 134 711 711 ASP ASP A . n A 1 135 ILE 135 712 712 ILE ILE A . n A 1 136 PRO 136 731 ? ? ? A . n A 1 137 TYR 137 732 ? ? ? A . n A 1 138 ALA 138 733 ? ? ? A . n A 1 139 ASN 139 734 ? ? ? A . n A 1 140 ASN 140 735 ? ? ? A . n A 1 141 GLN 141 736 ? ? ? A . n A 1 142 LYS 142 737 ? ? ? A . n A 1 143 GLU 143 738 ? ? ? A . n A 1 144 ASP 144 739 739 ASP ASP A . n A 1 145 ILE 145 740 740 ILE ILE A . n A 1 146 TYR 146 741 741 TYR TYR A . n A 1 147 ALA 147 742 742 ALA ALA A . n A 1 148 TRP 148 743 743 TRP TRP A . n A 1 149 LEU 149 744 744 LEU LEU A . n A 1 150 LYS 150 745 745 LYS LYS A . n A 1 151 ARG 151 746 746 ARG ARG A . n A 1 152 ALA 152 747 747 ALA ALA A . n A 1 153 GLY 153 748 748 GLY GLY A . n A 1 154 LYS 154 749 749 LYS LYS A . n A 1 155 PHE 155 750 750 PHE PHE A . n A 1 156 LYS 156 751 751 LYS LYS A . n A 1 157 ALA 157 752 752 ALA ALA A . n A 1 158 THR 158 753 753 THR THR A . n A 1 159 GLN 159 754 754 GLN GLN A . n A 1 160 ARG 160 755 755 ARG ARG A . n A 1 161 THR 161 756 756 THR THR A . n A 1 162 GLU 162 757 757 GLU GLU A . n A 1 163 GLY 163 758 758 GLY GLY A . n A 1 164 VAL 164 759 759 VAL VAL A . n A 1 165 SER 165 760 760 SER SER A . n A 1 166 THR 166 761 761 THR THR A . n A 1 167 THR 167 762 762 THR THR A . n A 1 168 ASP 168 763 763 ASP ASP A . n A 1 169 LEU 169 764 764 LEU LEU A . n A 1 170 ILE 170 765 765 ILE ILE A . n A 1 171 VAL 171 766 766 VAL VAL A . n A 1 172 ARG 172 767 767 ARG ARG A . n A 1 173 ILE 173 768 768 ILE ILE A . n A 1 174 LEU 174 769 769 LEU LEU A . n A 1 175 LYS 175 770 770 LYS LYS A . n A 1 176 ASN 176 771 ? ? ? A . n A 1 177 TYR 177 772 ? ? ? A . n A 1 178 GLU 178 773 ? ? ? A . n A 1 179 ASP 179 774 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CTP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CTP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CTP 1 801 819 CTP LIG A . C 3 MN 1 802 1 MN MN A . D 4 HOH 1 901 50 HOH HOH A . D 4 HOH 2 902 23 HOH HOH A . D 4 HOH 3 903 55 HOH HOH A . D 4 HOH 4 904 20 HOH HOH A . D 4 HOH 5 905 15 HOH HOH A . D 4 HOH 6 906 3 HOH HOH A . D 4 HOH 7 907 90 HOH HOH A . D 4 HOH 8 908 48 HOH HOH A . D 4 HOH 9 909 65 HOH HOH A . D 4 HOH 10 910 94 HOH HOH A . D 4 HOH 11 911 2 HOH HOH A . D 4 HOH 12 912 69 HOH HOH A . D 4 HOH 13 913 25 HOH HOH A . D 4 HOH 14 914 1 HOH HOH A . D 4 HOH 15 915 52 HOH HOH A . D 4 HOH 16 916 38 HOH HOH A . D 4 HOH 17 917 42 HOH HOH A . D 4 HOH 18 918 29 HOH HOH A . D 4 HOH 19 919 9 HOH HOH A . D 4 HOH 20 920 61 HOH HOH A . D 4 HOH 21 921 64 HOH HOH A . D 4 HOH 22 922 5 HOH HOH A . D 4 HOH 23 923 80 HOH HOH A . D 4 HOH 24 924 54 HOH HOH A . D 4 HOH 25 925 76 HOH HOH A . D 4 HOH 26 926 43 HOH HOH A . D 4 HOH 27 927 36 HOH HOH A . D 4 HOH 28 928 45 HOH HOH A . D 4 HOH 29 929 31 HOH HOH A . D 4 HOH 30 930 13 HOH HOH A . D 4 HOH 31 931 17 HOH HOH A . D 4 HOH 32 932 40 HOH HOH A . D 4 HOH 33 933 6 HOH HOH A . D 4 HOH 34 934 8 HOH HOH A . D 4 HOH 35 935 63 HOH HOH A . D 4 HOH 36 936 51 HOH HOH A . D 4 HOH 37 937 39 HOH HOH A . D 4 HOH 38 938 53 HOH HOH A . D 4 HOH 39 939 33 HOH HOH A . D 4 HOH 40 940 24 HOH HOH A . D 4 HOH 41 941 10 HOH HOH A . D 4 HOH 42 942 49 HOH HOH A . D 4 HOH 43 943 28 HOH HOH A . D 4 HOH 44 944 26 HOH HOH A . D 4 HOH 45 945 72 HOH HOH A . D 4 HOH 46 946 32 HOH HOH A . D 4 HOH 47 947 47 HOH HOH A . D 4 HOH 48 948 11 HOH HOH A . D 4 HOH 49 949 41 HOH HOH A . D 4 HOH 50 950 77 HOH HOH A . D 4 HOH 51 951 93 HOH HOH A . D 4 HOH 52 952 19 HOH HOH A . D 4 HOH 53 953 95 HOH HOH A . D 4 HOH 54 954 16 HOH HOH A . D 4 HOH 55 955 21 HOH HOH A . D 4 HOH 56 956 4 HOH HOH A . D 4 HOH 57 957 12 HOH HOH A . D 4 HOH 58 958 58 HOH HOH A . D 4 HOH 59 959 18 HOH HOH A . D 4 HOH 60 960 86 HOH HOH A . D 4 HOH 61 961 56 HOH HOH A . D 4 HOH 62 962 37 HOH HOH A . D 4 HOH 63 963 73 HOH HOH A . D 4 HOH 64 964 78 HOH HOH A . D 4 HOH 65 965 81 HOH HOH A . D 4 HOH 66 966 30 HOH HOH A . D 4 HOH 67 967 75 HOH HOH A . D 4 HOH 68 968 22 HOH HOH A . D 4 HOH 69 969 27 HOH HOH A . D 4 HOH 70 970 57 HOH HOH A . D 4 HOH 71 971 87 HOH HOH A . D 4 HOH 72 972 46 HOH HOH A . D 4 HOH 73 973 34 HOH HOH A . D 4 HOH 74 974 70 HOH HOH A . D 4 HOH 75 975 68 HOH HOH A . D 4 HOH 76 976 92 HOH HOH A . D 4 HOH 77 977 62 HOH HOH A . D 4 HOH 78 978 83 HOH HOH A . D 4 HOH 79 979 59 HOH HOH A . D 4 HOH 80 980 84 HOH HOH A . D 4 HOH 81 981 14 HOH HOH A . D 4 HOH 82 982 85 HOH HOH A . D 4 HOH 83 983 88 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 660 ? CG ? A LYS 83 CG 2 1 Y 1 A LYS 660 ? CD ? A LYS 83 CD 3 1 Y 1 A LYS 660 ? CE ? A LYS 83 CE 4 1 Y 1 A LYS 660 ? NZ ? A LYS 83 NZ 5 1 Y 1 A GLN 665 ? CG ? A GLN 88 CG 6 1 Y 1 A GLN 665 ? CD ? A GLN 88 CD 7 1 Y 1 A GLN 665 ? OE1 ? A GLN 88 OE1 8 1 Y 1 A GLN 665 ? NE2 ? A GLN 88 NE2 9 1 Y 1 A LEU 764 ? CG ? A LEU 169 CG 10 1 Y 1 A LEU 764 ? CD1 ? A LEU 169 CD1 11 1 Y 1 A LEU 764 ? CD2 ? A LEU 169 CD2 # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name PHENIX _software.os ? _software.os_version ? _software.type ? _software.version 1.19.2_4158 _software.pdbx_ordinal 1 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9HSH _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.494 _cell.length_a_esd ? _cell.length_b 69.321 _cell.length_b_esd ? _cell.length_c 117.043 _cell.length_c_esd ? _cell.volume 409683.575 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9HSH _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall 'I 2 2' _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9HSH _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3350 11.5%, NaF 210 mM, Glycerol 5.8%, MnCl2 15mM, 1,3 propandiol 3%' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-12-02 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9655 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9655 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 38.65 _reflns.entry_id 9HSH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 59.64 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 29350 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.967 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 940 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.285 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 51.62 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9HSH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 59.64 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 29350 _refine.ls_number_reflns_R_free 1418 _refine.ls_number_reflns_R_work 27932 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 79.73 _refine.ls_percent_reflns_R_free 4.83 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2318 _refine.ls_R_factor_R_free 0.2570 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2305 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.6948 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3172 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 59.64 _refine_hist.number_atoms_solvent 83 _refine_hist.number_atoms_total 1157 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1044 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0086 ? 1124 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8734 ? 1535 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0539 ? 177 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0063 ? 179 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 25.8800 ? 465 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.80 1.86 . . 14 273 7.75 . . . . 0.4685 . . . . . . . . . . . 0.4430 'X-RAY DIFFRACTION' 1.86 1.94 . . 121 2203 63.57 . . . . 0.4213 . . . . . . . . . . . 0.4599 'X-RAY DIFFRACTION' 1.94 2.03 . . 129 3046 86.21 . . . . 0.3913 . . . . . . . . . . . 0.3833 'X-RAY DIFFRACTION' 2.03 2.13 . . 170 3156 90.36 . . . . 0.3323 . . . . . . . . . . . 0.3459 'X-RAY DIFFRACTION' 2.13 2.27 . . 154 3329 94.47 . . . . 0.2935 . . . . . . . . . . . 0.3152 'X-RAY DIFFRACTION' 2.27 2.44 . . 170 3270 93.94 . . . . 0.2829 . . . . . . . . . . . 0.2973 'X-RAY DIFFRACTION' 2.44 2.69 . . 166 3249 92.57 . . . . 0.2543 . . . . . . . . . . . 0.3211 'X-RAY DIFFRACTION' 2.69 3.08 . . 183 3105 89.54 . . . . 0.2562 . . . . . . . . . . . 0.3075 'X-RAY DIFFRACTION' 3.08 3.88 . . 140 3176 90.04 . . . . 0.2059 . . . . . . . . . . . 0.2410 'X-RAY DIFFRACTION' 3.88 59.64 . . 171 3125 89.37 . . . . 0.1757 . . . . . . . . . . . 0.1906 # _struct.entry_id 9HSH _struct.title ;Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with Cytidine-triphosphate ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9HSH _struct_keywords.text 'Transferase, CCT' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8IEE9_PLAF7 _struct_ref.pdbx_db_accession Q8IEE9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETK LFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKKKKKKKSKGKSFSFDEENEDI YAWLKRAGKFKATQRTEGVSTTDLIVRILKNYED ; _struct_ref.pdbx_align_begin 581 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9HSH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 179 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IEE9 _struct_ref_seq.db_align_beg 581 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 774 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 581 _struct_ref_seq.pdbx_auth_seq_align_end 774 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9HSH GLY A 1 ? UNP Q8IEE9 ? ? 'expression tag' 578 1 1 9HSH HIS A 2 ? UNP Q8IEE9 ? ? 'expression tag' 579 2 1 9HSH MET A 3 ? UNP Q8IEE9 ? ? 'expression tag' 580 3 1 9HSH ? A ? ? UNP Q8IEE9 LYS 720 deletion ? 4 1 9HSH ? A ? ? UNP Q8IEE9 LYS 721 deletion ? 5 1 9HSH ? A ? ? UNP Q8IEE9 LYS 722 deletion ? 6 1 9HSH ? A ? ? UNP Q8IEE9 LYS 723 deletion ? 7 1 9HSH ? A ? ? UNP Q8IEE9 LYS 724 deletion ? 8 1 9HSH ? A ? ? UNP Q8IEE9 LYS 725 deletion ? 9 1 9HSH ? A ? ? UNP Q8IEE9 SER 726 deletion ? 10 1 9HSH ? A ? ? UNP Q8IEE9 LYS 727 deletion ? 11 1 9HSH ? A ? ? UNP Q8IEE9 GLY 728 deletion ? 12 1 9HSH ? A ? ? UNP Q8IEE9 LYS 729 deletion ? 13 1 9HSH ? A ? ? UNP Q8IEE9 SER 730 deletion ? 14 1 9HSH ? A ? ? UNP Q8IEE9 PHE 731 deletion ? 15 1 9HSH ? A ? ? UNP Q8IEE9 SER 732 deletion ? 16 1 9HSH ? A ? ? UNP Q8IEE9 PHE 733 deletion ? 17 1 9HSH ? A ? ? UNP Q8IEE9 ASP 734 deletion ? 18 1 9HSH ? A ? ? UNP Q8IEE9 GLU 735 deletion ? 19 1 9HSH ? A ? ? UNP Q8IEE9 GLU 736 deletion ? 20 1 9HSH ? A ? ? UNP Q8IEE9 ASN 737 deletion ? 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3960 ? 1 MORE -26 ? 1 'SSA (A^2)' 13220 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details Dimeric # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_455 -x-1,-y,z -1.0000000000 0.0000000000 0.0000000000 -50.4940000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 53 ? LEU A 66 ? HIS A 630 LEU A 643 1 ? 14 HELX_P HELX_P2 AA2 SER A 78 ? LYS A 86 ? SER A 655 LYS A 663 1 ? 9 HELX_P HELX_P3 AA3 THR A 92 ? LYS A 101 ? THR A 669 LYS A 678 1 ? 10 HELX_P HELX_P4 AA4 THR A 118 ? TYR A 125 ? THR A 695 TYR A 702 1 ? 8 HELX_P HELX_P5 AA5 TYR A 146 ? ALA A 152 ? TYR A 741 ALA A 747 1 ? 7 HELX_P HELX_P6 AA6 SER A 165 ? LEU A 174 ? SER A 760 LEU A 769 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B CTP . O1A A ? ? 1_555 C MN . MN ? ? A CTP 801 A MN 802 1_555 ? ? ? ? ? ? ? 2.504 ? ? metalc2 metalc ? ? B CTP . O1G B ? ? 1_555 C MN . MN ? ? A CTP 801 A MN 802 1_555 ? ? ? ? ? ? ? 2.532 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id O1A _pdbx_struct_conn_angle.ptnr1_label_alt_id A _pdbx_struct_conn_angle.ptnr1_label_asym_id B _pdbx_struct_conn_angle.ptnr1_label_comp_id CTP _pdbx_struct_conn_angle.ptnr1_label_seq_id . _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id CTP _pdbx_struct_conn_angle.ptnr1_auth_seq_id 801 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id MN _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id C _pdbx_struct_conn_angle.ptnr2_label_comp_id MN _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id MN _pdbx_struct_conn_angle.ptnr2_auth_seq_id 802 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O1G _pdbx_struct_conn_angle.ptnr3_label_alt_id B _pdbx_struct_conn_angle.ptnr3_label_asym_id B _pdbx_struct_conn_angle.ptnr3_label_comp_id CTP _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id CTP _pdbx_struct_conn_angle.ptnr3_auth_seq_id 801 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 100.6 _pdbx_struct_conn_angle.value_esd ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 111 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 688 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 112 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 689 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.07 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 108 ? CYS A 113 ? GLU A 685 CYS A 690 AA1 2 THR A 70 ? THR A 77 ? THR A 647 THR A 654 AA1 3 VAL A 41 ? GLY A 47 ? VAL A 618 GLY A 624 AA1 4 TYR A 129 ? ASP A 133 ? TYR A 706 ASP A 710 AA1 5 PHE A 155 ? THR A 158 ? PHE A 750 THR A 753 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 110 ? O ILE A 687 N VAL A 74 ? N VAL A 651 AA1 2 3 O ILE A 73 ? O ILE A 650 N ILE A 43 ? N ILE A 620 AA1 3 4 N TYR A 44 ? N TYR A 621 O ALA A 131 ? O ALA A 708 AA1 4 5 N VAL A 130 ? N VAL A 707 O LYS A 156 ? O LYS A 751 # _pdbx_entry_details.entry_id 9HSH _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 657 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 901 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.17 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 663 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -122.14 _pdbx_validate_torsion.psi -62.95 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 "C4'" A A CTP 801 ? 'WRONG HAND' . 2 1 "C4'" B A CTP 801 ? 'WRONG HAND' . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x+1/2,y+1/2,z+1/2 6 x+1/2,-y+1/2,-z+1/2 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 983 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.91 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 578 ? A GLY 1 2 1 Y 1 A HIS 579 ? A HIS 2 3 1 Y 1 A MET 580 ? A MET 3 4 1 Y 1 A ALA 581 ? A ALA 4 5 1 Y 1 A VAL 582 ? A VAL 5 6 1 Y 1 A PRO 583 ? A PRO 6 7 1 Y 1 A ASP 584 ? A ASP 7 8 1 Y 1 A ASP 585 ? A ASP 8 9 1 Y 1 A ASP 586 ? A ASP 9 10 1 Y 1 A ASP 587 ? A ASP 10 11 1 Y 1 A ASP 588 ? A ASP 11 12 1 Y 1 A ASP 589 ? A ASP 12 13 1 Y 1 A ASP 590 ? A ASP 13 14 1 Y 1 A ASN 591 ? A ASN 14 15 1 Y 1 A SER 592 ? A SER 15 16 1 Y 1 A ASN 593 ? A ASN 16 17 1 Y 1 A ASP 594 ? A ASP 17 18 1 Y 1 A GLU 595 ? A GLU 18 19 1 Y 1 A SER 596 ? A SER 19 20 1 Y 1 A GLU 597 ? A GLU 20 21 1 Y 1 A TYR 598 ? A TYR 21 22 1 Y 1 A GLU 599 ? A GLU 22 23 1 Y 1 A SER 600 ? A SER 23 24 1 Y 1 A SER 601 ? A SER 24 25 1 Y 1 A GLN 602 ? A GLN 25 26 1 Y 1 A MET 603 ? A MET 26 27 1 Y 1 A ASP 604 ? A ASP 27 28 1 Y 1 A SER 605 ? A SER 28 29 1 Y 1 A GLU 606 ? A GLU 29 30 1 Y 1 A LYS 607 ? A LYS 30 31 1 Y 1 A ASN 608 ? A ASN 31 32 1 Y 1 A LYS 609 ? A LYS 32 33 1 Y 1 A GLY 610 ? A GLY 33 34 1 Y 1 A SER 611 ? A SER 34 35 1 Y 1 A ILE 612 ? A ILE 35 36 1 Y 1 A LYS 613 ? A LYS 36 37 1 Y 1 A ASN 614 ? A ASN 37 38 1 Y 1 A SER 615 ? A SER 38 39 1 Y 1 A PRO 731 ? A PRO 136 40 1 Y 1 A TYR 732 ? A TYR 137 41 1 Y 1 A ALA 733 ? A ALA 138 42 1 Y 1 A ASN 734 ? A ASN 139 43 1 Y 1 A ASN 735 ? A ASN 140 44 1 Y 1 A GLN 736 ? A GLN 141 45 1 Y 1 A LYS 737 ? A LYS 142 46 1 Y 1 A GLU 738 ? A GLU 143 47 1 Y 1 A ASN 771 ? A ASN 176 48 1 Y 1 A TYR 772 ? A TYR 177 49 1 Y 1 A GLU 773 ? A GLU 178 50 1 Y 1 A ASP 774 ? A ASP 179 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CTP N1 N N N 74 CTP C2 C N N 75 CTP N3 N N N 76 CTP C4 C N N 77 CTP C5 C N N 78 CTP C6 C N N 79 CTP O2 O N N 80 CTP N4 N N N 81 CTP "C1'" C N R 82 CTP "C2'" C N R 83 CTP "O2'" O N N 84 CTP "C3'" C N S 85 CTP "C4'" C N R 86 CTP "O4'" O N N 87 CTP "O3'" O N N 88 CTP "C5'" C N N 89 CTP "O5'" O N N 90 CTP PA P N S 91 CTP O1A O N N 92 CTP O2A O N N 93 CTP O3A O N N 94 CTP PB P N R 95 CTP O1B O N N 96 CTP O2B O N N 97 CTP O3B O N N 98 CTP PG P N N 99 CTP O1G O N N 100 CTP O2G O N N 101 CTP O3G O N N 102 CTP H5 H N N 103 CTP H6 H N N 104 CTP HN41 H N N 105 CTP HN42 H N N 106 CTP "H1'" H N N 107 CTP "H2'" H N N 108 CTP "HO2'" H N N 109 CTP "H3'" H N N 110 CTP "H4'" H N N 111 CTP "HO3'" H N N 112 CTP "H5'1" H N N 113 CTP "H5'2" H N N 114 CTP HOA2 H N N 115 CTP HOB2 H N N 116 CTP HOG2 H N N 117 CTP HOG3 H N N 118 CYS N N N N 119 CYS CA C N R 120 CYS C C N N 121 CYS O O N N 122 CYS CB C N N 123 CYS SG S N N 124 CYS OXT O N N 125 CYS H H N N 126 CYS H2 H N N 127 CYS HA H N N 128 CYS HB2 H N N 129 CYS HB3 H N N 130 CYS HG H N N 131 CYS HXT H N N 132 GLN N N N N 133 GLN CA C N S 134 GLN C C N N 135 GLN O O N N 136 GLN CB C N N 137 GLN CG C N N 138 GLN CD C N N 139 GLN OE1 O N N 140 GLN NE2 N N N 141 GLN OXT O N N 142 GLN H H N N 143 GLN H2 H N N 144 GLN HA H N N 145 GLN HB2 H N N 146 GLN HB3 H N N 147 GLN HG2 H N N 148 GLN HG3 H N N 149 GLN HE21 H N N 150 GLN HE22 H N N 151 GLN HXT H N N 152 GLU N N N N 153 GLU CA C N S 154 GLU C C N N 155 GLU O O N N 156 GLU CB C N N 157 GLU CG C N N 158 GLU CD C N N 159 GLU OE1 O N N 160 GLU OE2 O N N 161 GLU OXT O N N 162 GLU H H N N 163 GLU H2 H N N 164 GLU HA H N N 165 GLU HB2 H N N 166 GLU HB3 H N N 167 GLU HG2 H N N 168 GLU HG3 H N N 169 GLU HE2 H N N 170 GLU HXT H N N 171 GLY N N N N 172 GLY CA C N N 173 GLY C C N N 174 GLY O O N N 175 GLY OXT O N N 176 GLY H H N N 177 GLY H2 H N N 178 GLY HA2 H N N 179 GLY HA3 H N N 180 GLY HXT H N N 181 HIS N N N N 182 HIS CA C N S 183 HIS C C N N 184 HIS O O N N 185 HIS CB C N N 186 HIS CG C Y N 187 HIS ND1 N Y N 188 HIS CD2 C Y N 189 HIS CE1 C Y N 190 HIS NE2 N Y N 191 HIS OXT O N N 192 HIS H H N N 193 HIS H2 H N N 194 HIS HA H N N 195 HIS HB2 H N N 196 HIS HB3 H N N 197 HIS HD1 H N N 198 HIS HD2 H N N 199 HIS HE1 H N N 200 HIS HE2 H N N 201 HIS HXT H N N 202 HOH O O N N 203 HOH H1 H N N 204 HOH H2 H N N 205 ILE N N N N 206 ILE CA C N S 207 ILE C C N N 208 ILE O O N N 209 ILE CB C N S 210 ILE CG1 C N N 211 ILE CG2 C N N 212 ILE CD1 C N N 213 ILE OXT O N N 214 ILE H H N N 215 ILE H2 H N N 216 ILE HA H N N 217 ILE HB H N N 218 ILE HG12 H N N 219 ILE HG13 H N N 220 ILE HG21 H N N 221 ILE HG22 H N N 222 ILE HG23 H N N 223 ILE HD11 H N N 224 ILE HD12 H N N 225 ILE HD13 H N N 226 ILE HXT H N N 227 LEU N N N N 228 LEU CA C N S 229 LEU C C N N 230 LEU O O N N 231 LEU CB C N N 232 LEU CG C N N 233 LEU CD1 C N N 234 LEU CD2 C N N 235 LEU OXT O N N 236 LEU H H N N 237 LEU H2 H N N 238 LEU HA H N N 239 LEU HB2 H N N 240 LEU HB3 H N N 241 LEU HG H N N 242 LEU HD11 H N N 243 LEU HD12 H N N 244 LEU HD13 H N N 245 LEU HD21 H N N 246 LEU HD22 H N N 247 LEU HD23 H N N 248 LEU HXT H N N 249 LYS N N N N 250 LYS CA C N S 251 LYS C C N N 252 LYS O O N N 253 LYS CB C N N 254 LYS CG C N N 255 LYS CD C N N 256 LYS CE C N N 257 LYS NZ N N N 258 LYS OXT O N N 259 LYS H H N N 260 LYS H2 H N N 261 LYS HA H N N 262 LYS HB2 H N N 263 LYS HB3 H N N 264 LYS HG2 H N N 265 LYS HG3 H N N 266 LYS HD2 H N N 267 LYS HD3 H N N 268 LYS HE2 H N N 269 LYS HE3 H N N 270 LYS HZ1 H N N 271 LYS HZ2 H N N 272 LYS HZ3 H N N 273 LYS HXT H N N 274 MET N N N N 275 MET CA C N S 276 MET C C N N 277 MET O O N N 278 MET CB C N N 279 MET CG C N N 280 MET SD S N N 281 MET CE C N N 282 MET OXT O N N 283 MET H H N N 284 MET H2 H N N 285 MET HA H N N 286 MET HB2 H N N 287 MET HB3 H N N 288 MET HG2 H N N 289 MET HG3 H N N 290 MET HE1 H N N 291 MET HE2 H N N 292 MET HE3 H N N 293 MET HXT H N N 294 MN MN MN N N 295 PHE N N N N 296 PHE CA C N S 297 PHE C C N N 298 PHE O O N N 299 PHE CB C N N 300 PHE CG C Y N 301 PHE CD1 C Y N 302 PHE CD2 C Y N 303 PHE CE1 C Y N 304 PHE CE2 C Y N 305 PHE CZ C Y N 306 PHE OXT O N N 307 PHE H H N N 308 PHE H2 H N N 309 PHE HA H N N 310 PHE HB2 H N N 311 PHE HB3 H N N 312 PHE HD1 H N N 313 PHE HD2 H N N 314 PHE HE1 H N N 315 PHE HE2 H N N 316 PHE HZ H N N 317 PHE HXT H N N 318 PRO N N N N 319 PRO CA C N S 320 PRO C C N N 321 PRO O O N N 322 PRO CB C N N 323 PRO CG C N N 324 PRO CD C N N 325 PRO OXT O N N 326 PRO H H N N 327 PRO HA H N N 328 PRO HB2 H N N 329 PRO HB3 H N N 330 PRO HG2 H N N 331 PRO HG3 H N N 332 PRO HD2 H N N 333 PRO HD3 H N N 334 PRO HXT H N N 335 SER N N N N 336 SER CA C N S 337 SER C C N N 338 SER O O N N 339 SER CB C N N 340 SER OG O N N 341 SER OXT O N N 342 SER H H N N 343 SER H2 H N N 344 SER HA H N N 345 SER HB2 H N N 346 SER HB3 H N N 347 SER HG H N N 348 SER HXT H N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CTP N1 C2 sing N N 70 CTP N1 C6 sing N N 71 CTP N1 "C1'" sing N N 72 CTP C2 N3 sing N N 73 CTP C2 O2 doub N N 74 CTP N3 C4 doub N N 75 CTP C4 C5 sing N N 76 CTP C4 N4 sing N N 77 CTP C5 C6 doub N N 78 CTP C5 H5 sing N N 79 CTP C6 H6 sing N N 80 CTP N4 HN41 sing N N 81 CTP N4 HN42 sing N N 82 CTP "C1'" "C2'" sing N N 83 CTP "C1'" "O4'" sing N N 84 CTP "C1'" "H1'" sing N N 85 CTP "C2'" "O2'" sing N N 86 CTP "C2'" "C3'" sing N N 87 CTP "C2'" "H2'" sing N N 88 CTP "O2'" "HO2'" sing N N 89 CTP "C3'" "C4'" sing N N 90 CTP "C3'" "O3'" sing N N 91 CTP "C3'" "H3'" sing N N 92 CTP "C4'" "O4'" sing N N 93 CTP "C4'" "C5'" sing N N 94 CTP "C4'" "H4'" sing N N 95 CTP "O3'" "HO3'" sing N N 96 CTP "C5'" "O5'" sing N N 97 CTP "C5'" "H5'1" sing N N 98 CTP "C5'" "H5'2" sing N N 99 CTP "O5'" PA sing N N 100 CTP PA O1A doub N N 101 CTP PA O2A sing N N 102 CTP PA O3A sing N N 103 CTP O2A HOA2 sing N N 104 CTP O3A PB sing N N 105 CTP PB O1B doub N N 106 CTP PB O2B sing N N 107 CTP PB O3B sing N N 108 CTP O2B HOB2 sing N N 109 CTP O3B PG sing N N 110 CTP PG O1G doub N N 111 CTP PG O2G sing N N 112 CTP PG O3G sing N N 113 CTP O2G HOG2 sing N N 114 CTP O3G HOG3 sing N N 115 CYS N CA sing N N 116 CYS N H sing N N 117 CYS N H2 sing N N 118 CYS CA C sing N N 119 CYS CA CB sing N N 120 CYS CA HA sing N N 121 CYS C O doub N N 122 CYS C OXT sing N N 123 CYS CB SG sing N N 124 CYS CB HB2 sing N N 125 CYS CB HB3 sing N N 126 CYS SG HG sing N N 127 CYS OXT HXT sing N N 128 GLN N CA sing N N 129 GLN N H sing N N 130 GLN N H2 sing N N 131 GLN CA C sing N N 132 GLN CA CB sing N N 133 GLN CA HA sing N N 134 GLN C O doub N N 135 GLN C OXT sing N N 136 GLN CB CG sing N N 137 GLN CB HB2 sing N N 138 GLN CB HB3 sing N N 139 GLN CG CD sing N N 140 GLN CG HG2 sing N N 141 GLN CG HG3 sing N N 142 GLN CD OE1 doub N N 143 GLN CD NE2 sing N N 144 GLN NE2 HE21 sing N N 145 GLN NE2 HE22 sing N N 146 GLN OXT HXT sing N N 147 GLU N CA sing N N 148 GLU N H sing N N 149 GLU N H2 sing N N 150 GLU CA C sing N N 151 GLU CA CB sing N N 152 GLU CA HA sing N N 153 GLU C O doub N N 154 GLU C OXT sing N N 155 GLU CB CG sing N N 156 GLU CB HB2 sing N N 157 GLU CB HB3 sing N N 158 GLU CG CD sing N N 159 GLU CG HG2 sing N N 160 GLU CG HG3 sing N N 161 GLU CD OE1 doub N N 162 GLU CD OE2 sing N N 163 GLU OE2 HE2 sing N N 164 GLU OXT HXT sing N N 165 GLY N CA sing N N 166 GLY N H sing N N 167 GLY N H2 sing N N 168 GLY CA C sing N N 169 GLY CA HA2 sing N N 170 GLY CA HA3 sing N N 171 GLY C O doub N N 172 GLY C OXT sing N N 173 GLY OXT HXT sing N N 174 HIS N CA sing N N 175 HIS N H sing N N 176 HIS N H2 sing N N 177 HIS CA C sing N N 178 HIS CA CB sing N N 179 HIS CA HA sing N N 180 HIS C O doub N N 181 HIS C OXT sing N N 182 HIS CB CG sing N N 183 HIS CB HB2 sing N N 184 HIS CB HB3 sing N N 185 HIS CG ND1 sing Y N 186 HIS CG CD2 doub Y N 187 HIS ND1 CE1 doub Y N 188 HIS ND1 HD1 sing N N 189 HIS CD2 NE2 sing Y N 190 HIS CD2 HD2 sing N N 191 HIS CE1 NE2 sing Y N 192 HIS CE1 HE1 sing N N 193 HIS NE2 HE2 sing N N 194 HIS OXT HXT sing N N 195 HOH O H1 sing N N 196 HOH O H2 sing N N 197 ILE N CA sing N N 198 ILE N H sing N N 199 ILE N H2 sing N N 200 ILE CA C sing N N 201 ILE CA CB sing N N 202 ILE CA HA sing N N 203 ILE C O doub N N 204 ILE C OXT sing N N 205 ILE CB CG1 sing N N 206 ILE CB CG2 sing N N 207 ILE CB HB sing N N 208 ILE CG1 CD1 sing N N 209 ILE CG1 HG12 sing N N 210 ILE CG1 HG13 sing N N 211 ILE CG2 HG21 sing N N 212 ILE CG2 HG22 sing N N 213 ILE CG2 HG23 sing N N 214 ILE CD1 HD11 sing N N 215 ILE CD1 HD12 sing N N 216 ILE CD1 HD13 sing N N 217 ILE OXT HXT sing N N 218 LEU N CA sing N N 219 LEU N H sing N N 220 LEU N H2 sing N N 221 LEU CA C sing N N 222 LEU CA CB sing N N 223 LEU CA HA sing N N 224 LEU C O doub N N 225 LEU C OXT sing N N 226 LEU CB CG sing N N 227 LEU CB HB2 sing N N 228 LEU CB HB3 sing N N 229 LEU CG CD1 sing N N 230 LEU CG CD2 sing N N 231 LEU CG HG sing N N 232 LEU CD1 HD11 sing N N 233 LEU CD1 HD12 sing N N 234 LEU CD1 HD13 sing N N 235 LEU CD2 HD21 sing N N 236 LEU CD2 HD22 sing N N 237 LEU CD2 HD23 sing N N 238 LEU OXT HXT sing N N 239 LYS N CA sing N N 240 LYS N H sing N N 241 LYS N H2 sing N N 242 LYS CA C sing N N 243 LYS CA CB sing N N 244 LYS CA HA sing N N 245 LYS C O doub N N 246 LYS C OXT sing N N 247 LYS CB CG sing N N 248 LYS CB HB2 sing N N 249 LYS CB HB3 sing N N 250 LYS CG CD sing N N 251 LYS CG HG2 sing N N 252 LYS CG HG3 sing N N 253 LYS CD CE sing N N 254 LYS CD HD2 sing N N 255 LYS CD HD3 sing N N 256 LYS CE NZ sing N N 257 LYS CE HE2 sing N N 258 LYS CE HE3 sing N N 259 LYS NZ HZ1 sing N N 260 LYS NZ HZ2 sing N N 261 LYS NZ HZ3 sing N N 262 LYS OXT HXT sing N N 263 MET N CA sing N N 264 MET N H sing N N 265 MET N H2 sing N N 266 MET CA C sing N N 267 MET CA CB sing N N 268 MET CA HA sing N N 269 MET C O doub N N 270 MET C OXT sing N N 271 MET CB CG sing N N 272 MET CB HB2 sing N N 273 MET CB HB3 sing N N 274 MET CG SD sing N N 275 MET CG HG2 sing N N 276 MET CG HG3 sing N N 277 MET SD CE sing N N 278 MET CE HE1 sing N N 279 MET CE HE2 sing N N 280 MET CE HE3 sing N N 281 MET OXT HXT sing N N 282 PHE N CA sing N N 283 PHE N H sing N N 284 PHE N H2 sing N N 285 PHE CA C sing N N 286 PHE CA CB sing N N 287 PHE CA HA sing N N 288 PHE C O doub N N 289 PHE C OXT sing N N 290 PHE CB CG sing N N 291 PHE CB HB2 sing N N 292 PHE CB HB3 sing N N 293 PHE CG CD1 doub Y N 294 PHE CG CD2 sing Y N 295 PHE CD1 CE1 sing Y N 296 PHE CD1 HD1 sing N N 297 PHE CD2 CE2 doub Y N 298 PHE CD2 HD2 sing N N 299 PHE CE1 CZ doub Y N 300 PHE CE1 HE1 sing N N 301 PHE CE2 CZ sing Y N 302 PHE CE2 HE2 sing N N 303 PHE CZ HZ sing N N 304 PHE OXT HXT sing N N 305 PRO N CA sing N N 306 PRO N CD sing N N 307 PRO N H sing N N 308 PRO CA C sing N N 309 PRO CA CB sing N N 310 PRO CA HA sing N N 311 PRO C O doub N N 312 PRO C OXT sing N N 313 PRO CB CG sing N N 314 PRO CB HB2 sing N N 315 PRO CB HB3 sing N N 316 PRO CG CD sing N N 317 PRO CG HG2 sing N N 318 PRO CG HG3 sing N N 319 PRO CD HD2 sing N N 320 PRO CD HD3 sing N N 321 PRO OXT HXT sing N N 322 SER N CA sing N N 323 SER N H sing N N 324 SER N H2 sing N N 325 SER CA C sing N N 326 SER CA CB sing N N 327 SER CA HA sing N N 328 SER C O doub N N 329 SER C OXT sing N N 330 SER CB OG sing N N 331 SER CB HB2 sing N N 332 SER CB HB3 sing N N 333 SER OG HG sing N N 334 SER OXT HXT sing N N 335 THR N CA sing N N 336 THR N H sing N N 337 THR N H2 sing N N 338 THR CA C sing N N 339 THR CA CB sing N N 340 THR CA HA sing N N 341 THR C O doub N N 342 THR C OXT sing N N 343 THR CB OG1 sing N N 344 THR CB CG2 sing N N 345 THR CB HB sing N N 346 THR OG1 HG1 sing N N 347 THR CG2 HG21 sing N N 348 THR CG2 HG22 sing N N 349 THR CG2 HG23 sing N N 350 THR OXT HXT sing N N 351 TRP N CA sing N N 352 TRP N H sing N N 353 TRP N H2 sing N N 354 TRP CA C sing N N 355 TRP CA CB sing N N 356 TRP CA HA sing N N 357 TRP C O doub N N 358 TRP C OXT sing N N 359 TRP CB CG sing N N 360 TRP CB HB2 sing N N 361 TRP CB HB3 sing N N 362 TRP CG CD1 doub Y N 363 TRP CG CD2 sing Y N 364 TRP CD1 NE1 sing Y N 365 TRP CD1 HD1 sing N N 366 TRP CD2 CE2 doub Y N 367 TRP CD2 CE3 sing Y N 368 TRP NE1 CE2 sing Y N 369 TRP NE1 HE1 sing N N 370 TRP CE2 CZ2 sing Y N 371 TRP CE3 CZ3 doub Y N 372 TRP CE3 HE3 sing N N 373 TRP CZ2 CH2 doub Y N 374 TRP CZ2 HZ2 sing N N 375 TRP CZ3 CH2 sing Y N 376 TRP CZ3 HZ3 sing N N 377 TRP CH2 HH2 sing N N 378 TRP OXT HXT sing N N 379 TYR N CA sing N N 380 TYR N H sing N N 381 TYR N H2 sing N N 382 TYR CA C sing N N 383 TYR CA CB sing N N 384 TYR CA HA sing N N 385 TYR C O doub N N 386 TYR C OXT sing N N 387 TYR CB CG sing N N 388 TYR CB HB2 sing N N 389 TYR CB HB3 sing N N 390 TYR CG CD1 doub Y N 391 TYR CG CD2 sing Y N 392 TYR CD1 CE1 sing Y N 393 TYR CD1 HD1 sing N N 394 TYR CD2 CE2 doub Y N 395 TYR CD2 HD2 sing N N 396 TYR CE1 CZ doub Y N 397 TYR CE1 HE1 sing N N 398 TYR CE2 CZ sing Y N 399 TYR CE2 HE2 sing N N 400 TYR CZ OH sing N N 401 TYR OH HH sing N N 402 TYR OXT HXT sing N N 403 VAL N CA sing N N 404 VAL N H sing N N 405 VAL N H2 sing N N 406 VAL CA C sing N N 407 VAL CA CB sing N N 408 VAL CA HA sing N N 409 VAL C O doub N N 410 VAL C OXT sing N N 411 VAL CB CG1 sing N N 412 VAL CB CG2 sing N N 413 VAL CB HB sing N N 414 VAL CG1 HG11 sing N N 415 VAL CG1 HG12 sing N N 416 VAL CG1 HG13 sing N N 417 VAL CG2 HG21 sing N N 418 VAL CG2 HG22 sing N N 419 VAL CG2 HG23 sing N N 420 VAL OXT HXT sing N N 421 # _pdbx_audit_support.funding_organization 'Agence Nationale de la Recherche (ANR)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ANR-20-CE44-0012 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4ZCS _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 2 2 2' _space_group.name_Hall 'I 2 2' _space_group.IT_number 23 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9HSH _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.019804 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014426 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008544 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_