data_9HX8 # _entry.id 9HX8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9HX8 pdb_00009hx8 10.2210/pdb9hx8/pdb WWPDB D_1292144395 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-01-14 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9HX8 _pdbx_database_status.recvd_initial_deposition_date 2025-01-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email andreas.schlundt@uni-greifswald.de _pdbx_contact_author.name_first Andreas _pdbx_contact_author.name_last Schlundt _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2254-7560 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'von Ehr, J.' 1 0000-0003-4535-661X 'Schlundt, A.' 2 0000-0003-2254-7560 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Apo structure of SRSF6 RRM2 W123A' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'von Ehr, J.' 1 0000-0003-4535-661X primary 'Schlundt, A.' 2 0000-0003-2254-7560 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ubiquitin-like protein SMT3,Serine/arginine-rich splicing factor 6' 23010.746 1 ? W123A ? 'Fusion protein of His6-Sumo-SRSF6-RRM2 W123A, His6-Sumo-tag cleaved off during purification, W123A mutation abolished RNA-binding' 2 water nat water 18.015 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Pre-mRNA-splicing factor SRP55,Splicing factor,arginine/serine-rich 6' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASGHHHHHHGSEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPED LDMEDNDIIEAHREQIGGSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSAQDLKDFMRQAGEVTYADAHKERTN EGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHR ; _entity_poly.pdbx_seq_one_letter_code_can ;MASGHHHHHHGSEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPED LDMEDNDIIEAHREQIGGSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSAQDLKDFMRQAGEVTYADAHKERTN EGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 GLY n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 SER n 1 13 GLU n 1 14 VAL n 1 15 LYS n 1 16 PRO n 1 17 GLU n 1 18 VAL n 1 19 LYS n 1 20 PRO n 1 21 GLU n 1 22 THR n 1 23 HIS n 1 24 ILE n 1 25 ASN n 1 26 LEU n 1 27 LYS n 1 28 VAL n 1 29 SER n 1 30 ASP n 1 31 GLY n 1 32 SER n 1 33 SER n 1 34 GLU n 1 35 ILE n 1 36 PHE n 1 37 PHE n 1 38 LYS n 1 39 ILE n 1 40 LYS n 1 41 LYS n 1 42 THR n 1 43 THR n 1 44 PRO n 1 45 LEU n 1 46 ARG n 1 47 ARG n 1 48 LEU n 1 49 MET n 1 50 GLU n 1 51 ALA n 1 52 PHE n 1 53 ALA n 1 54 LYS n 1 55 ARG n 1 56 GLN n 1 57 GLY n 1 58 LYS n 1 59 GLU n 1 60 MET n 1 61 ASP n 1 62 SER n 1 63 LEU n 1 64 ARG n 1 65 PHE n 1 66 LEU n 1 67 TYR n 1 68 ASP n 1 69 GLY n 1 70 ILE n 1 71 ARG n 1 72 ILE n 1 73 GLN n 1 74 ALA n 1 75 ASP n 1 76 GLN n 1 77 THR n 1 78 PRO n 1 79 GLU n 1 80 ASP n 1 81 LEU n 1 82 ASP n 1 83 MET n 1 84 GLU n 1 85 ASP n 1 86 ASN n 1 87 ASP n 1 88 ILE n 1 89 ILE n 1 90 GLU n 1 91 ALA n 1 92 HIS n 1 93 ARG n 1 94 GLU n 1 95 GLN n 1 96 ILE n 1 97 GLY n 1 98 GLY n 1 99 SER n 1 100 GLY n 1 101 GLY n 1 102 GLY n 1 103 GLY n 1 104 TYR n 1 105 SER n 1 106 SER n 1 107 ARG n 1 108 ARG n 1 109 THR n 1 110 SER n 1 111 GLY n 1 112 ARG n 1 113 ASP n 1 114 LYS n 1 115 TYR n 1 116 GLY n 1 117 PRO n 1 118 PRO n 1 119 VAL n 1 120 ARG n 1 121 THR n 1 122 GLU n 1 123 TYR n 1 124 ARG n 1 125 LEU n 1 126 ILE n 1 127 VAL n 1 128 GLU n 1 129 ASN n 1 130 LEU n 1 131 SER n 1 132 SER n 1 133 ARG n 1 134 CYS n 1 135 SER n 1 136 ALA n 1 137 GLN n 1 138 ASP n 1 139 LEU n 1 140 LYS n 1 141 ASP n 1 142 PHE n 1 143 MET n 1 144 ARG n 1 145 GLN n 1 146 ALA n 1 147 GLY n 1 148 GLU n 1 149 VAL n 1 150 THR n 1 151 TYR n 1 152 ALA n 1 153 ASP n 1 154 ALA n 1 155 HIS n 1 156 LYS n 1 157 GLU n 1 158 ARG n 1 159 THR n 1 160 ASN n 1 161 GLU n 1 162 GLY n 1 163 VAL n 1 164 ILE n 1 165 GLU n 1 166 PHE n 1 167 ARG n 1 168 SER n 1 169 TYR n 1 170 SER n 1 171 ASP n 1 172 MET n 1 173 LYS n 1 174 ARG n 1 175 ALA n 1 176 LEU n 1 177 ASP n 1 178 LYS n 1 179 LEU n 1 180 ASP n 1 181 GLY n 1 182 THR n 1 183 GLU n 1 184 ILE n 1 185 ASN n 1 186 GLY n 1 187 ARG n 1 188 ASN n 1 189 ILE n 1 190 ARG n 1 191 LEU n 1 192 ILE n 1 193 GLU n 1 194 ASP n 1 195 LYS n 1 196 PRO n 1 197 ARG n 1 198 THR n 1 199 SER n 1 200 HIS n 1 201 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 98 ;Baker's yeast ; ? 'SMT3, YDR510W, D9719.15' ? ? ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 99 201 human ? 'SRSF6, SFRS6, SRP55' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -12 ? ? ? A . n A 1 2 ALA 2 -11 ? ? ? A . n A 1 3 SER 3 -10 ? ? ? A . n A 1 4 GLY 4 -9 ? ? ? A . n A 1 5 HIS 5 -8 ? ? ? A . n A 1 6 HIS 6 -7 ? ? ? A . n A 1 7 HIS 7 -6 ? ? ? A . n A 1 8 HIS 8 -5 ? ? ? A . n A 1 9 HIS 9 -4 ? ? ? A . n A 1 10 HIS 10 -3 ? ? ? A . n A 1 11 GLY 11 -2 ? ? ? A . n A 1 12 SER 12 -1 ? ? ? A . n A 1 13 GLU 13 0 ? ? ? A . n A 1 14 VAL 14 1 ? ? ? A . n A 1 15 LYS 15 2 ? ? ? A . n A 1 16 PRO 16 3 ? ? ? A . n A 1 17 GLU 17 4 ? ? ? A . n A 1 18 VAL 18 5 ? ? ? A . n A 1 19 LYS 19 6 ? ? ? A . n A 1 20 PRO 20 7 ? ? ? A . n A 1 21 GLU 21 8 ? ? ? A . n A 1 22 THR 22 9 ? ? ? A . n A 1 23 HIS 23 10 ? ? ? A . n A 1 24 ILE 24 11 ? ? ? A . n A 1 25 ASN 25 12 ? ? ? A . n A 1 26 LEU 26 13 ? ? ? A . n A 1 27 LYS 27 14 ? ? ? A . n A 1 28 VAL 28 15 ? ? ? A . n A 1 29 SER 29 16 ? ? ? A . n A 1 30 ASP 30 17 ? ? ? A . n A 1 31 GLY 31 18 ? ? ? A . n A 1 32 SER 32 19 ? ? ? A . n A 1 33 SER 33 20 ? ? ? A . n A 1 34 GLU 34 21 ? ? ? A . n A 1 35 ILE 35 22 ? ? ? A . n A 1 36 PHE 36 23 ? ? ? A . n A 1 37 PHE 37 24 ? ? ? A . n A 1 38 LYS 38 25 ? ? ? A . n A 1 39 ILE 39 26 ? ? ? A . n A 1 40 LYS 40 27 ? ? ? A . n A 1 41 LYS 41 28 ? ? ? A . n A 1 42 THR 42 29 ? ? ? A . n A 1 43 THR 43 30 ? ? ? A . n A 1 44 PRO 44 31 ? ? ? A . n A 1 45 LEU 45 32 ? ? ? A . n A 1 46 ARG 46 33 ? ? ? A . n A 1 47 ARG 47 34 ? ? ? A . n A 1 48 LEU 48 35 ? ? ? A . n A 1 49 MET 49 36 ? ? ? A . n A 1 50 GLU 50 37 ? ? ? A . n A 1 51 ALA 51 38 ? ? ? A . n A 1 52 PHE 52 39 ? ? ? A . n A 1 53 ALA 53 40 ? ? ? A . n A 1 54 LYS 54 41 ? ? ? A . n A 1 55 ARG 55 42 ? ? ? A . n A 1 56 GLN 56 43 ? ? ? A . n A 1 57 GLY 57 44 ? ? ? A . n A 1 58 LYS 58 45 ? ? ? A . n A 1 59 GLU 59 46 ? ? ? A . n A 1 60 MET 60 47 ? ? ? A . n A 1 61 ASP 61 48 ? ? ? A . n A 1 62 SER 62 49 ? ? ? A . n A 1 63 LEU 63 50 ? ? ? A . n A 1 64 ARG 64 51 ? ? ? A . n A 1 65 PHE 65 52 ? ? ? A . n A 1 66 LEU 66 53 ? ? ? A . n A 1 67 TYR 67 54 ? ? ? A . n A 1 68 ASP 68 55 ? ? ? A . n A 1 69 GLY 69 56 ? ? ? A . n A 1 70 ILE 70 57 ? ? ? A . n A 1 71 ARG 71 58 ? ? ? A . n A 1 72 ILE 72 59 ? ? ? A . n A 1 73 GLN 73 60 ? ? ? A . n A 1 74 ALA 74 61 ? ? ? A . n A 1 75 ASP 75 62 ? ? ? A . n A 1 76 GLN 76 63 ? ? ? A . n A 1 77 THR 77 64 ? ? ? A . n A 1 78 PRO 78 65 ? ? ? A . n A 1 79 GLU 79 66 ? ? ? A . n A 1 80 ASP 80 67 ? ? ? A . n A 1 81 LEU 81 68 ? ? ? A . n A 1 82 ASP 82 69 ? ? ? A . n A 1 83 MET 83 70 ? ? ? A . n A 1 84 GLU 84 71 ? ? ? A . n A 1 85 ASP 85 72 ? ? ? A . n A 1 86 ASN 86 73 ? ? ? A . n A 1 87 ASP 87 74 ? ? ? A . n A 1 88 ILE 88 75 ? ? ? A . n A 1 89 ILE 89 76 ? ? ? A . n A 1 90 GLU 90 77 ? ? ? A . n A 1 91 ALA 91 78 ? ? ? A . n A 1 92 HIS 92 79 ? ? ? A . n A 1 93 ARG 93 80 ? ? ? A . n A 1 94 GLU 94 81 ? ? ? A . n A 1 95 GLN 95 82 ? ? ? A . n A 1 96 ILE 96 83 ? ? ? A . n A 1 97 GLY 97 84 ? ? ? A . n A 1 98 GLY 98 85 ? ? ? A . n A 1 99 SER 99 86 ? ? ? A . n A 1 100 GLY 100 87 ? ? ? A . n A 1 101 GLY 101 88 ? ? ? A . n A 1 102 GLY 102 89 ? ? ? A . n A 1 103 GLY 103 90 ? ? ? A . n A 1 104 TYR 104 91 ? ? ? A . n A 1 105 SER 105 92 ? ? ? A . n A 1 106 SER 106 93 ? ? ? A . n A 1 107 ARG 107 94 ? ? ? A . n A 1 108 ARG 108 95 ? ? ? A . n A 1 109 THR 109 96 ? ? ? A . n A 1 110 SER 110 97 ? ? ? A . n A 1 111 GLY 111 98 ? ? ? A . n A 1 112 ARG 112 99 ? ? ? A . n A 1 113 ASP 113 100 ? ? ? A . n A 1 114 LYS 114 101 ? ? ? A . n A 1 115 TYR 115 102 ? ? ? A . n A 1 116 GLY 116 103 ? ? ? A . n A 1 117 PRO 117 104 ? ? ? A . n A 1 118 PRO 118 105 ? ? ? A . n A 1 119 VAL 119 106 106 VAL VAL A . n A 1 120 ARG 120 107 107 ARG ARG A . n A 1 121 THR 121 108 108 THR THR A . n A 1 122 GLU 122 109 109 GLU GLU A . n A 1 123 TYR 123 110 110 TYR TYR A . n A 1 124 ARG 124 111 111 ARG ARG A . n A 1 125 LEU 125 112 112 LEU LEU A . n A 1 126 ILE 126 113 113 ILE ILE A . n A 1 127 VAL 127 114 114 VAL VAL A . n A 1 128 GLU 128 115 115 GLU GLU A . n A 1 129 ASN 129 116 116 ASN ASN A . n A 1 130 LEU 130 117 117 LEU LEU A . n A 1 131 SER 131 118 118 SER SER A . n A 1 132 SER 132 119 119 SER SER A . n A 1 133 ARG 133 120 120 ARG ARG A . n A 1 134 CYS 134 121 121 CYS CYS A . n A 1 135 SER 135 122 122 SER SER A . n A 1 136 ALA 136 123 123 ALA ALA A . n A 1 137 GLN 137 124 124 GLN GLN A . n A 1 138 ASP 138 125 125 ASP ASP A . n A 1 139 LEU 139 126 126 LEU LEU A . n A 1 140 LYS 140 127 127 LYS LYS A . n A 1 141 ASP 141 128 128 ASP ASP A . n A 1 142 PHE 142 129 129 PHE PHE A . n A 1 143 MET 143 130 130 MET MET A . n A 1 144 ARG 144 131 131 ARG ARG A . n A 1 145 GLN 145 132 132 GLN GLN A . n A 1 146 ALA 146 133 133 ALA ALA A . n A 1 147 GLY 147 134 134 GLY GLY A . n A 1 148 GLU 148 135 135 GLU GLU A . n A 1 149 VAL 149 136 136 VAL VAL A . n A 1 150 THR 150 137 137 THR THR A . n A 1 151 TYR 151 138 138 TYR TYR A . n A 1 152 ALA 152 139 139 ALA ALA A . n A 1 153 ASP 153 140 140 ASP ASP A . n A 1 154 ALA 154 141 141 ALA ALA A . n A 1 155 HIS 155 142 142 HIS HIS A . n A 1 156 LYS 156 143 143 LYS LYS A . n A 1 157 GLU 157 144 144 GLU GLU A . n A 1 158 ARG 158 145 145 ARG ARG A . n A 1 159 THR 159 146 146 THR THR A . n A 1 160 ASN 160 147 147 ASN ASN A . n A 1 161 GLU 161 148 148 GLU GLU A . n A 1 162 GLY 162 149 149 GLY GLY A . n A 1 163 VAL 163 150 150 VAL VAL A . n A 1 164 ILE 164 151 151 ILE ILE A . n A 1 165 GLU 165 152 152 GLU GLU A . n A 1 166 PHE 166 153 153 PHE PHE A . n A 1 167 ARG 167 154 154 ARG ARG A . n A 1 168 SER 168 155 155 SER SER A . n A 1 169 TYR 169 156 156 TYR TYR A . n A 1 170 SER 170 157 157 SER SER A . n A 1 171 ASP 171 158 158 ASP ASP A . n A 1 172 MET 172 159 159 MET MET A . n A 1 173 LYS 173 160 160 LYS LYS A . n A 1 174 ARG 174 161 161 ARG ARG A . n A 1 175 ALA 175 162 162 ALA ALA A . n A 1 176 LEU 176 163 163 LEU LEU A . n A 1 177 ASP 177 164 164 ASP ASP A . n A 1 178 LYS 178 165 165 LYS LYS A . n A 1 179 LEU 179 166 166 LEU LEU A . n A 1 180 ASP 180 167 167 ASP ASP A . n A 1 181 GLY 181 168 168 GLY GLY A . n A 1 182 THR 182 169 169 THR THR A . n A 1 183 GLU 183 170 170 GLU GLU A . n A 1 184 ILE 184 171 171 ILE ILE A . n A 1 185 ASN 185 172 172 ASN ASN A . n A 1 186 GLY 186 173 173 GLY GLY A . n A 1 187 ARG 187 174 174 ARG ARG A . n A 1 188 ASN 188 175 175 ASN ASN A . n A 1 189 ILE 189 176 176 ILE ILE A . n A 1 190 ARG 190 177 177 ARG ARG A . n A 1 191 LEU 191 178 178 LEU LEU A . n A 1 192 ILE 192 179 179 ILE ILE A . n A 1 193 GLU 193 180 180 GLU GLU A . n A 1 194 ASP 194 181 181 ASP ASP A . n A 1 195 LYS 195 182 182 LYS LYS A . n A 1 196 PRO 196 183 183 PRO PRO A . n A 1 197 ARG 197 184 184 ARG ARG A . n A 1 198 THR 198 185 185 THR THR A . n A 1 199 SER 199 186 ? ? ? A . n A 1 200 HIS 200 187 ? ? ? A . n A 1 201 ARG 201 188 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 3 HOH HOH A . B 2 HOH 2 202 18 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? v2 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? 1.1.7 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'Jun 30, 2023' 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? 2.3.74 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? pointless ? ? ? 1.13.4 5 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.8.2 6 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.8.3 7 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? BUCCANEER ? ? ? 3.5.2 8 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.9.8.95 9 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0430 10 ? refinement ? ? ? ? ? ? ? ? ? ? ? PDB-REDO ? ? ? 8.11 11 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.4 12 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 120 _cell.angle_gamma_esd ? _cell.entry_id 9HX8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 66.07 _cell.length_a_esd ? _cell.length_b 66.07 _cell.length_b_esd ? _cell.length_c 46.322 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9HX8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9HX8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.69 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Na-Citrate, 20 % PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-06-30 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97622 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97622 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P13 (MX1)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9HX8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.00 _reflns.d_resolution_low 57.22 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8061 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.00 _reflns_shell.d_res_low 2.05 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 583 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.953 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -12.6826 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][2] -12.6826 _refine.aniso_B[2][3] 0 _refine.aniso_B[3][3] 25.3652 _refine.B_iso_max ? _refine.B_iso_mean 85.04 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.929 _refine.correlation_coeff_Fo_to_Fc_free 0.933 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9HX8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2 _refine.ls_d_res_low 36 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8017 _refine.ls_number_reflns_R_free 378 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.3 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2484 _refine.ls_R_factor_R_free 0.2589 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2479 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.149 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.146 _refine.pdbx_overall_SU_R_Blow_DPI 0.171 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.173 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9HX8 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.38 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2 _refine_hist.d_res_low 36 _refine_hist.number_atoms_solvent 2 _refine_hist.number_atoms_total 655 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 653 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 659 ? t_bond_d 2 HARMONIC 'X-RAY DIFFRACTION' ? 0.87 ? 882 ? t_angle_deg 2 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 256 ? t_dihedral_angle_d 2 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 117 ? t_gen_planes 5 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 659 ? t_it 10 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 86 ? t_chiral_improper_torsion 5 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 469 ? t_ideal_dist_contact 4 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 3.12 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 14.61 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2 _refine_ls_shell.d_res_low 2.04 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 446 _refine_ls_shell.number_reflns_R_free 25 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.percent_reflns_obs 99.33 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs 0.3661 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3622 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.4666 # _struct.entry_id 9HX8 _struct.title 'Apo structure of SRSF6 RRM2 W123A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9HX8 _struct_keywords.text 'RRM, splicing factor, RNA-binding protein, SRSF6, SPLICING' _struct_keywords.pdbx_keywords SPLICING # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SMT3_YEAST Q12306 ? 1 ;EVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAH REQIGG ; 13 2 UNP SRSF6_HUMAN Q13247 ? 1 ;SGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDK LDGTEINGRNIRLIEDKPRTSHR ; 86 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9HX8 A 13 ? 98 ? Q12306 13 ? 98 ? 0 85 2 2 9HX8 A 99 ? 201 ? Q13247 86 ? 188 ? 86 188 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9HX8 MET A 1 ? UNP Q12306 ? ? 'initiating methionine' -12 1 1 9HX8 ALA A 2 ? UNP Q12306 ? ? 'expression tag' -11 2 1 9HX8 SER A 3 ? UNP Q12306 ? ? 'expression tag' -10 3 1 9HX8 GLY A 4 ? UNP Q12306 ? ? 'expression tag' -9 4 1 9HX8 HIS A 5 ? UNP Q12306 ? ? 'expression tag' -8 5 1 9HX8 HIS A 6 ? UNP Q12306 ? ? 'expression tag' -7 6 1 9HX8 HIS A 7 ? UNP Q12306 ? ? 'expression tag' -6 7 1 9HX8 HIS A 8 ? UNP Q12306 ? ? 'expression tag' -5 8 1 9HX8 HIS A 9 ? UNP Q12306 ? ? 'expression tag' -4 9 1 9HX8 HIS A 10 ? UNP Q12306 ? ? 'expression tag' -3 10 1 9HX8 GLY A 11 ? UNP Q12306 ? ? 'expression tag' -2 11 1 9HX8 SER A 12 ? UNP Q12306 ? ? 'expression tag' -1 12 2 9HX8 ALA A 136 ? UNP Q13247 TRP 123 'engineered mutation' 123 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 4940 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Gel filtration shows peak at expected elution volume for monomeric protein' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 135 ? ARG A 144 ? SER A 122 ARG A 131 1 ? 10 HELX_P HELX_P2 AA2 SER A 168 ? ASP A 180 ? SER A 155 ASP A 167 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 149 ? ALA A 154 ? VAL A 136 ALA A 141 AA1 2 GLU A 161 ? PHE A 166 ? GLU A 148 PHE A 153 AA1 3 ARG A 124 ? GLU A 128 ? ARG A 111 GLU A 115 AA1 4 ARG A 190 ? GLU A 193 ? ARG A 177 GLU A 180 AA2 1 GLU A 183 ? ILE A 184 ? GLU A 170 ILE A 171 AA2 2 ARG A 187 ? ASN A 188 ? ARG A 174 ASN A 175 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 151 ? N TYR A 138 O GLU A 165 ? O GLU A 152 AA1 2 3 O ILE A 164 ? O ILE A 151 N LEU A 125 ? N LEU A 112 AA1 3 4 N ILE A 126 ? N ILE A 113 O ILE A 192 ? O ILE A 179 AA2 1 2 N ILE A 184 ? N ILE A 171 O ARG A 187 ? O ARG A 174 # _pdbx_entry_details.entry_id 9HX8 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method ? _pdbx_refine_tls.origin_x 25.979 _pdbx_refine_tls.origin_y -9.454 _pdbx_refine_tls.origin_z 1.382 _pdbx_refine_tls.T[1][1] 0.09 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0105 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0635 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.1184 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0563 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0124 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 6.2593 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.9522 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.5755 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 7.948 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 3.3943 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 15.6532 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1433 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.2119 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.3407 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.2119 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.7614 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -1.5602 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.3407 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -1.5602 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.6181 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 106 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 185 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|106 - A|185 }' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -12 ? A MET 1 2 1 Y 1 A ALA -11 ? A ALA 2 3 1 Y 1 A SER -10 ? A SER 3 4 1 Y 1 A GLY -9 ? A GLY 4 5 1 Y 1 A HIS -8 ? A HIS 5 6 1 Y 1 A HIS -7 ? A HIS 6 7 1 Y 1 A HIS -6 ? A HIS 7 8 1 Y 1 A HIS -5 ? A HIS 8 9 1 Y 1 A HIS -4 ? A HIS 9 10 1 Y 1 A HIS -3 ? A HIS 10 11 1 Y 1 A GLY -2 ? A GLY 11 12 1 Y 1 A SER -1 ? A SER 12 13 1 Y 1 A GLU 0 ? A GLU 13 14 1 Y 1 A VAL 1 ? A VAL 14 15 1 Y 1 A LYS 2 ? A LYS 15 16 1 Y 1 A PRO 3 ? A PRO 16 17 1 Y 1 A GLU 4 ? A GLU 17 18 1 Y 1 A VAL 5 ? A VAL 18 19 1 Y 1 A LYS 6 ? A LYS 19 20 1 Y 1 A PRO 7 ? A PRO 20 21 1 Y 1 A GLU 8 ? A GLU 21 22 1 Y 1 A THR 9 ? A THR 22 23 1 Y 1 A HIS 10 ? A HIS 23 24 1 Y 1 A ILE 11 ? A ILE 24 25 1 Y 1 A ASN 12 ? A ASN 25 26 1 Y 1 A LEU 13 ? A LEU 26 27 1 Y 1 A LYS 14 ? A LYS 27 28 1 Y 1 A VAL 15 ? A VAL 28 29 1 Y 1 A SER 16 ? A SER 29 30 1 Y 1 A ASP 17 ? A ASP 30 31 1 Y 1 A GLY 18 ? A GLY 31 32 1 Y 1 A SER 19 ? A SER 32 33 1 Y 1 A SER 20 ? A SER 33 34 1 Y 1 A GLU 21 ? A GLU 34 35 1 Y 1 A ILE 22 ? A ILE 35 36 1 Y 1 A PHE 23 ? A PHE 36 37 1 Y 1 A PHE 24 ? A PHE 37 38 1 Y 1 A LYS 25 ? A LYS 38 39 1 Y 1 A ILE 26 ? A ILE 39 40 1 Y 1 A LYS 27 ? A LYS 40 41 1 Y 1 A LYS 28 ? A LYS 41 42 1 Y 1 A THR 29 ? A THR 42 43 1 Y 1 A THR 30 ? A THR 43 44 1 Y 1 A PRO 31 ? A PRO 44 45 1 Y 1 A LEU 32 ? A LEU 45 46 1 Y 1 A ARG 33 ? A ARG 46 47 1 Y 1 A ARG 34 ? A ARG 47 48 1 Y 1 A LEU 35 ? A LEU 48 49 1 Y 1 A MET 36 ? A MET 49 50 1 Y 1 A GLU 37 ? A GLU 50 51 1 Y 1 A ALA 38 ? A ALA 51 52 1 Y 1 A PHE 39 ? A PHE 52 53 1 Y 1 A ALA 40 ? A ALA 53 54 1 Y 1 A LYS 41 ? A LYS 54 55 1 Y 1 A ARG 42 ? A ARG 55 56 1 Y 1 A GLN 43 ? A GLN 56 57 1 Y 1 A GLY 44 ? A GLY 57 58 1 Y 1 A LYS 45 ? A LYS 58 59 1 Y 1 A GLU 46 ? A GLU 59 60 1 Y 1 A MET 47 ? A MET 60 61 1 Y 1 A ASP 48 ? A ASP 61 62 1 Y 1 A SER 49 ? A SER 62 63 1 Y 1 A LEU 50 ? A LEU 63 64 1 Y 1 A ARG 51 ? A ARG 64 65 1 Y 1 A PHE 52 ? A PHE 65 66 1 Y 1 A LEU 53 ? A LEU 66 67 1 Y 1 A TYR 54 ? A TYR 67 68 1 Y 1 A ASP 55 ? A ASP 68 69 1 Y 1 A GLY 56 ? A GLY 69 70 1 Y 1 A ILE 57 ? A ILE 70 71 1 Y 1 A ARG 58 ? A ARG 71 72 1 Y 1 A ILE 59 ? A ILE 72 73 1 Y 1 A GLN 60 ? A GLN 73 74 1 Y 1 A ALA 61 ? A ALA 74 75 1 Y 1 A ASP 62 ? A ASP 75 76 1 Y 1 A GLN 63 ? A GLN 76 77 1 Y 1 A THR 64 ? A THR 77 78 1 Y 1 A PRO 65 ? A PRO 78 79 1 Y 1 A GLU 66 ? A GLU 79 80 1 Y 1 A ASP 67 ? A ASP 80 81 1 Y 1 A LEU 68 ? A LEU 81 82 1 Y 1 A ASP 69 ? A ASP 82 83 1 Y 1 A MET 70 ? A MET 83 84 1 Y 1 A GLU 71 ? A GLU 84 85 1 Y 1 A ASP 72 ? A ASP 85 86 1 Y 1 A ASN 73 ? A ASN 86 87 1 Y 1 A ASP 74 ? A ASP 87 88 1 Y 1 A ILE 75 ? A ILE 88 89 1 Y 1 A ILE 76 ? A ILE 89 90 1 Y 1 A GLU 77 ? A GLU 90 91 1 Y 1 A ALA 78 ? A ALA 91 92 1 Y 1 A HIS 79 ? A HIS 92 93 1 Y 1 A ARG 80 ? A ARG 93 94 1 Y 1 A GLU 81 ? A GLU 94 95 1 Y 1 A GLN 82 ? A GLN 95 96 1 Y 1 A ILE 83 ? A ILE 96 97 1 Y 1 A GLY 84 ? A GLY 97 98 1 Y 1 A GLY 85 ? A GLY 98 99 1 Y 1 A SER 86 ? A SER 99 100 1 Y 1 A GLY 87 ? A GLY 100 101 1 Y 1 A GLY 88 ? A GLY 101 102 1 Y 1 A GLY 89 ? A GLY 102 103 1 Y 1 A GLY 90 ? A GLY 103 104 1 Y 1 A TYR 91 ? A TYR 104 105 1 Y 1 A SER 92 ? A SER 105 106 1 Y 1 A SER 93 ? A SER 106 107 1 Y 1 A ARG 94 ? A ARG 107 108 1 Y 1 A ARG 95 ? A ARG 108 109 1 Y 1 A THR 96 ? A THR 109 110 1 Y 1 A SER 97 ? A SER 110 111 1 Y 1 A GLY 98 ? A GLY 111 112 1 Y 1 A ARG 99 ? A ARG 112 113 1 Y 1 A ASP 100 ? A ASP 113 114 1 Y 1 A LYS 101 ? A LYS 114 115 1 Y 1 A TYR 102 ? A TYR 115 116 1 Y 1 A GLY 103 ? A GLY 116 117 1 Y 1 A PRO 104 ? A PRO 117 118 1 Y 1 A PRO 105 ? A PRO 118 119 1 Y 1 A SER 186 ? A SER 199 120 1 Y 1 A HIS 187 ? A HIS 200 121 1 Y 1 A ARG 188 ? A ARG 201 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'Own crystal structure from WT domain' # _atom_sites.entry_id 9HX8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015135 _atom_sites.fract_transf_matrix[1][2] 0.008738 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017477 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021588 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #