data_9HTD # _entry.id 9HTD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9HTD pdb_00009htd 10.2210/pdb9htd/pdb WWPDB D_1292143941 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-09-24 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9HTD _pdbx_database_status.recvd_initial_deposition_date 2024-12-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Apo structure of the same PSB-II construct.' 6EVL unspecified PDB 'Same PSB-II construct co-crystallized with PPGPEGPPG.' 6EVP unspecified PDB 'Same PSB-II construct co-crystallized with PPGPAGPPG.' 6EVN unspecified PDB 'Same PSB-II construct co-crystallized with PPGPRGPPG.' 6EVO unspecified PDB 'Same PSB-II construct co-crystallized with PPPPPPPPP.' 6EVM unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email rik.wierenga@oulu.fi _pdbx_contact_author.name_first Rik _pdbx_contact_author.name_last Wierenga _pdbx_contact_author.name_mi K. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6554-471X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sulu, R.' 1 0000-0003-0658-8338 'Rahman, M.M.' 2 0000-0002-8081-3823 'Wierenga, R.K.' 3 0000-0001-6554-471X 'Koski, M.K.' 4 0000-0002-9251-1160 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proteins _citation.journal_id_ASTM PSFGEY _citation.journal_id_CSD 0867 _citation.journal_id_ISSN 1097-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 93 _citation.language ? _citation.page_first 1732 _citation.page_last 1746 _citation.title ;Binding Differences of the Peptide-Substrate-Binding Domain of Collagen Prolyl 4-Hydroxylases I and II for Proline- and Hydroxyproline-Rich Peptides. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/prot.26839 _citation.pdbx_database_id_PubMed 40386874 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rahman, M.M.' 1 0000-0002-8081-3823 primary 'Sulu, R.' 2 0000-0003-0658-8338 primary 'Adediran, B.' 3 0000-0002-0552-6365 primary 'Tu, H.' 4 0000-0002-2198-3283 primary 'Salo, A.M.' 5 0000-0002-8781-217X primary 'Murthy, S.' 6 0000-0001-5602-4202 primary 'Myllyharju, J.' 7 0000-0001-7772-1250 primary 'Wierenga, R.K.' 8 0000-0001-6554-471X primary 'Koski, M.K.' 9 0000-0002-9251-1160 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Prolyl 4-hydroxylase subunit alpha-2' 11920.266 1 1.14.11.2 ? ? 'N-terminal His-tag. Construct including residues Met142-Glu236.' 2 polymer syn GLY-PRO-ALA-GLY-PRO-HYP-GLY 777.822 1 ? ? ? 'The two first N-terminal residues of the peptide are not modelled and not seen in the electron density.' 3 non-polymer syn GLYCINE 75.067 4 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 water nat water 18.015 55 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '4-PH alpha-2,Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MHHHHHHMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLS LDPSHERAGGNLRYFEQLLEEE ; ;MHHHHHHMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLS LDPSHERAGGNLRYFEQLLEEE ; A ? 2 'polypeptide(L)' no yes 'P(HYP)GPAGP(HYP)G' PPGPAGPPG C ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 GLYCINE GLY 4 'SULFATE ION' SO4 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 MET n 1 9 LEU n 1 10 SER n 1 11 VAL n 1 12 ASP n 1 13 ASP n 1 14 CYS n 1 15 PHE n 1 16 GLY n 1 17 MET n 1 18 GLY n 1 19 ARG n 1 20 SER n 1 21 ALA n 1 22 TYR n 1 23 ASN n 1 24 GLU n 1 25 GLY n 1 26 ASP n 1 27 TYR n 1 28 TYR n 1 29 HIS n 1 30 THR n 1 31 VAL n 1 32 LEU n 1 33 TRP n 1 34 MET n 1 35 GLU n 1 36 GLN n 1 37 VAL n 1 38 LEU n 1 39 LYS n 1 40 GLN n 1 41 LEU n 1 42 ASP n 1 43 ALA n 1 44 GLY n 1 45 GLU n 1 46 GLU n 1 47 ALA n 1 48 THR n 1 49 THR n 1 50 THR n 1 51 LYS n 1 52 SER n 1 53 GLN n 1 54 VAL n 1 55 LEU n 1 56 ASP n 1 57 TYR n 1 58 LEU n 1 59 SER n 1 60 TYR n 1 61 ALA n 1 62 VAL n 1 63 PHE n 1 64 GLN n 1 65 LEU n 1 66 GLY n 1 67 ASP n 1 68 LEU n 1 69 HIS n 1 70 ARG n 1 71 ALA n 1 72 LEU n 1 73 GLU n 1 74 LEU n 1 75 THR n 1 76 ARG n 1 77 ARG n 1 78 LEU n 1 79 LEU n 1 80 SER n 1 81 LEU n 1 82 ASP n 1 83 PRO n 1 84 SER n 1 85 HIS n 1 86 GLU n 1 87 ARG n 1 88 ALA n 1 89 GLY n 1 90 GLY n 1 91 ASN n 1 92 LEU n 1 93 ARG n 1 94 TYR n 1 95 PHE n 1 96 GLU n 1 97 GLN n 1 98 LEU n 1 99 LEU n 1 100 GLU n 1 101 GLU n 1 102 GLU n 2 1 PRO n 2 2 HYP n 2 3 GLY n 2 4 PRO n 2 5 ALA n 2 6 GLY n 2 7 PRO n 2 8 HYP n 2 9 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 102 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'P4HA2, UNQ290/PRO330' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 9 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 HYP 'L-peptide linking' n 4-HYDROXYPROLINE HYDROXYPROLINE 'C5 H9 N O3' 131.130 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 137 ? ? ? A . n A 1 2 HIS 2 138 ? ? ? A . n A 1 3 HIS 3 139 ? ? ? A . n A 1 4 HIS 4 140 ? ? ? A . n A 1 5 HIS 5 141 ? ? ? A . n A 1 6 HIS 6 142 ? ? ? A . n A 1 7 HIS 7 143 ? ? ? A . n A 1 8 MET 8 144 ? ? ? A . n A 1 9 LEU 9 145 145 LEU LEU A . n A 1 10 SER 10 146 146 SER SER A . n A 1 11 VAL 11 147 147 VAL VAL A . n A 1 12 ASP 12 148 148 ASP ASP A . n A 1 13 ASP 13 149 149 ASP ASP A . n A 1 14 CYS 14 150 150 CYS CYS A . n A 1 15 PHE 15 151 151 PHE PHE A . n A 1 16 GLY 16 152 152 GLY GLY A . n A 1 17 MET 17 153 153 MET MET A . n A 1 18 GLY 18 154 154 GLY GLY A . n A 1 19 ARG 19 155 155 ARG ARG A . n A 1 20 SER 20 156 156 SER SER A . n A 1 21 ALA 21 157 157 ALA ALA A . n A 1 22 TYR 22 158 158 TYR TYR A . n A 1 23 ASN 23 159 159 ASN ASN A . n A 1 24 GLU 24 160 160 GLU GLU A . n A 1 25 GLY 25 161 161 GLY GLY A . n A 1 26 ASP 26 162 162 ASP ASP A . n A 1 27 TYR 27 163 163 TYR TYR A . n A 1 28 TYR 28 164 164 TYR TYR A . n A 1 29 HIS 29 165 165 HIS HIS A . n A 1 30 THR 30 166 166 THR THR A . n A 1 31 VAL 31 167 167 VAL VAL A . n A 1 32 LEU 32 168 168 LEU LEU A . n A 1 33 TRP 33 169 169 TRP TRP A . n A 1 34 MET 34 170 170 MET MET A . n A 1 35 GLU 35 171 171 GLU GLU A . n A 1 36 GLN 36 172 172 GLN GLN A . n A 1 37 VAL 37 173 173 VAL VAL A . n A 1 38 LEU 38 174 174 LEU LEU A . n A 1 39 LYS 39 175 175 LYS LYS A . n A 1 40 GLN 40 176 176 GLN GLN A . n A 1 41 LEU 41 177 177 LEU LEU A . n A 1 42 ASP 42 178 178 ASP ASP A . n A 1 43 ALA 43 179 179 ALA ALA A . n A 1 44 GLY 44 180 180 GLY GLY A . n A 1 45 GLU 45 181 181 GLU GLU A . n A 1 46 GLU 46 182 182 GLU GLU A . n A 1 47 ALA 47 183 183 ALA ALA A . n A 1 48 THR 48 184 184 THR THR A . n A 1 49 THR 49 185 185 THR THR A . n A 1 50 THR 50 186 186 THR THR A . n A 1 51 LYS 51 187 187 LYS LYS A . n A 1 52 SER 52 188 188 SER SER A . n A 1 53 GLN 53 189 189 GLN GLN A . n A 1 54 VAL 54 190 190 VAL VAL A . n A 1 55 LEU 55 191 191 LEU LEU A . n A 1 56 ASP 56 192 192 ASP ASP A . n A 1 57 TYR 57 193 193 TYR TYR A . n A 1 58 LEU 58 194 194 LEU LEU A . n A 1 59 SER 59 195 195 SER SER A . n A 1 60 TYR 60 196 196 TYR TYR A . n A 1 61 ALA 61 197 197 ALA ALA A . n A 1 62 VAL 62 198 198 VAL VAL A . n A 1 63 PHE 63 199 199 PHE PHE A . n A 1 64 GLN 64 200 200 GLN GLN A . n A 1 65 LEU 65 201 201 LEU LEU A . n A 1 66 GLY 66 202 202 GLY GLY A . n A 1 67 ASP 67 203 203 ASP ASP A . n A 1 68 LEU 68 204 204 LEU LEU A . n A 1 69 HIS 69 205 205 HIS HIS A . n A 1 70 ARG 70 206 206 ARG ARG A . n A 1 71 ALA 71 207 207 ALA ALA A . n A 1 72 LEU 72 208 208 LEU LEU A . n A 1 73 GLU 73 209 209 GLU GLU A . n A 1 74 LEU 74 210 210 LEU LEU A . n A 1 75 THR 75 211 211 THR THR A . n A 1 76 ARG 76 212 212 ARG ARG A . n A 1 77 ARG 77 213 213 ARG ARG A . n A 1 78 LEU 78 214 214 LEU LEU A . n A 1 79 LEU 79 215 215 LEU LEU A . n A 1 80 SER 80 216 216 SER SER A . n A 1 81 LEU 81 217 217 LEU LEU A . n A 1 82 ASP 82 218 218 ASP ASP A . n A 1 83 PRO 83 219 219 PRO PRO A . n A 1 84 SER 84 220 220 SER SER A . n A 1 85 HIS 85 221 221 HIS HIS A . n A 1 86 GLU 86 222 222 GLU GLU A . n A 1 87 ARG 87 223 223 ARG ARG A . n A 1 88 ALA 88 224 224 ALA ALA A . n A 1 89 GLY 89 225 225 GLY GLY A . n A 1 90 GLY 90 226 226 GLY GLY A . n A 1 91 ASN 91 227 227 ASN ASN A . n A 1 92 LEU 92 228 228 LEU LEU A . n A 1 93 ARG 93 229 229 ARG ARG A . n A 1 94 TYR 94 230 230 TYR TYR A . n A 1 95 PHE 95 231 231 PHE PHE A . n A 1 96 GLU 96 232 232 GLU GLU A . n A 1 97 GLN 97 233 233 GLN GLN A . n A 1 98 LEU 98 234 234 LEU LEU A . n A 1 99 LEU 99 235 235 LEU LEU A . n A 1 100 GLU 100 236 236 GLU GLU A . n A 1 101 GLU 101 237 237 GLU GLU A . n A 1 102 GLU 102 238 238 GLU GLU A . n B 2 1 PRO 1 1 ? ? ? C . n B 2 2 HYP 2 2 ? ? ? C . n B 2 3 GLY 3 3 3 GLY GLY C . n B 2 4 PRO 4 4 4 PRO PRO C . n B 2 5 ALA 5 5 5 ALA ALA C . n B 2 6 GLY 6 6 6 GLY GLY C . n B 2 7 PRO 7 7 7 PRO PRO C . n B 2 8 HYP 8 8 8 HYP HYP C . n B 2 9 GLY 9 9 9 GLY GLY C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 GLY 1 301 1 GLY GLY A . D 3 GLY 1 302 2 GLY GLY A . E 3 GLY 1 303 3 GLY GLY A . F 3 GLY 1 304 4 GLY GLY A . G 4 SO4 1 305 1 SO4 SO4 A . H 5 HOH 1 401 27 HOH HOH A . H 5 HOH 2 402 55 HOH HOH A . H 5 HOH 3 403 38 HOH HOH A . H 5 HOH 4 404 10 HOH HOH A . H 5 HOH 5 405 20 HOH HOH A . H 5 HOH 6 406 16 HOH HOH A . H 5 HOH 7 407 30 HOH HOH A . H 5 HOH 8 408 41 HOH HOH A . H 5 HOH 9 409 47 HOH HOH A . H 5 HOH 10 410 25 HOH HOH A . H 5 HOH 11 411 4 HOH HOH A . H 5 HOH 12 412 36 HOH HOH A . H 5 HOH 13 413 1 HOH HOH A . H 5 HOH 14 414 34 HOH HOH A . H 5 HOH 15 415 45 HOH HOH A . H 5 HOH 16 416 17 HOH HOH A . H 5 HOH 17 417 21 HOH HOH A . H 5 HOH 18 418 9 HOH HOH A . H 5 HOH 19 419 5 HOH HOH A . H 5 HOH 20 420 2 HOH HOH A . H 5 HOH 21 421 8 HOH HOH A . H 5 HOH 22 422 26 HOH HOH A . H 5 HOH 23 423 23 HOH HOH A . H 5 HOH 24 424 11 HOH HOH A . H 5 HOH 25 425 51 HOH HOH A . H 5 HOH 26 426 50 HOH HOH A . H 5 HOH 27 427 15 HOH HOH A . H 5 HOH 28 428 12 HOH HOH A . H 5 HOH 29 429 14 HOH HOH A . H 5 HOH 30 430 43 HOH HOH A . H 5 HOH 31 431 18 HOH HOH A . H 5 HOH 32 432 28 HOH HOH A . H 5 HOH 33 433 22 HOH HOH A . H 5 HOH 34 434 39 HOH HOH A . H 5 HOH 35 435 31 HOH HOH A . H 5 HOH 36 436 32 HOH HOH A . H 5 HOH 37 437 19 HOH HOH A . H 5 HOH 38 438 7 HOH HOH A . H 5 HOH 39 439 13 HOH HOH A . H 5 HOH 40 440 3 HOH HOH A . H 5 HOH 41 441 42 HOH HOH A . H 5 HOH 42 442 29 HOH HOH A . H 5 HOH 43 443 6 HOH HOH A . H 5 HOH 44 444 35 HOH HOH A . H 5 HOH 45 445 49 HOH HOH A . H 5 HOH 46 446 24 HOH HOH A . H 5 HOH 47 447 44 HOH HOH A . H 5 HOH 48 448 53 HOH HOH A . H 5 HOH 49 449 52 HOH HOH A . H 5 HOH 50 450 54 HOH HOH A . H 5 HOH 51 451 33 HOH HOH A . I 5 HOH 1 101 40 HOH HOH C . I 5 HOH 2 102 37 HOH HOH C . I 5 HOH 3 103 46 HOH HOH C . I 5 HOH 4 104 48 HOH HOH C . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? '5.8.0430 (refmacat 0.4.77)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 120 _cell.angle_gamma_esd ? _cell.entry_id 9HTD _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.655 _cell.length_a_esd ? _cell.length_b 56.655 _cell.length_b_esd ? _cell.length_c 68.828 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9HTD _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9HTD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.30 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details 'Cold room temperature is fluctuating between 277 and 279.' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2M ammonium sulphate, 10% dioxane, 100 mM MES, 2 mM Pro-Hyp-Gly-Pro-Ala-Gly-Pro-Hyp-Gly.' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 278 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Toroidal mirror' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-09-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9763 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P14 (MX2)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate 27.6 _reflns.entry_id 9HTD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 49.06 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12786 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.026 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low 1.78 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 718 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.8 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.433 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.556 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.4 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.075 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.196 _refine.aniso_B[1][2] -0.098 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -0.196 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 0.637 _refine.B_iso_max ? _refine.B_iso_mean 39.127 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.974 _refine.correlation_coeff_Fo_to_Fc_free 0.963 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9HTD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.751 _refine.ls_d_res_low 49.06 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12783 _refine.ls_number_reflns_R_free 687 _refine.ls_number_reflns_R_work 12096 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.113 _refine.ls_percent_reflns_R_free 5.374 _refine.ls_R_factor_all 0.166 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.1951 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1648 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.096 _refine.pdbx_overall_ESU_R_Free 0.095 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.210 _refine.overall_SU_ML 0.067 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 802 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 55 _refine_hist.number_atoms_total 882 _refine_hist.d_res_high 1.751 _refine_hist.d_res_low 49.06 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.012 838 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.016 760 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.905 1.844 1130 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.741 1.768 1749 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.556 5.000 99 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 8.494 5.000 6 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 12.335 10.000 133 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.063 10.000 43 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.097 0.200 119 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1000 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 190 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.219 0.200 177 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.142 0.200 662 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.181 0.200 415 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.071 0.200 457 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.189 0.200 44 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.103 0.200 13 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.107 0.200 21 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.134 0.200 11 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 4.246 3.566 414 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.201 3.560 413 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 5.780 6.293 507 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 5.776 6.296 508 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 6.025 4.133 424 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.953 4.094 420 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 8.940 7.317 623 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.894 7.245 618 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 9.990 38.529 968 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 9.734 37.843 959 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.751 1.796 . . 49 885 98.2124 . . . . 0.278 . . . . . . . . . . . 0.279 'X-RAY DIFFRACTION' 1.796 1.846 . . 46 882 98.4093 . . . . 0.255 . . . . . . . . . . . 0.270 'X-RAY DIFFRACTION' 1.846 1.899 . . 49 867 97.9679 . . . . 0.262 . . . . . . . . . . . 0.255 'X-RAY DIFFRACTION' 1.899 1.957 . . 30 829 96.8433 . . . . 0.264 . . . . . . . . . . . 0.315 'X-RAY DIFFRACTION' 1.957 2.022 . . 64 777 97.4508 . . . . 0.198 . . . . . . . . . . . 0.261 'X-RAY DIFFRACTION' 2.022 2.092 . . 58 745 96.9807 . . . . 0.190 . . . . . . . . . . . 0.213 'X-RAY DIFFRACTION' 2.092 2.171 . . 40 760 97.6801 . . . . 0.171 . . . . . . . . . . . 0.272 'X-RAY DIFFRACTION' 2.171 2.260 . . 34 714 96.5161 . . . . 0.161 . . . . . . . . . . . 0.172 'X-RAY DIFFRACTION' 2.260 2.360 . . 32 687 95.9947 . . . . 0.141 . . . . . . . . . . . 0.165 'X-RAY DIFFRACTION' 2.360 2.475 . . 39 654 96.7877 . . . . 0.147 . . . . . . . . . . . 0.154 'X-RAY DIFFRACTION' 2.475 2.608 . . 34 627 96.3557 . . . . 0.158 . . . . . . . . . . . 0.206 'X-RAY DIFFRACTION' 2.608 2.766 . . 25 596 95.8333 . . . . 0.170 . . . . . . . . . . . 0.290 'X-RAY DIFFRACTION' 2.766 2.956 . . 45 547 95.4839 . . . . 0.165 . . . . . . . . . . . 0.154 'X-RAY DIFFRACTION' 2.956 3.192 . . 25 517 95.4225 . . . . 0.150 . . . . . . . . . . . 0.172 'X-RAY DIFFRACTION' 3.192 3.495 . . 41 459 93.9850 . . . . 0.153 . . . . . . . . . . . 0.154 'X-RAY DIFFRACTION' 3.495 3.906 . . 20 435 93.0470 . . . . 0.140 . . . . . . . . . . . 0.171 'X-RAY DIFFRACTION' 3.906 4.505 . . 21 375 92.9577 . . . . 0.135 . . . . . . . . . . . 0.162 'X-RAY DIFFRACTION' 4.505 5.506 . . 13 335 91.0995 . . . . 0.153 . . . . . . . . . . . 0.126 'X-RAY DIFFRACTION' 5.506 7.738 . . 16 247 88.8513 . . . . 0.199 . . . . . . . . . . . 0.301 'X-RAY DIFFRACTION' 7.738 49.06 . . 6 158 87.7005 . . . . 0.170 . . . . . . . . . . . 0.284 # _struct.entry_id 9HTD _struct.title ;Peptide-substrate-binding (PSB) domain of human type II collagen prolyl 4-hydroxylase complexed with Pro-Hyp-Gly-Pro-Ala-Gly-Pro-Hyp-Gly. ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9HTD _struct_keywords.text 'collagen, tetratricopeptide, extracellular matrix, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 5 ? I N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP P4HA2_HUMAN O15460 ? 1 ;MLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSHER AGGNLRYFEQLLEEE ; 163 2 PDB 9HTD 9HTD ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9HTD A 8 ? 102 ? O15460 163 ? 257 ? 144 238 2 2 9HTD C 1 ? 9 ? 9HTD 1 ? 9 ? 1 9 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9HTD MET A 1 ? UNP O15460 ? ? 'initiating methionine' 137 1 1 9HTD HIS A 2 ? UNP O15460 ? ? 'expression tag' 138 2 1 9HTD HIS A 3 ? UNP O15460 ? ? 'expression tag' 139 3 1 9HTD HIS A 4 ? UNP O15460 ? ? 'expression tag' 140 4 1 9HTD HIS A 5 ? UNP O15460 ? ? 'expression tag' 141 5 1 9HTD HIS A 6 ? UNP O15460 ? ? 'expression tag' 142 6 1 9HTD HIS A 7 ? UNP O15460 ? ? 'expression tag' 143 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 980 ? 1 MORE -16 ? 1 'SSA (A^2)' 5730 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details 'SEC-MALS experiments show that the PSB-II construct is monomer in the solution.' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 10 ? GLU A 24 ? SER A 146 GLU A 160 1 ? 15 HELX_P HELX_P2 AA2 ASP A 26 ? ALA A 43 ? ASP A 162 ALA A 179 1 ? 18 HELX_P HELX_P3 AA3 THR A 50 ? LEU A 65 ? THR A 186 LEU A 201 1 ? 16 HELX_P HELX_P4 AA4 ASP A 67 ? ASP A 82 ? ASP A 203 ASP A 218 1 ? 16 HELX_P HELX_P5 AA5 HIS A 85 ? GLU A 102 ? HIS A 221 GLU A 238 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B PRO 7 C ? ? ? 1_555 B HYP 8 N ? ? C PRO 7 C HYP 8 1_555 ? ? ? ? ? ? ? 1.356 ? ? covale2 covale both ? B HYP 8 C ? ? ? 1_555 B GLY 9 N ? ? C HYP 8 C GLY 9 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id HYP _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 8 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id HYP _pdbx_modification_feature.auth_asym_id C _pdbx_modification_feature.auth_seq_id 8 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id PRO _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id HYP _pdbx_modification_feature.type Hydroxylation _pdbx_modification_feature.category 'Named protein modification' # _pdbx_entry_details.entry_id 9HTD _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A GLU 160 ? ? CA A GLU 160 ? ? C A GLU 160 ? ? 98.10 110.40 -12.30 2.00 N 2 1 NE A ARG 206 ? ? CZ A ARG 206 ? ? NH1 A ARG 206 ? ? 124.02 120.30 3.72 0.50 N 3 1 NE A ARG 206 ? ? CZ A ARG 206 ? ? NH2 A ARG 206 ? ? 113.99 120.30 -6.31 0.50 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 218 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -155.34 _pdbx_validate_torsion.psi 66.08 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 155 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.089 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 137 ? A MET 1 2 1 Y 1 A HIS 138 ? A HIS 2 3 1 Y 1 A HIS 139 ? A HIS 3 4 1 Y 1 A HIS 140 ? A HIS 4 5 1 Y 1 A HIS 141 ? A HIS 5 6 1 Y 1 A HIS 142 ? A HIS 6 7 1 Y 1 A HIS 143 ? A HIS 7 8 1 Y 1 A MET 144 ? A MET 8 9 1 Y 1 C PRO 1 ? B PRO 1 10 1 Y 1 C HYP 2 ? B HYP 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 HYP N N N N 161 HYP CA C N S 162 HYP C C N N 163 HYP O O N N 164 HYP CB C N N 165 HYP CG C N R 166 HYP CD C N N 167 HYP OD1 O N N 168 HYP OXT O N N 169 HYP H H N N 170 HYP HA H N N 171 HYP HB2 H N N 172 HYP HB3 H N N 173 HYP HG H N N 174 HYP HD22 H N N 175 HYP HD23 H N N 176 HYP HD1 H N N 177 HYP HXT H N N 178 LEU N N N N 179 LEU CA C N S 180 LEU C C N N 181 LEU O O N N 182 LEU CB C N N 183 LEU CG C N N 184 LEU CD1 C N N 185 LEU CD2 C N N 186 LEU OXT O N N 187 LEU H H N N 188 LEU H2 H N N 189 LEU HA H N N 190 LEU HB2 H N N 191 LEU HB3 H N N 192 LEU HG H N N 193 LEU HD11 H N N 194 LEU HD12 H N N 195 LEU HD13 H N N 196 LEU HD21 H N N 197 LEU HD22 H N N 198 LEU HD23 H N N 199 LEU HXT H N N 200 LYS N N N N 201 LYS CA C N S 202 LYS C C N N 203 LYS O O N N 204 LYS CB C N N 205 LYS CG C N N 206 LYS CD C N N 207 LYS CE C N N 208 LYS NZ N N N 209 LYS OXT O N N 210 LYS H H N N 211 LYS H2 H N N 212 LYS HA H N N 213 LYS HB2 H N N 214 LYS HB3 H N N 215 LYS HG2 H N N 216 LYS HG3 H N N 217 LYS HD2 H N N 218 LYS HD3 H N N 219 LYS HE2 H N N 220 LYS HE3 H N N 221 LYS HZ1 H N N 222 LYS HZ2 H N N 223 LYS HZ3 H N N 224 LYS HXT H N N 225 MET N N N N 226 MET CA C N S 227 MET C C N N 228 MET O O N N 229 MET CB C N N 230 MET CG C N N 231 MET SD S N N 232 MET CE C N N 233 MET OXT O N N 234 MET H H N N 235 MET H2 H N N 236 MET HA H N N 237 MET HB2 H N N 238 MET HB3 H N N 239 MET HG2 H N N 240 MET HG3 H N N 241 MET HE1 H N N 242 MET HE2 H N N 243 MET HE3 H N N 244 MET HXT H N N 245 PHE N N N N 246 PHE CA C N S 247 PHE C C N N 248 PHE O O N N 249 PHE CB C N N 250 PHE CG C Y N 251 PHE CD1 C Y N 252 PHE CD2 C Y N 253 PHE CE1 C Y N 254 PHE CE2 C Y N 255 PHE CZ C Y N 256 PHE OXT O N N 257 PHE H H N N 258 PHE H2 H N N 259 PHE HA H N N 260 PHE HB2 H N N 261 PHE HB3 H N N 262 PHE HD1 H N N 263 PHE HD2 H N N 264 PHE HE1 H N N 265 PHE HE2 H N N 266 PHE HZ H N N 267 PHE HXT H N N 268 PRO N N N N 269 PRO CA C N S 270 PRO C C N N 271 PRO O O N N 272 PRO CB C N N 273 PRO CG C N N 274 PRO CD C N N 275 PRO OXT O N N 276 PRO H H N N 277 PRO HA H N N 278 PRO HB2 H N N 279 PRO HB3 H N N 280 PRO HG2 H N N 281 PRO HG3 H N N 282 PRO HD2 H N N 283 PRO HD3 H N N 284 PRO HXT H N N 285 SER N N N N 286 SER CA C N S 287 SER C C N N 288 SER O O N N 289 SER CB C N N 290 SER OG O N N 291 SER OXT O N N 292 SER H H N N 293 SER H2 H N N 294 SER HA H N N 295 SER HB2 H N N 296 SER HB3 H N N 297 SER HG H N N 298 SER HXT H N N 299 SO4 S S N N 300 SO4 O1 O N N 301 SO4 O2 O N N 302 SO4 O3 O N N 303 SO4 O4 O N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 HYP N CA sing N N 152 HYP N CD sing N N 153 HYP N H sing N N 154 HYP CA C sing N N 155 HYP CA CB sing N N 156 HYP CA HA sing N N 157 HYP C O doub N N 158 HYP C OXT sing N N 159 HYP CB CG sing N N 160 HYP CB HB2 sing N N 161 HYP CB HB3 sing N N 162 HYP CG CD sing N N 163 HYP CG OD1 sing N N 164 HYP CG HG sing N N 165 HYP CD HD22 sing N N 166 HYP CD HD23 sing N N 167 HYP OD1 HD1 sing N N 168 HYP OXT HXT sing N N 169 LEU N CA sing N N 170 LEU N H sing N N 171 LEU N H2 sing N N 172 LEU CA C sing N N 173 LEU CA CB sing N N 174 LEU CA HA sing N N 175 LEU C O doub N N 176 LEU C OXT sing N N 177 LEU CB CG sing N N 178 LEU CB HB2 sing N N 179 LEU CB HB3 sing N N 180 LEU CG CD1 sing N N 181 LEU CG CD2 sing N N 182 LEU CG HG sing N N 183 LEU CD1 HD11 sing N N 184 LEU CD1 HD12 sing N N 185 LEU CD1 HD13 sing N N 186 LEU CD2 HD21 sing N N 187 LEU CD2 HD22 sing N N 188 LEU CD2 HD23 sing N N 189 LEU OXT HXT sing N N 190 LYS N CA sing N N 191 LYS N H sing N N 192 LYS N H2 sing N N 193 LYS CA C sing N N 194 LYS CA CB sing N N 195 LYS CA HA sing N N 196 LYS C O doub N N 197 LYS C OXT sing N N 198 LYS CB CG sing N N 199 LYS CB HB2 sing N N 200 LYS CB HB3 sing N N 201 LYS CG CD sing N N 202 LYS CG HG2 sing N N 203 LYS CG HG3 sing N N 204 LYS CD CE sing N N 205 LYS CD HD2 sing N N 206 LYS CD HD3 sing N N 207 LYS CE NZ sing N N 208 LYS CE HE2 sing N N 209 LYS CE HE3 sing N N 210 LYS NZ HZ1 sing N N 211 LYS NZ HZ2 sing N N 212 LYS NZ HZ3 sing N N 213 LYS OXT HXT sing N N 214 MET N CA sing N N 215 MET N H sing N N 216 MET N H2 sing N N 217 MET CA C sing N N 218 MET CA CB sing N N 219 MET CA HA sing N N 220 MET C O doub N N 221 MET C OXT sing N N 222 MET CB CG sing N N 223 MET CB HB2 sing N N 224 MET CB HB3 sing N N 225 MET CG SD sing N N 226 MET CG HG2 sing N N 227 MET CG HG3 sing N N 228 MET SD CE sing N N 229 MET CE HE1 sing N N 230 MET CE HE2 sing N N 231 MET CE HE3 sing N N 232 MET OXT HXT sing N N 233 PHE N CA sing N N 234 PHE N H sing N N 235 PHE N H2 sing N N 236 PHE CA C sing N N 237 PHE CA CB sing N N 238 PHE CA HA sing N N 239 PHE C O doub N N 240 PHE C OXT sing N N 241 PHE CB CG sing N N 242 PHE CB HB2 sing N N 243 PHE CB HB3 sing N N 244 PHE CG CD1 doub Y N 245 PHE CG CD2 sing Y N 246 PHE CD1 CE1 sing Y N 247 PHE CD1 HD1 sing N N 248 PHE CD2 CE2 doub Y N 249 PHE CD2 HD2 sing N N 250 PHE CE1 CZ doub Y N 251 PHE CE1 HE1 sing N N 252 PHE CE2 CZ sing Y N 253 PHE CE2 HE2 sing N N 254 PHE CZ HZ sing N N 255 PHE OXT HXT sing N N 256 PRO N CA sing N N 257 PRO N CD sing N N 258 PRO N H sing N N 259 PRO CA C sing N N 260 PRO CA CB sing N N 261 PRO CA HA sing N N 262 PRO C O doub N N 263 PRO C OXT sing N N 264 PRO CB CG sing N N 265 PRO CB HB2 sing N N 266 PRO CB HB3 sing N N 267 PRO CG CD sing N N 268 PRO CG HG2 sing N N 269 PRO CG HG3 sing N N 270 PRO CD HD2 sing N N 271 PRO CD HD3 sing N N 272 PRO OXT HXT sing N N 273 SER N CA sing N N 274 SER N H sing N N 275 SER N H2 sing N N 276 SER CA C sing N N 277 SER CA CB sing N N 278 SER CA HA sing N N 279 SER C O doub N N 280 SER C OXT sing N N 281 SER CB OG sing N N 282 SER CB HB2 sing N N 283 SER CB HB3 sing N N 284 SER OG HG sing N N 285 SER OXT HXT sing N N 286 SO4 S O1 doub N N 287 SO4 S O2 doub N N 288 SO4 S O3 sing N N 289 SO4 S O4 sing N N 290 THR N CA sing N N 291 THR N H sing N N 292 THR N H2 sing N N 293 THR CA C sing N N 294 THR CA CB sing N N 295 THR CA HA sing N N 296 THR C O doub N N 297 THR C OXT sing N N 298 THR CB OG1 sing N N 299 THR CB CG2 sing N N 300 THR CB HB sing N N 301 THR OG1 HG1 sing N N 302 THR CG2 HG21 sing N N 303 THR CG2 HG22 sing N N 304 THR CG2 HG23 sing N N 305 THR OXT HXT sing N N 306 TRP N CA sing N N 307 TRP N H sing N N 308 TRP N H2 sing N N 309 TRP CA C sing N N 310 TRP CA CB sing N N 311 TRP CA HA sing N N 312 TRP C O doub N N 313 TRP C OXT sing N N 314 TRP CB CG sing N N 315 TRP CB HB2 sing N N 316 TRP CB HB3 sing N N 317 TRP CG CD1 doub Y N 318 TRP CG CD2 sing Y N 319 TRP CD1 NE1 sing Y N 320 TRP CD1 HD1 sing N N 321 TRP CD2 CE2 doub Y N 322 TRP CD2 CE3 sing Y N 323 TRP NE1 CE2 sing Y N 324 TRP NE1 HE1 sing N N 325 TRP CE2 CZ2 sing Y N 326 TRP CE3 CZ3 doub Y N 327 TRP CE3 HE3 sing N N 328 TRP CZ2 CH2 doub Y N 329 TRP CZ2 HZ2 sing N N 330 TRP CZ3 CH2 sing Y N 331 TRP CZ3 HZ3 sing N N 332 TRP CH2 HH2 sing N N 333 TRP OXT HXT sing N N 334 TYR N CA sing N N 335 TYR N H sing N N 336 TYR N H2 sing N N 337 TYR CA C sing N N 338 TYR CA CB sing N N 339 TYR CA HA sing N N 340 TYR C O doub N N 341 TYR C OXT sing N N 342 TYR CB CG sing N N 343 TYR CB HB2 sing N N 344 TYR CB HB3 sing N N 345 TYR CG CD1 doub Y N 346 TYR CG CD2 sing Y N 347 TYR CD1 CE1 sing Y N 348 TYR CD1 HD1 sing N N 349 TYR CD2 CE2 doub Y N 350 TYR CD2 HD2 sing N N 351 TYR CE1 CZ doub Y N 352 TYR CE1 HE1 sing N N 353 TYR CE2 CZ sing Y N 354 TYR CE2 HE2 sing N N 355 TYR CZ OH sing N N 356 TYR OH HH sing N N 357 TYR OXT HXT sing N N 358 VAL N CA sing N N 359 VAL N H sing N N 360 VAL N H2 sing N N 361 VAL CA C sing N N 362 VAL CA CB sing N N 363 VAL CA HA sing N N 364 VAL C O doub N N 365 VAL C OXT sing N N 366 VAL CB CG1 sing N N 367 VAL CB CG2 sing N N 368 VAL CB HB sing N N 369 VAL CG1 HG11 sing N N 370 VAL CG1 HG12 sing N N 371 VAL CG1 HG13 sing N N 372 VAL CG2 HG21 sing N N 373 VAL CG2 HG22 sing N N 374 VAL CG2 HG23 sing N N 375 VAL OXT HXT sing N N 376 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Jane and Aatos Erkko Foundation' Finland 220013 1 'Sigrid Juselius Foundation' Finland ? 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6EVL _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9HTD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017651 _atom_sites.fract_transf_matrix[1][2] 0.010191 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020381 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014529 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0487 # loop_ #