data_9I19 # _entry.id 9I19 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9I19 pdb_00009i19 10.2210/pdb9i19/pdb WWPDB D_1292142220 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-01-28 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9I19 _pdbx_database_status.recvd_initial_deposition_date 2025-01-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 4 _pdbx_contact_author.email n.le-brun@uea.ac.uk _pdbx_contact_author.name_first Nick _pdbx_contact_author.name_last 'Le Brun' _pdbx_contact_author.name_mi E _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9780-4061 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bugg, Z.' 1 0009-0008-4847-7322 'Hemmings, A.M.' 2 0000-0003-3053-3134 'Bradley, J.M.' 3 0000-0003-1635-4455 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Three-fold channel residue Asp131 plays a key role in guiding Fe2+ to the catalytic ferroxidase centres of human H-chain and mitochondrial ferritins ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bugg, Z.' 1 0009-0008-4847-7322 primary 'Hemmings, A.M.' 2 0000-0003-3053-3134 primary 'Bradley, J.M.' 3 0000-0003-1635-4455 primary 'Le Brun, N.E.' 4 0000-0001-9780-4061 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ferritin heavy chain' 21254.670 1 1.16.3.1 ? ? ? 2 non-polymer syn 'FE (III) ION' 55.845 3 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 4 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 4 ? ? ? ? 5 water nat water 18.015 274 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ferritin H subunit,Cell proliferation-inducing gene 15 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR IFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCNFIETHYLNEQVKAIKELGDHVTNLRKMG APESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_seq_one_letter_code_can ;MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR IFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCNFIETHYLNEQVKAIKELGDHVTNLRKMG APESGLAEYLFDKHTLGDSDNES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 'MAGNESIUM ION' MG 4 'CHLORIDE ION' CL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 THR n 1 4 ALA n 1 5 SER n 1 6 THR n 1 7 SER n 1 8 GLN n 1 9 VAL n 1 10 ARG n 1 11 GLN n 1 12 ASN n 1 13 TYR n 1 14 HIS n 1 15 GLN n 1 16 ASP n 1 17 SER n 1 18 GLU n 1 19 ALA n 1 20 ALA n 1 21 ILE n 1 22 ASN n 1 23 ARG n 1 24 GLN n 1 25 ILE n 1 26 ASN n 1 27 LEU n 1 28 GLU n 1 29 LEU n 1 30 TYR n 1 31 ALA n 1 32 SER n 1 33 TYR n 1 34 VAL n 1 35 TYR n 1 36 LEU n 1 37 SER n 1 38 MET n 1 39 SER n 1 40 TYR n 1 41 TYR n 1 42 PHE n 1 43 ASP n 1 44 ARG n 1 45 ASP n 1 46 ASP n 1 47 VAL n 1 48 ALA n 1 49 LEU n 1 50 LYS n 1 51 ASN n 1 52 PHE n 1 53 ALA n 1 54 LYS n 1 55 TYR n 1 56 PHE n 1 57 LEU n 1 58 HIS n 1 59 GLN n 1 60 SER n 1 61 HIS n 1 62 GLU n 1 63 GLU n 1 64 ARG n 1 65 GLU n 1 66 HIS n 1 67 ALA n 1 68 GLU n 1 69 LYS n 1 70 LEU n 1 71 MET n 1 72 LYS n 1 73 LEU n 1 74 GLN n 1 75 ASN n 1 76 GLN n 1 77 ARG n 1 78 GLY n 1 79 GLY n 1 80 ARG n 1 81 ILE n 1 82 PHE n 1 83 LEU n 1 84 GLN n 1 85 ASP n 1 86 ILE n 1 87 LYS n 1 88 LYS n 1 89 PRO n 1 90 ASP n 1 91 CYS n 1 92 ASP n 1 93 ASP n 1 94 TRP n 1 95 GLU n 1 96 SER n 1 97 GLY n 1 98 LEU n 1 99 ASN n 1 100 ALA n 1 101 MET n 1 102 GLU n 1 103 CYS n 1 104 ALA n 1 105 LEU n 1 106 HIS n 1 107 LEU n 1 108 GLU n 1 109 LYS n 1 110 ASN n 1 111 VAL n 1 112 ASN n 1 113 GLN n 1 114 SER n 1 115 LEU n 1 116 LEU n 1 117 GLU n 1 118 LEU n 1 119 HIS n 1 120 LYS n 1 121 LEU n 1 122 ALA n 1 123 THR n 1 124 ASP n 1 125 LYS n 1 126 ASN n 1 127 ASP n 1 128 PRO n 1 129 HIS n 1 130 LEU n 1 131 CYS n 1 132 ASN n 1 133 PHE n 1 134 ILE n 1 135 GLU n 1 136 THR n 1 137 HIS n 1 138 TYR n 1 139 LEU n 1 140 ASN n 1 141 GLU n 1 142 GLN n 1 143 VAL n 1 144 LYS n 1 145 ALA n 1 146 ILE n 1 147 LYS n 1 148 GLU n 1 149 LEU n 1 150 GLY n 1 151 ASP n 1 152 HIS n 1 153 VAL n 1 154 THR n 1 155 ASN n 1 156 LEU n 1 157 ARG n 1 158 LYS n 1 159 MET n 1 160 GLY n 1 161 ALA n 1 162 PRO n 1 163 GLU n 1 164 SER n 1 165 GLY n 1 166 LEU n 1 167 ALA n 1 168 GLU n 1 169 TYR n 1 170 LEU n 1 171 PHE n 1 172 ASP n 1 173 LYS n 1 174 HIS n 1 175 THR n 1 176 LEU n 1 177 GLY n 1 178 ASP n 1 179 SER n 1 180 ASP n 1 181 ASN n 1 182 GLU n 1 183 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 183 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 THR 2 1 ? ? ? A . n A 1 3 THR 3 2 ? ? ? A . n A 1 4 ALA 4 3 3 ALA ALA A . n A 1 5 SER 5 4 4 SER SER A . n A 1 6 THR 6 5 5 THR THR A . n A 1 7 SER 7 6 6 SER SER A . n A 1 8 GLN 8 7 7 GLN GLN A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 ARG 10 9 9 ARG ARG A . n A 1 11 GLN 11 10 10 GLN GLN A . n A 1 12 ASN 12 11 11 ASN ASN A . n A 1 13 TYR 13 12 12 TYR TYR A . n A 1 14 HIS 14 13 13 HIS HIS A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 ASP 16 15 15 ASP ASP A . n A 1 17 SER 17 16 16 SER SER A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 ALA 19 18 18 ALA ALA A . n A 1 20 ALA 20 19 19 ALA ALA A . n A 1 21 ILE 21 20 20 ILE ILE A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 ARG 23 22 22 ARG ARG A . n A 1 24 GLN 24 23 23 GLN GLN A . n A 1 25 ILE 25 24 24 ILE ILE A . n A 1 26 ASN 26 25 25 ASN ASN A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 TYR 30 29 29 TYR TYR A . n A 1 31 ALA 31 30 30 ALA ALA A . n A 1 32 SER 32 31 31 SER SER A . n A 1 33 TYR 33 32 32 TYR TYR A . n A 1 34 VAL 34 33 33 VAL VAL A . n A 1 35 TYR 35 34 34 TYR TYR A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 SER 37 36 36 SER SER A . n A 1 38 MET 38 37 37 MET MET A . n A 1 39 SER 39 38 38 SER SER A . n A 1 40 TYR 40 39 39 TYR TYR A . n A 1 41 TYR 41 40 40 TYR TYR A . n A 1 42 PHE 42 41 41 PHE PHE A . n A 1 43 ASP 43 42 42 ASP ASP A . n A 1 44 ARG 44 43 43 ARG ARG A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ASP 46 45 45 ASP ASP A . n A 1 47 VAL 47 46 46 VAL VAL A . n A 1 48 ALA 48 47 47 ALA ALA A . n A 1 49 LEU 49 48 48 LEU LEU A . n A 1 50 LYS 50 49 49 LYS LYS A . n A 1 51 ASN 51 50 50 ASN ASN A . n A 1 52 PHE 52 51 51 PHE PHE A . n A 1 53 ALA 53 52 52 ALA ALA A . n A 1 54 LYS 54 53 53 LYS LYS A . n A 1 55 TYR 55 54 54 TYR TYR A . n A 1 56 PHE 56 55 55 PHE PHE A . n A 1 57 LEU 57 56 56 LEU LEU A . n A 1 58 HIS 58 57 57 HIS HIS A . n A 1 59 GLN 59 58 58 GLN GLN A . n A 1 60 SER 60 59 59 SER SER A . n A 1 61 HIS 61 60 60 HIS HIS A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 GLU 63 62 62 GLU GLU A . n A 1 64 ARG 64 63 63 ARG ARG A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 HIS 66 65 65 HIS HIS A . n A 1 67 ALA 67 66 66 ALA ALA A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 LYS 69 68 68 LYS LYS A . n A 1 70 LEU 70 69 69 LEU LEU A . n A 1 71 MET 71 70 70 MET MET A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 GLN 74 73 73 GLN GLN A . n A 1 75 ASN 75 74 74 ASN ASN A . n A 1 76 GLN 76 75 75 GLN GLN A . n A 1 77 ARG 77 76 76 ARG ARG A . n A 1 78 GLY 78 77 77 GLY GLY A . n A 1 79 GLY 79 78 78 GLY GLY A . n A 1 80 ARG 80 79 79 ARG ARG A . n A 1 81 ILE 81 80 80 ILE ILE A . n A 1 82 PHE 82 81 81 PHE PHE A . n A 1 83 LEU 83 82 82 LEU LEU A . n A 1 84 GLN 84 83 83 GLN GLN A . n A 1 85 ASP 85 84 84 ASP ASP A . n A 1 86 ILE 86 85 85 ILE ILE A . n A 1 87 LYS 87 86 86 LYS LYS A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 PRO 89 88 88 PRO PRO A . n A 1 90 ASP 90 89 89 ASP ASP A . n A 1 91 CYS 91 90 90 CYS CYS A . n A 1 92 ASP 92 91 91 ASP ASP A . n A 1 93 ASP 93 92 92 ASP ASP A . n A 1 94 TRP 94 93 93 TRP TRP A . n A 1 95 GLU 95 94 94 GLU GLU A . n A 1 96 SER 96 95 95 SER SER A . n A 1 97 GLY 97 96 96 GLY GLY A . n A 1 98 LEU 98 97 97 LEU LEU A . n A 1 99 ASN 99 98 98 ASN ASN A . n A 1 100 ALA 100 99 99 ALA ALA A . n A 1 101 MET 101 100 100 MET MET A . n A 1 102 GLU 102 101 101 GLU GLU A . n A 1 103 CYS 103 102 102 CYS CYS A . n A 1 104 ALA 104 103 103 ALA ALA A . n A 1 105 LEU 105 104 104 LEU LEU A . n A 1 106 HIS 106 105 105 HIS HIS A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 LYS 109 108 108 LYS LYS A . n A 1 110 ASN 110 109 109 ASN ASN A . n A 1 111 VAL 111 110 110 VAL VAL A . n A 1 112 ASN 112 111 111 ASN ASN A . n A 1 113 GLN 113 112 112 GLN GLN A . n A 1 114 SER 114 113 113 SER SER A . n A 1 115 LEU 115 114 114 LEU LEU A . n A 1 116 LEU 116 115 115 LEU LEU A . n A 1 117 GLU 117 116 116 GLU GLU A . n A 1 118 LEU 118 117 117 LEU LEU A . n A 1 119 HIS 119 118 118 HIS HIS A . n A 1 120 LYS 120 119 119 LYS LYS A . n A 1 121 LEU 121 120 120 LEU LEU A . n A 1 122 ALA 122 121 121 ALA ALA A . n A 1 123 THR 123 122 122 THR THR A . n A 1 124 ASP 124 123 123 ASP ASP A . n A 1 125 LYS 125 124 124 LYS LYS A . n A 1 126 ASN 126 125 125 ASN ASN A . n A 1 127 ASP 127 126 126 ASP ASP A . n A 1 128 PRO 128 127 127 PRO PRO A . n A 1 129 HIS 129 128 128 HIS HIS A . n A 1 130 LEU 130 129 129 LEU LEU A . n A 1 131 CYS 131 130 130 CYS CYS A . n A 1 132 ASN 132 131 131 ASN ASN A . n A 1 133 PHE 133 132 132 PHE PHE A . n A 1 134 ILE 134 133 133 ILE ILE A . n A 1 135 GLU 135 134 134 GLU GLU A . n A 1 136 THR 136 135 135 THR THR A . n A 1 137 HIS 137 136 136 HIS HIS A . n A 1 138 TYR 138 137 137 TYR TYR A . n A 1 139 LEU 139 138 138 LEU LEU A . n A 1 140 ASN 140 139 139 ASN ASN A . n A 1 141 GLU 141 140 140 GLU GLU A . n A 1 142 GLN 142 141 141 GLN GLN A . n A 1 143 VAL 143 142 142 VAL VAL A . n A 1 144 LYS 144 143 143 LYS LYS A . n A 1 145 ALA 145 144 144 ALA ALA A . n A 1 146 ILE 146 145 145 ILE ILE A . n A 1 147 LYS 147 146 146 LYS LYS A . n A 1 148 GLU 148 147 147 GLU GLU A . n A 1 149 LEU 149 148 148 LEU LEU A . n A 1 150 GLY 150 149 149 GLY GLY A . n A 1 151 ASP 151 150 150 ASP ASP A . n A 1 152 HIS 152 151 151 HIS HIS A . n A 1 153 VAL 153 152 152 VAL VAL A . n A 1 154 THR 154 153 153 THR THR A . n A 1 155 ASN 155 154 154 ASN ASN A . n A 1 156 LEU 156 155 155 LEU LEU A . n A 1 157 ARG 157 156 156 ARG ARG A . n A 1 158 LYS 158 157 157 LYS LYS A . n A 1 159 MET 159 158 158 MET MET A . n A 1 160 GLY 160 159 159 GLY GLY A . n A 1 161 ALA 161 160 160 ALA ALA A . n A 1 162 PRO 162 161 161 PRO PRO A . n A 1 163 GLU 163 162 162 GLU GLU A . n A 1 164 SER 164 163 163 SER SER A . n A 1 165 GLY 165 164 164 GLY GLY A . n A 1 166 LEU 166 165 165 LEU LEU A . n A 1 167 ALA 167 166 166 ALA ALA A . n A 1 168 GLU 168 167 167 GLU GLU A . n A 1 169 TYR 169 168 168 TYR TYR A . n A 1 170 LEU 170 169 169 LEU LEU A . n A 1 171 PHE 171 170 170 PHE PHE A . n A 1 172 ASP 172 171 171 ASP ASP A . n A 1 173 LYS 173 172 172 LYS LYS A . n A 1 174 HIS 174 173 173 HIS HIS A . n A 1 175 THR 175 174 174 THR THR A . n A 1 176 LEU 176 175 175 LEU LEU A . n A 1 177 GLY 177 176 176 GLY GLY A . n A 1 178 ASP 178 177 ? ? ? A . n A 1 179 SER 179 178 ? ? ? A . n A 1 180 ASP 180 179 ? ? ? A . n A 1 181 ASN 181 180 ? ? ? A . n A 1 182 GLU 182 181 ? ? ? A . n A 1 183 SER 183 182 ? ? ? A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? 2 FE ? ? FE ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 201 1 FE FE A . C 2 FE 1 202 2 FE FE A . D 2 FE 1 203 3 FE FE A . E 3 MG 1 204 2 MG MG A . F 3 MG 1 205 3 MG MG A . G 3 MG 1 206 4 MG MG A . H 3 MG 1 207 5 MG MG A . I 4 CL 1 208 1 CL CL A . J 4 CL 1 209 2 CL CL A . K 4 CL 1 210 3 CL CL A . L 4 CL 1 211 4 CL CL A . M 5 HOH 1 301 271 HOH HOH A . M 5 HOH 2 302 279 HOH HOH A . M 5 HOH 3 303 197 HOH HOH A . M 5 HOH 4 304 219 HOH HOH A . M 5 HOH 5 305 273 HOH HOH A . M 5 HOH 6 306 252 HOH HOH A . M 5 HOH 7 307 249 HOH HOH A . M 5 HOH 8 308 215 HOH HOH A . M 5 HOH 9 309 259 HOH HOH A . M 5 HOH 10 310 207 HOH HOH A . M 5 HOH 11 311 218 HOH HOH A . M 5 HOH 12 312 155 HOH HOH A . M 5 HOH 13 313 192 HOH HOH A . M 5 HOH 14 314 210 HOH HOH A . M 5 HOH 15 315 278 HOH HOH A . M 5 HOH 16 316 268 HOH HOH A . M 5 HOH 17 317 149 HOH HOH A . M 5 HOH 18 318 115 HOH HOH A . M 5 HOH 19 319 223 HOH HOH A . M 5 HOH 20 320 8 HOH HOH A . M 5 HOH 21 321 82 HOH HOH A . M 5 HOH 22 322 224 HOH HOH A . M 5 HOH 23 323 276 HOH HOH A . M 5 HOH 24 324 157 HOH HOH A . M 5 HOH 25 325 188 HOH HOH A . M 5 HOH 26 326 203 HOH HOH A . M 5 HOH 27 327 70 HOH HOH A . M 5 HOH 28 328 108 HOH HOH A . M 5 HOH 29 329 97 HOH HOH A . M 5 HOH 30 330 51 HOH HOH A . M 5 HOH 31 331 233 HOH HOH A . M 5 HOH 32 332 35 HOH HOH A . M 5 HOH 33 333 18 HOH HOH A . M 5 HOH 34 334 143 HOH HOH A . M 5 HOH 35 335 242 HOH HOH A . M 5 HOH 36 336 174 HOH HOH A . M 5 HOH 37 337 3 HOH HOH A . M 5 HOH 38 338 22 HOH HOH A . M 5 HOH 39 339 23 HOH HOH A . M 5 HOH 40 340 7 HOH HOH A . M 5 HOH 41 341 17 HOH HOH A . M 5 HOH 42 342 132 HOH HOH A . M 5 HOH 43 343 34 HOH HOH A . M 5 HOH 44 344 1 HOH HOH A . M 5 HOH 45 345 81 HOH HOH A . M 5 HOH 46 346 55 HOH HOH A . M 5 HOH 47 347 65 HOH HOH A . M 5 HOH 48 348 33 HOH HOH A . M 5 HOH 49 349 226 HOH HOH A . M 5 HOH 50 350 52 HOH HOH A . M 5 HOH 51 351 269 HOH HOH A . M 5 HOH 52 352 208 HOH HOH A . M 5 HOH 53 353 121 HOH HOH A . M 5 HOH 54 354 42 HOH HOH A . M 5 HOH 55 355 146 HOH HOH A . M 5 HOH 56 356 275 HOH HOH A . M 5 HOH 57 357 14 HOH HOH A . M 5 HOH 58 358 71 HOH HOH A . M 5 HOH 59 359 160 HOH HOH A . M 5 HOH 60 360 62 HOH HOH A . M 5 HOH 61 361 122 HOH HOH A . M 5 HOH 62 362 216 HOH HOH A . M 5 HOH 63 363 61 HOH HOH A . M 5 HOH 64 364 156 HOH HOH A . M 5 HOH 65 365 94 HOH HOH A . M 5 HOH 66 366 39 HOH HOH A . M 5 HOH 67 367 74 HOH HOH A . M 5 HOH 68 368 26 HOH HOH A . M 5 HOH 69 369 20 HOH HOH A . M 5 HOH 70 370 6 HOH HOH A . M 5 HOH 71 371 212 HOH HOH A . M 5 HOH 72 372 11 HOH HOH A . M 5 HOH 73 373 91 HOH HOH A . M 5 HOH 74 374 99 HOH HOH A . M 5 HOH 75 375 75 HOH HOH A . M 5 HOH 76 376 105 HOH HOH A . M 5 HOH 77 377 30 HOH HOH A . M 5 HOH 78 378 36 HOH HOH A . M 5 HOH 79 379 73 HOH HOH A . M 5 HOH 80 380 102 HOH HOH A . M 5 HOH 81 381 80 HOH HOH A . M 5 HOH 82 382 79 HOH HOH A . M 5 HOH 83 383 253 HOH HOH A . M 5 HOH 84 384 5 HOH HOH A . M 5 HOH 85 385 32 HOH HOH A . M 5 HOH 86 386 151 HOH HOH A . M 5 HOH 87 387 2 HOH HOH A . M 5 HOH 88 388 214 HOH HOH A . M 5 HOH 89 389 78 HOH HOH A . M 5 HOH 90 390 31 HOH HOH A . M 5 HOH 91 391 93 HOH HOH A . M 5 HOH 92 392 38 HOH HOH A . M 5 HOH 93 393 186 HOH HOH A . M 5 HOH 94 394 109 HOH HOH A . M 5 HOH 95 395 84 HOH HOH A . M 5 HOH 96 396 89 HOH HOH A . M 5 HOH 97 397 118 HOH HOH A . M 5 HOH 98 398 92 HOH HOH A . M 5 HOH 99 399 12 HOH HOH A . M 5 HOH 100 400 19 HOH HOH A . M 5 HOH 101 401 195 HOH HOH A . M 5 HOH 102 402 50 HOH HOH A . M 5 HOH 103 403 25 HOH HOH A . M 5 HOH 104 404 141 HOH HOH A . M 5 HOH 105 405 9 HOH HOH A . M 5 HOH 106 406 4 HOH HOH A . M 5 HOH 107 407 265 HOH HOH A . M 5 HOH 108 408 144 HOH HOH A . M 5 HOH 109 409 129 HOH HOH A . M 5 HOH 110 410 162 HOH HOH A . M 5 HOH 111 411 135 HOH HOH A . M 5 HOH 112 412 66 HOH HOH A . M 5 HOH 113 413 193 HOH HOH A . M 5 HOH 114 414 58 HOH HOH A . M 5 HOH 115 415 15 HOH HOH A . M 5 HOH 116 416 86 HOH HOH A . M 5 HOH 117 417 47 HOH HOH A . M 5 HOH 118 418 54 HOH HOH A . M 5 HOH 119 419 123 HOH HOH A . M 5 HOH 120 420 110 HOH HOH A . M 5 HOH 121 421 251 HOH HOH A . M 5 HOH 122 422 57 HOH HOH A . M 5 HOH 123 423 245 HOH HOH A . M 5 HOH 124 424 126 HOH HOH A . M 5 HOH 125 425 131 HOH HOH A . M 5 HOH 126 426 272 HOH HOH A . M 5 HOH 127 427 248 HOH HOH A . M 5 HOH 128 428 112 HOH HOH A . M 5 HOH 129 429 152 HOH HOH A . M 5 HOH 130 430 83 HOH HOH A . M 5 HOH 131 431 46 HOH HOH A . M 5 HOH 132 432 63 HOH HOH A . M 5 HOH 133 433 222 HOH HOH A . M 5 HOH 134 434 40 HOH HOH A . M 5 HOH 135 435 49 HOH HOH A . M 5 HOH 136 436 198 HOH HOH A . M 5 HOH 137 437 119 HOH HOH A . M 5 HOH 138 438 125 HOH HOH A . M 5 HOH 139 439 190 HOH HOH A . M 5 HOH 140 440 124 HOH HOH A . M 5 HOH 141 441 16 HOH HOH A . M 5 HOH 142 442 67 HOH HOH A . M 5 HOH 143 443 247 HOH HOH A . M 5 HOH 144 444 238 HOH HOH A . M 5 HOH 145 445 133 HOH HOH A . M 5 HOH 146 446 147 HOH HOH A . M 5 HOH 147 447 44 HOH HOH A . M 5 HOH 148 448 153 HOH HOH A . M 5 HOH 149 449 106 HOH HOH A . M 5 HOH 150 450 217 HOH HOH A . M 5 HOH 151 451 101 HOH HOH A . M 5 HOH 152 452 204 HOH HOH A . M 5 HOH 153 453 103 HOH HOH A . M 5 HOH 154 454 227 HOH HOH A . M 5 HOH 155 455 28 HOH HOH A . M 5 HOH 156 456 258 HOH HOH A . M 5 HOH 157 457 136 HOH HOH A . M 5 HOH 158 458 43 HOH HOH A . M 5 HOH 159 459 138 HOH HOH A . M 5 HOH 160 460 48 HOH HOH A . M 5 HOH 161 461 167 HOH HOH A . M 5 HOH 162 462 64 HOH HOH A . M 5 HOH 163 463 113 HOH HOH A . M 5 HOH 164 464 171 HOH HOH A . M 5 HOH 165 465 87 HOH HOH A . M 5 HOH 166 466 76 HOH HOH A . M 5 HOH 167 467 201 HOH HOH A . M 5 HOH 168 468 241 HOH HOH A . M 5 HOH 169 469 274 HOH HOH A . M 5 HOH 170 470 254 HOH HOH A . M 5 HOH 171 471 231 HOH HOH A . M 5 HOH 172 472 263 HOH HOH A . M 5 HOH 173 473 211 HOH HOH A . M 5 HOH 174 474 172 HOH HOH A . M 5 HOH 175 475 182 HOH HOH A . M 5 HOH 176 476 116 HOH HOH A . M 5 HOH 177 477 220 HOH HOH A . M 5 HOH 178 478 185 HOH HOH A . M 5 HOH 179 479 173 HOH HOH A . M 5 HOH 180 480 134 HOH HOH A . M 5 HOH 181 481 202 HOH HOH A . M 5 HOH 182 482 161 HOH HOH A . M 5 HOH 183 483 120 HOH HOH A . M 5 HOH 184 484 107 HOH HOH A . M 5 HOH 185 485 69 HOH HOH A . M 5 HOH 186 486 45 HOH HOH A . M 5 HOH 187 487 169 HOH HOH A . M 5 HOH 188 488 168 HOH HOH A . M 5 HOH 189 489 255 HOH HOH A . M 5 HOH 190 490 159 HOH HOH A . M 5 HOH 191 491 175 HOH HOH A . M 5 HOH 192 492 199 HOH HOH A . M 5 HOH 193 493 88 HOH HOH A . M 5 HOH 194 494 234 HOH HOH A . M 5 HOH 195 495 59 HOH HOH A . M 5 HOH 196 496 140 HOH HOH A . M 5 HOH 197 497 95 HOH HOH A . M 5 HOH 198 498 196 HOH HOH A . M 5 HOH 199 499 239 HOH HOH A . M 5 HOH 200 500 85 HOH HOH A . M 5 HOH 201 501 261 HOH HOH A . M 5 HOH 202 502 154 HOH HOH A . M 5 HOH 203 503 142 HOH HOH A . M 5 HOH 204 504 163 HOH HOH A . M 5 HOH 205 505 100 HOH HOH A . M 5 HOH 206 506 232 HOH HOH A . M 5 HOH 207 507 221 HOH HOH A . M 5 HOH 208 508 77 HOH HOH A . M 5 HOH 209 509 72 HOH HOH A . M 5 HOH 210 510 170 HOH HOH A . M 5 HOH 211 511 225 HOH HOH A . M 5 HOH 212 512 24 HOH HOH A . M 5 HOH 213 513 164 HOH HOH A . M 5 HOH 214 514 166 HOH HOH A . M 5 HOH 215 515 177 HOH HOH A . M 5 HOH 216 516 209 HOH HOH A . M 5 HOH 217 517 37 HOH HOH A . M 5 HOH 218 518 21 HOH HOH A . M 5 HOH 219 519 10 HOH HOH A . M 5 HOH 220 520 150 HOH HOH A . M 5 HOH 221 521 128 HOH HOH A . M 5 HOH 222 522 235 HOH HOH A . M 5 HOH 223 523 53 HOH HOH A . M 5 HOH 224 524 205 HOH HOH A . M 5 HOH 225 525 179 HOH HOH A . M 5 HOH 226 526 98 HOH HOH A . M 5 HOH 227 527 206 HOH HOH A . M 5 HOH 228 528 29 HOH HOH A . M 5 HOH 229 529 260 HOH HOH A . M 5 HOH 230 530 277 HOH HOH A . M 5 HOH 231 531 240 HOH HOH A . M 5 HOH 232 532 187 HOH HOH A . M 5 HOH 233 533 96 HOH HOH A . M 5 HOH 234 534 264 HOH HOH A . M 5 HOH 235 535 181 HOH HOH A . M 5 HOH 236 536 104 HOH HOH A . M 5 HOH 237 537 246 HOH HOH A . M 5 HOH 238 538 270 HOH HOH A . M 5 HOH 239 539 230 HOH HOH A . M 5 HOH 240 540 228 HOH HOH A . M 5 HOH 241 541 191 HOH HOH A . M 5 HOH 242 542 90 HOH HOH A . M 5 HOH 243 543 139 HOH HOH A . M 5 HOH 244 544 237 HOH HOH A . M 5 HOH 245 545 262 HOH HOH A . M 5 HOH 246 546 148 HOH HOH A . M 5 HOH 247 547 183 HOH HOH A . M 5 HOH 248 548 244 HOH HOH A . M 5 HOH 249 549 236 HOH HOH A . M 5 HOH 250 550 256 HOH HOH A . M 5 HOH 251 551 111 HOH HOH A . M 5 HOH 252 552 137 HOH HOH A . M 5 HOH 253 553 41 HOH HOH A . M 5 HOH 254 554 200 HOH HOH A . M 5 HOH 255 555 60 HOH HOH A . M 5 HOH 256 556 178 HOH HOH A . M 5 HOH 257 557 27 HOH HOH A . M 5 HOH 258 558 158 HOH HOH A . M 5 HOH 259 559 130 HOH HOH A . M 5 HOH 260 560 176 HOH HOH A . M 5 HOH 261 561 165 HOH HOH A . M 5 HOH 262 562 114 HOH HOH A . M 5 HOH 263 563 213 HOH HOH A . M 5 HOH 264 564 127 HOH HOH A . M 5 HOH 265 565 257 HOH HOH A . M 5 HOH 266 566 194 HOH HOH A . M 5 HOH 267 567 117 HOH HOH A . M 5 HOH 268 568 68 HOH HOH A . M 5 HOH 269 569 184 HOH HOH A . M 5 HOH 270 570 180 HOH HOH A . M 5 HOH 271 571 189 HOH HOH A . M 5 HOH 272 572 229 HOH HOH A . M 5 HOH 273 573 243 HOH HOH A . M 5 HOH 274 574 145 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9I19 _cell.details ? _cell.formula_units_Z ? _cell.length_a 183.087 _cell.length_a_esd ? _cell.length_b 183.087 _cell.length_b_esd ? _cell.length_c 183.087 _cell.length_c_esd ? _cell.volume 6137231.785 _cell.volume_esd ? _cell.Z_PDB 96 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9I19 _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall 'F 4 2 3' _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9I19 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.1 M Bicine 2 M Magnesium chloride 0.1 M Sodium chloride 60 mM Ferrous chloride 3 mM Sodium chloride ; _exptl_crystal_grow.pdbx_pH_range 8.9-9.1 _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-04-15 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.975 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.975 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 18.24 _reflns.entry_id 9I19 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.63 _reflns.d_resolution_low 55.20 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 3051139 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.24 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 132 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 29.19 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.63 _reflns_shell.d_res_low 1.69 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 32092 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.452 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 20.20 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9I19 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.63 _refine.ls_d_res_low 55.20 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 59006 _refine.ls_number_reflns_R_free 2996 _refine.ls_number_reflns_R_work 56010 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.38 _refine.ls_percent_reflns_R_free 5.08 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1652 _refine.ls_R_factor_R_free 0.1922 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1638 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.4681 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1926 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.63 _refine_hist.d_res_low 55.20 _refine_hist.number_atoms_solvent 274 _refine_hist.number_atoms_total 1709 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1424 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0061 ? 1453 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8164 ? 1957 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0464 ? 206 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0061 ? 258 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 4.8000 ? 189 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.63 1.66 . . 104 1859 65.76 . . . . 0.3350 . . . . . . . . . . . 0.4132 'X-RAY DIFFRACTION' 1.66 1.69 . . 115 2239 80.53 . . . . 0.3142 . . . . . . . . . . . 0.3471 'X-RAY DIFFRACTION' 1.69 1.72 . . 118 2379 85.75 . . . . 0.2708 . . . . . . . . . . . 0.2495 'X-RAY DIFFRACTION' 1.72 1.75 . . 160 2519 89.72 . . . . 0.2446 . . . . . . . . . . . 0.2876 'X-RAY DIFFRACTION' 1.75 1.79 . . 111 2574 92.02 . . . . 0.2092 . . . . . . . . . . . 0.2417 'X-RAY DIFFRACTION' 1.79 1.82 . . 133 2659 94.36 . . . . 0.1889 . . . . . . . . . . . 0.2248 'X-RAY DIFFRACTION' 1.82 1.87 . . 148 2702 96.74 . . . . 0.1759 . . . . . . . . . . . 0.2113 'X-RAY DIFFRACTION' 1.87 1.91 . . 139 2783 98.72 . . . . 0.1756 . . . . . . . . . . . 0.2019 'X-RAY DIFFRACTION' 1.91 1.97 . . 163 2735 99.86 . . . . 0.1597 . . . . . . . . . . . 0.1872 'X-RAY DIFFRACTION' 1.97 2.02 . . 159 2807 100.00 . . . . 0.1610 . . . . . . . . . . . 0.2047 'X-RAY DIFFRACTION' 2.02 2.09 . . 114 2837 100.00 . . . . 0.1556 . . . . . . . . . . . 0.2015 'X-RAY DIFFRACTION' 2.09 2.16 . . 163 2747 100.00 . . . . 0.1491 . . . . . . . . . . . 0.1846 'X-RAY DIFFRACTION' 2.16 2.25 . . 153 2801 100.00 . . . . 0.1501 . . . . . . . . . . . 0.1852 'X-RAY DIFFRACTION' 2.25 2.35 . . 136 2800 99.93 . . . . 0.1481 . . . . . . . . . . . 0.2067 'X-RAY DIFFRACTION' 2.35 2.48 . . 141 2795 100.00 . . . . 0.1622 . . . . . . . . . . . 0.1799 'X-RAY DIFFRACTION' 2.48 2.63 . . 174 2778 100.00 . . . . 0.1694 . . . . . . . . . . . 0.2255 'X-RAY DIFFRACTION' 2.63 2.83 . . 150 2791 100.00 . . . . 0.1610 . . . . . . . . . . . 0.1824 'X-RAY DIFFRACTION' 2.83 3.12 . . 143 2795 100.00 . . . . 0.1505 . . . . . . . . . . . 0.1533 'X-RAY DIFFRACTION' 3.12 3.57 . . 191 2765 100.00 . . . . 0.1402 . . . . . . . . . . . 0.1582 'X-RAY DIFFRACTION' 3.57 4.50 . . 124 2825 100.00 . . . . 0.1321 . . . . . . . . . . . 0.1892 'X-RAY DIFFRACTION' 4.50 55.20 . . 157 2820 99.87 . . . . 0.1758 . . . . . . . . . . . 0.1683 # _struct.entry_id 9I19 _struct.title 'Iron loaded human H-chain ferritin D131N mutant 5 minute oxygen soak' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9I19 _struct_keywords.text 'Iron, ferritin, H-chain, human, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 4 ? J N N 4 ? K N N 4 ? L N N 4 ? M N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FRIH_HUMAN _struct_ref.pdbx_db_accession P02794 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGR IFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMG APESGLAEYLFDKHTLGDSDNES ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9I19 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02794 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 182 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9I19 _struct_ref_seq_dif.mon_id ASN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 132 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P02794 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 132 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 131 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F,G,H,I,J,K,L,M 1 2 A,B,C,D,E,F,G,H,I,J,K,L,M 1 3 A,B,C,D,E,F,G,H,I,J,K,L,M 1 4 A,B,C,D,E,F,G,H,I,J,K,L,M 1 5 A,B,C,D,E,F,G,H,I,J,K,L,M 1 6 A,B,C,D,E,F,G,H,I,J,K,L,M 1 7 A,B,C,D,E,F,G,H,I,J,K,L,M 1 8 A,B,C,D,E,F,G,H,I,J,K,L,M 1 9 A,B,C,D,E,F,G,H,I,J,K,L,M 1 10 A,B,C,D,E,F,G,H,I,J,K,L,M 1 11 A,B,C,D,E,F,G,H,I,J,K,L,M 1 12 A,B,C,D,E,F,G,H,I,J,K,L,M 1 13 A,B,C,D,E,F,G,H,I,J,K,L,M 1 14 A,B,C,D,E,F,G,H,I,J,K,L,M 1 15 A,B,C,D,E,F,G,H,I,J,K,L,M 1 16 A,B,C,D,E,F,G,H,I,J,K,L,M 1 17 A,B,C,D,E,F,G,H,I,J,K,L,M 1 18 A,B,C,D,E,F,G,H,I,J,K,L,M 1 19 A,B,C,D,E,F,G,H,I,J,K,L,M 1 20 A,B,C,D,E,F,G,H,I,J,K,L,M 1 21 A,B,C,D,E,F,G,H,I,J,K,L,M 1 22 A,B,C,D,E,F,G,H,I,J,K,L,M 1 23 A,B,C,D,E,F,G,H,I,J,K,L,M 1 24 A,B,C,D,E,F,G,H,I,J,K,L,M # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0 0.0 0.0 0.0 0.0 1.0 0.0 0.0 0.0 0.0 1.0 0.0 2 'point symmetry operation' ? ? 0.0 -1.0 0.0 91.543 -1.0 0.0 0.0 91.543 0.0 0.0 -1.0 0.0 3 'point symmetry operation' ? ? 0.0 0.0 1.0 0.0 0.0 1.0 0.0 0.0 -1.0 0.0 0.0 0.0 4 'point symmetry operation' ? ? 0.0 0.0 -1.0 0.0 -1.0 0.0 0.0 91.543 0.0 1.0 0.0 -91.543 5 'point symmetry operation' ? ? 0.0 0.0 -1.0 0.0 0.0 1.0 0.0 0.0 1.0 0.0 0.0 0.0 6 'point symmetry operation' ? ? 0.0 0.0 1.0 0.0 -1.0 0.0 0.0 91.543 0.0 -1.0 0.0 91.543 7 'point symmetry operation' ? ? 1.0 0.0 0.0 0.0 0.0 0.0 1.0 91.543 0.0 -1.0 0.0 91.543 8 'point symmetry operation' ? ? 0.0 -1.0 0.0 91.543 0.0 0.0 -1.0 91.543 1.0 0.0 0.0 0.0 9 'point symmetry operation' ? ? 1.0 0.0 0.0 0.0 0.0 0.0 -1.0 91.543 0.0 1.0 0.0 -91.543 10 'point symmetry operation' ? ? 0.0 -1.0 0.0 91.543 0.0 0.0 1.0 91.543 -1.0 0.0 0.0 0.0 11 'point symmetry operation' ? ? -1.0 0.0 0.0 0.0 0.0 1.0 0.0 0.0 0.0 0.0 -1.0 0.0 12 'point symmetry operation' ? ? 0.0 1.0 0.0 -91.543 -1.0 0.0 0.0 91.543 0.0 0.0 1.0 0.0 13 'point symmetry operation' ? ? -1.0 0.0 0.0 0.0 0.0 0.0 1.0 91.543 0.0 1.0 0.0 -91.543 14 'point symmetry operation' ? ? 0.0 1.0 0.0 -91.543 0.0 0.0 -1.0 91.543 -1.0 0.0 0.0 0.0 15 'point symmetry operation' ? ? -1.0 0.0 0.0 0.0 0.0 0.0 -1.0 91.543 0.0 -1.0 0.0 91.543 16 'point symmetry operation' ? ? 0.0 1.0 0.0 -91.543 0.0 0.0 1.0 91.543 1.0 0.0 0.0 0.0 17 'point symmetry operation' ? ? 0.0 0.0 1.0 0.0 0.0 -1.0 0.0 183.087 1.0 0.0 0.0 0.0 18 'point symmetry operation' ? ? 0.0 0.0 -1.0 0.0 1.0 0.0 0.0 91.543 0.0 -1.0 0.0 91.543 19 'point symmetry operation' ? ? 1.0 0.0 0.0 0.0 0.0 -1.0 0.0 183.087 0.0 0.0 -1.0 0.0 20 'point symmetry operation' ? ? 0.0 -1.0 0.0 91.543 1.0 0.0 0.0 91.543 0.0 0.0 1.0 0.0 21 'point symmetry operation' ? ? 0.0 0.0 -1.0 0.0 0.0 -1.0 0.0 183.087 -1.0 0.0 0.0 0.0 22 'point symmetry operation' ? ? 0.0 0.0 1.0 0.0 1.0 0.0 0.0 91.543 0.0 1.0 0.0 -91.543 23 'point symmetry operation' ? ? -1.0 0.0 0.0 0.0 0.0 -1.0 0.0 183.087 0.0 0.0 1.0 0.0 24 'point symmetry operation' ? ? 0.0 1.0 0.0 -91.543 1.0 0.0 0.0 91.543 0.0 0.0 -1.0 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 14 ? ASP A 43 ? HIS A 13 ASP A 42 1 ? 30 HELX_P HELX_P2 AA2 LEU A 49 ? GLY A 78 ? LEU A 48 GLY A 77 1 ? 30 HELX_P HELX_P3 AA3 SER A 96 ? LYS A 125 ? SER A 95 LYS A 124 1 ? 30 HELX_P HELX_P4 AA4 ASP A 127 ? TYR A 138 ? ASP A 126 TYR A 137 1 ? 12 HELX_P HELX_P5 AA5 TYR A 138 ? GLY A 160 ? TYR A 137 GLY A 159 1 ? 23 HELX_P HELX_P6 AA6 SER A 164 ? THR A 175 ? SER A 163 THR A 174 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 28 OE1 ? ? ? 1_555 C FE . FE ? ? A GLU 27 A FE 202 1_555 ? ? ? ? ? ? ? 2.041 ? ? metalc2 metalc ? ? A GLN 59 OE1 ? ? ? 1_555 H MG . MG ? ? A GLN 58 A MG 207 1_555 ? ? ? ? ? ? ? 2.128 ? ? metalc3 metalc ? ? A GLU 63 OE1 ? ? ? 1_555 C FE . FE ? ? A GLU 62 A FE 202 1_555 ? ? ? ? ? ? ? 2.036 ? ? metalc4 metalc ? ? A GLU 63 OE2 ? ? ? 1_555 D FE . FE ? ? A GLU 62 A FE 203 1_555 ? ? ? ? ? ? ? 1.930 ? ? metalc5 metalc ? ? A HIS 66 ND1 ? ? ? 1_555 C FE . FE ? ? A HIS 65 A FE 202 1_555 ? ? ? ? ? ? ? 2.192 ? ? metalc6 metalc ? ? A GLN 84 OE1 ? ? ? 1_555 G MG . MG ? ? A GLN 83 A MG 206 1_555 ? ? ? ? ? ? ? 2.566 ? ? metalc7 metalc ? ? A GLU 108 OE1 ? ? ? 1_555 D FE . FE ? ? A GLU 107 A FE 203 1_555 ? ? ? ? ? ? ? 2.026 ? ? metalc8 metalc ? ? A GLU 108 OE2 ? ? ? 1_555 D FE . FE ? ? A GLU 107 A FE 203 1_555 ? ? ? ? ? ? ? 2.243 ? ? metalc9 metalc ? ? A HIS 174 NE2 ? ? ? 1_555 B FE . FE ? ? A HIS 173 A FE 201 1_555 ? ? ? ? ? ? ? 2.195 ? ? metalc10 metalc ? ? A HIS 174 NE2 ? ? ? 1_555 B FE . FE ? ? A HIS 173 A FE 201 23_555 ? ? ? ? ? ? ? 2.228 ? ? metalc11 metalc ? ? B FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 201 A HOH 458 1_555 ? ? ? ? ? ? ? 2.133 ? ? metalc12 metalc ? ? B FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 201 A HOH 458 3_555 ? ? ? ? ? ? ? 2.133 ? ? metalc13 metalc ? ? C FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 202 A HOH 316 1_555 ? ? ? ? ? ? ? 2.003 ? ? metalc14 metalc ? ? C FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 202 A HOH 333 1_555 ? ? ? ? ? ? ? 2.144 ? ? metalc15 metalc ? ? C FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 202 A HOH 395 1_555 ? ? ? ? ? ? ? 2.426 ? ? metalc16 metalc ? ? D FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 203 A HOH 316 1_555 ? ? ? ? ? ? ? 1.898 ? ? metalc17 metalc ? ? D FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 203 A HOH 395 1_555 ? ? ? ? ? ? ? 2.281 ? ? metalc18 metalc ? ? D FE . FE ? ? ? 1_555 M HOH . O ? ? A FE 203 A HOH 446 1_555 ? ? ? ? ? ? ? 2.285 ? ? metalc19 metalc ? ? E MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 204 A HOH 320 1_555 ? ? ? ? ? ? ? 2.053 ? ? metalc20 metalc ? ? E MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 204 A HOH 320 13_555 ? ? ? ? ? ? ? 2.053 ? ? metalc21 metalc ? ? E MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 204 A HOH 341 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc22 metalc ? ? E MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 204 A HOH 341 13_555 ? ? ? ? ? ? ? 2.058 ? ? metalc23 metalc ? ? E MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 204 A HOH 518 86_555 ? ? ? ? ? ? ? 2.122 ? ? metalc24 metalc ? ? E MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 204 A HOH 538 74_555 ? ? ? ? ? ? ? 2.119 ? ? metalc25 metalc ? ? F MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 205 A HOH 360 84_555 ? ? ? ? ? ? ? 2.760 ? ? metalc26 metalc ? ? F MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 205 A HOH 420 1_555 ? ? ? ? ? ? ? 2.384 ? ? metalc27 metalc ? ? G MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 206 A HOH 518 74_555 ? ? ? ? ? ? ? 2.990 ? ? metalc28 metalc ? ? H MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 207 A HOH 301 1_555 ? ? ? ? ? ? ? 1.834 ? ? metalc29 metalc ? ? H MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 207 A HOH 331 1_555 ? ? ? ? ? ? ? 2.099 ? ? metalc30 metalc ? ? H MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 207 A HOH 345 1_555 ? ? ? ? ? ? ? 2.137 ? ? metalc31 metalc ? ? H MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 207 A HOH 351 1_555 ? ? ? ? ? ? ? 2.396 ? ? metalc32 metalc ? ? H MG . MG ? ? ? 1_555 M HOH . O ? ? A MG 207 A HOH 446 1_555 ? ? ? ? ? ? ? 2.144 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 28 ? A GLU 27 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 85.9 ? 2 OE1 ? A GLU 28 ? A GLU 27 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 106.8 ? 3 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 93.7 ? 4 OE1 ? A GLU 28 ? A GLU 27 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 316 ? 1_555 157.0 ? 5 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 316 ? 1_555 97.1 ? 6 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 316 ? 1_555 95.7 ? 7 OE1 ? A GLU 28 ? A GLU 27 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 333 ? 1_555 88.2 ? 8 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 333 ? 1_555 164.8 ? 9 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 333 ? 1_555 101.4 ? 10 O ? M HOH . ? A HOH 316 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 333 ? 1_555 83.1 ? 11 OE1 ? A GLU 28 ? A GLU 27 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 395 ? 1_555 106.4 ? 12 OE1 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 395 ? 1_555 76.9 ? 13 ND1 ? A HIS 66 ? A HIS 65 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 395 ? 1_555 144.6 ? 14 O ? M HOH . ? A HOH 316 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 395 ? 1_555 52.9 ? 15 O ? M HOH . ? A HOH 333 ? 1_555 FE ? C FE . ? A FE 202 ? 1_555 O ? M HOH . ? A HOH 395 ? 1_555 91.4 ? 16 OE1 ? A GLN 59 ? A GLN 58 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 301 ? 1_555 75.5 ? 17 OE1 ? A GLN 59 ? A GLN 58 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 331 ? 1_555 98.1 ? 18 O ? M HOH . ? A HOH 301 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 331 ? 1_555 163.5 ? 19 OE1 ? A GLN 59 ? A GLN 58 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 345 ? 1_555 90.5 ? 20 O ? M HOH . ? A HOH 301 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 345 ? 1_555 89.5 ? 21 O ? M HOH . ? A HOH 331 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 345 ? 1_555 105.9 ? 22 OE1 ? A GLN 59 ? A GLN 58 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 351 ? 1_555 72.5 ? 23 O ? M HOH . ? A HOH 301 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 351 ? 1_555 68.4 ? 24 O ? M HOH . ? A HOH 331 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 351 ? 1_555 95.3 ? 25 O ? M HOH . ? A HOH 345 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 351 ? 1_555 154.7 ? 26 OE1 ? A GLN 59 ? A GLN 58 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 446 ? 1_555 170.8 ? 27 O ? M HOH . ? A HOH 301 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 446 ? 1_555 100.1 ? 28 O ? M HOH . ? A HOH 331 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 446 ? 1_555 88.2 ? 29 O ? M HOH . ? A HOH 345 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 446 ? 1_555 81.3 ? 30 O ? M HOH . ? A HOH 351 ? 1_555 MG ? H MG . ? A MG 207 ? 1_555 O ? M HOH . ? A HOH 446 ? 1_555 113.6 ? 31 OE2 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 OE1 ? A GLU 108 ? A GLU 107 ? 1_555 154.3 ? 32 OE2 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 OE2 ? A GLU 108 ? A GLU 107 ? 1_555 92.9 ? 33 OE1 ? A GLU 108 ? A GLU 107 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 OE2 ? A GLU 108 ? A GLU 107 ? 1_555 61.6 ? 34 OE2 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 316 ? 1_555 93.5 ? 35 OE1 ? A GLU 108 ? A GLU 107 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 316 ? 1_555 111.2 ? 36 OE2 ? A GLU 108 ? A GLU 107 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 316 ? 1_555 168.2 ? 37 OE2 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 395 ? 1_555 84.5 ? 38 OE1 ? A GLU 108 ? A GLU 107 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 395 ? 1_555 103.1 ? 39 OE2 ? A GLU 108 ? A GLU 107 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 395 ? 1_555 114.4 ? 40 O ? M HOH . ? A HOH 316 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 395 ? 1_555 56.5 ? 41 OE2 ? A GLU 63 ? A GLU 62 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 446 ? 1_555 97.7 ? 42 OE1 ? A GLU 108 ? A GLU 107 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 446 ? 1_555 87.3 ? 43 OE2 ? A GLU 108 ? A GLU 107 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 446 ? 1_555 94.2 ? 44 O ? M HOH . ? A HOH 316 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 446 ? 1_555 94.7 ? 45 O ? M HOH . ? A HOH 395 ? 1_555 FE ? D FE . ? A FE 203 ? 1_555 O ? M HOH . ? A HOH 446 ? 1_555 151.3 ? 46 OE1 ? A GLN 84 ? A GLN 83 ? 1_555 MG ? G MG . ? A MG 206 ? 1_555 O ? M HOH . ? A HOH 518 ? 74_555 114.7 ? 47 NE2 ? A HIS 174 ? A HIS 173 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 NE2 ? A HIS 174 ? A HIS 173 ? 1_555 0.0 ? 48 NE2 ? A HIS 174 ? A HIS 173 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 O ? M HOH . ? A HOH 458 ? 1_555 89.1 ? 49 NE2 ? A HIS 174 ? A HIS 173 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 O ? M HOH . ? A HOH 458 ? 1_555 89.1 ? 50 NE2 ? A HIS 174 ? A HIS 173 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 O ? M HOH . ? A HOH 458 ? 3_555 89.1 ? 51 NE2 ? A HIS 174 ? A HIS 173 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 O ? M HOH . ? A HOH 458 ? 3_555 89.1 ? 52 O ? M HOH . ? A HOH 458 ? 1_555 FE ? B FE . ? A FE 201 ? 1_555 O ? M HOH . ? A HOH 458 ? 3_555 0.0 ? 53 O ? M HOH . ? A HOH 320 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 320 ? 13_555 0.0 ? 54 O ? M HOH . ? A HOH 320 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 341 ? 1_555 88.8 ? 55 O ? M HOH . ? A HOH 320 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 341 ? 1_555 88.8 ? 56 O ? M HOH . ? A HOH 320 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 341 ? 13_555 88.8 ? 57 O ? M HOH . ? A HOH 320 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 341 ? 13_555 88.8 ? 58 O ? M HOH . ? A HOH 341 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 341 ? 13_555 177.7 ? 59 O ? M HOH . ? A HOH 320 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 518 ? 86_555 91.1 ? 60 O ? M HOH . ? A HOH 320 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 518 ? 86_555 91.1 ? 61 O ? M HOH . ? A HOH 341 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 518 ? 86_555 91.4 ? 62 O ? M HOH . ? A HOH 341 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 518 ? 86_555 88.6 ? 63 O ? M HOH . ? A HOH 320 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 538 ? 74_555 180.0 ? 64 O ? M HOH . ? A HOH 320 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 538 ? 74_555 180.0 ? 65 O ? M HOH . ? A HOH 341 ? 1_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 538 ? 74_555 91.2 ? 66 O ? M HOH . ? A HOH 341 ? 13_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 538 ? 74_555 91.2 ? 67 O ? M HOH . ? A HOH 518 ? 86_555 MG ? E MG . ? A MG 204 ? 1_555 O ? M HOH . ? A HOH 538 ? 74_555 88.9 ? 68 O ? M HOH . ? A HOH 360 ? 84_555 MG ? F MG . ? A MG 205 ? 1_555 O ? M HOH . ? A HOH 420 ? 1_555 128.2 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 161 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 160 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 162 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 161 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.92 # _pdbx_entry_details.entry_id 9I19 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 316 ? ? O A HOH 395 ? ? 2.01 2 1 OE1 A GLU 61 ? ? O A HOH 301 ? ? 2.03 3 1 O A HOH 306 ? ? O A HOH 540 ? ? 2.08 4 1 OD2 A ASP 150 ? ? O A HOH 303 ? ? 2.09 5 1 OE1 A GLN 112 ? ? O A HOH 304 ? ? 2.09 6 1 O A HOH 327 ? ? O A HOH 551 ? ? 2.10 7 1 O A HOH 332 ? ? O A HOH 540 ? ? 2.11 8 1 O A HOH 356 ? ? O A HOH 426 ? ? 2.13 9 1 O A HOH 303 ? ? O A HOH 492 ? ? 2.14 10 1 O A HOH 553 ? ? O A HOH 565 ? ? 2.14 11 1 O A HOH 546 ? ? O A HOH 551 ? ? 2.15 12 1 O A HOH 388 ? ? O A HOH 501 ? ? 2.15 13 1 OE2 A GLU 61 ? ? O A HOH 305 ? ? 2.16 14 1 NE2 A GLN 14 ? ? O A HOH 306 ? ? 2.17 15 1 O A HOH 496 ? ? O A HOH 497 ? ? 2.18 16 1 O A HOH 314 ? ? O A HOH 367 ? ? 2.18 17 1 O A HOH 539 ? ? O A HOH 549 ? ? 2.19 18 1 O A HOH 540 ? ? O A HOH 548 ? ? 2.19 19 1 O A HOH 464 ? ? O A HOH 466 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 307 ? ? 1_555 O A HOH 414 ? ? 21_555 2.08 2 1 O A HOH 307 ? ? 1_555 O A HOH 383 ? ? 21_555 2.12 3 1 O A HOH 470 ? ? 1_555 O A HOH 470 ? ? 86_555 2.14 4 1 O A HOH 414 ? ? 1_555 O A HOH 420 ? ? 30_555 2.16 5 1 O A HOH 307 ? ? 1_555 O A HOH 550 ? ? 21_555 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 46 ? ? -124.52 -62.53 2 1 GLU A 94 ? ? 71.27 -47.72 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A FE 201 ? B FE . 2 1 A MG 204 ? E MG . 3 1 A CL 209 ? J CL . 4 1 A HOH 320 ? M HOH . 5 1 A HOH 323 ? M HOH . 6 1 A HOH 458 ? M HOH . 7 1 A HOH 527 ? M HOH . 8 1 A HOH 530 ? M HOH . 9 1 A HOH 538 ? M HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-z,y 3 x,z,-y 4 z,y,-x 5 -z,y,x 6 -y,x,z 7 y,-x,z 8 z,x,y 9 y,z,x 10 -y,-z,x 11 z,-x,-y 12 -y,z,-x 13 -z,-x,y 14 -z,x,-y 15 y,-z,-x 16 x,-y,-z 17 -x,y,-z 18 -x,-y,z 19 y,x,-z 20 -y,-x,-z 21 z,-y,x 22 -z,-y,-x 23 -x,z,y 24 -x,-z,-y 25 x,y+1/2,z+1/2 26 x,-z+1/2,y+1/2 27 x,z+1/2,-y+1/2 28 z,y+1/2,-x+1/2 29 -z,y+1/2,x+1/2 30 -y,x+1/2,z+1/2 31 y,-x+1/2,z+1/2 32 z,x+1/2,y+1/2 33 y,z+1/2,x+1/2 34 -y,-z+1/2,x+1/2 35 z,-x+1/2,-y+1/2 36 -y,z+1/2,-x+1/2 37 -z,-x+1/2,y+1/2 38 -z,x+1/2,-y+1/2 39 y,-z+1/2,-x+1/2 40 x,-y+1/2,-z+1/2 41 -x,y+1/2,-z+1/2 42 -x,-y+1/2,z+1/2 43 y,x+1/2,-z+1/2 44 -y,-x+1/2,-z+1/2 45 z,-y+1/2,x+1/2 46 -z,-y+1/2,-x+1/2 47 -x,z+1/2,y+1/2 48 -x,-z+1/2,-y+1/2 49 x+1/2,y,z+1/2 50 x+1/2,-z,y+1/2 51 x+1/2,z,-y+1/2 52 z+1/2,y,-x+1/2 53 -z+1/2,y,x+1/2 54 -y+1/2,x,z+1/2 55 y+1/2,-x,z+1/2 56 z+1/2,x,y+1/2 57 y+1/2,z,x+1/2 58 -y+1/2,-z,x+1/2 59 z+1/2,-x,-y+1/2 60 -y+1/2,z,-x+1/2 61 -z+1/2,-x,y+1/2 62 -z+1/2,x,-y+1/2 63 y+1/2,-z,-x+1/2 64 x+1/2,-y,-z+1/2 65 -x+1/2,y,-z+1/2 66 -x+1/2,-y,z+1/2 67 y+1/2,x,-z+1/2 68 -y+1/2,-x,-z+1/2 69 z+1/2,-y,x+1/2 70 -z+1/2,-y,-x+1/2 71 -x+1/2,z,y+1/2 72 -x+1/2,-z,-y+1/2 73 x+1/2,y+1/2,z 74 x+1/2,-z+1/2,y 75 x+1/2,z+1/2,-y 76 z+1/2,y+1/2,-x 77 -z+1/2,y+1/2,x 78 -y+1/2,x+1/2,z 79 y+1/2,-x+1/2,z 80 z+1/2,x+1/2,y 81 y+1/2,z+1/2,x 82 -y+1/2,-z+1/2,x 83 z+1/2,-x+1/2,-y 84 -y+1/2,z+1/2,-x 85 -z+1/2,-x+1/2,y 86 -z+1/2,x+1/2,-y 87 y+1/2,-z+1/2,-x 88 x+1/2,-y+1/2,-z 89 -x+1/2,y+1/2,-z 90 -x+1/2,-y+1/2,z 91 y+1/2,x+1/2,-z 92 -y+1/2,-x+1/2,-z 93 z+1/2,-y+1/2,x 94 -z+1/2,-y+1/2,-x 95 -x+1/2,z+1/2,y 96 -x+1/2,-z+1/2,-y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A THR 1 ? A THR 2 3 1 Y 1 A THR 2 ? A THR 3 4 1 Y 1 A ASP 177 ? A ASP 178 5 1 Y 1 A SER 178 ? A SER 179 6 1 Y 1 A ASP 179 ? A ASP 180 7 1 Y 1 A ASN 180 ? A ASN 181 8 1 Y 1 A GLU 181 ? A GLU 182 9 1 Y 1 A SER 182 ? A SER 183 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 FE FE FE N N 89 GLN N N N N 90 GLN CA C N S 91 GLN C C N N 92 GLN O O N N 93 GLN CB C N N 94 GLN CG C N N 95 GLN CD C N N 96 GLN OE1 O N N 97 GLN NE2 N N N 98 GLN OXT O N N 99 GLN H H N N 100 GLN H2 H N N 101 GLN HA H N N 102 GLN HB2 H N N 103 GLN HB3 H N N 104 GLN HG2 H N N 105 GLN HG3 H N N 106 GLN HE21 H N N 107 GLN HE22 H N N 108 GLN HXT H N N 109 GLU N N N N 110 GLU CA C N S 111 GLU C C N N 112 GLU O O N N 113 GLU CB C N N 114 GLU CG C N N 115 GLU CD C N N 116 GLU OE1 O N N 117 GLU OE2 O N N 118 GLU OXT O N N 119 GLU H H N N 120 GLU H2 H N N 121 GLU HA H N N 122 GLU HB2 H N N 123 GLU HB3 H N N 124 GLU HG2 H N N 125 GLU HG3 H N N 126 GLU HE2 H N N 127 GLU HXT H N N 128 GLY N N N N 129 GLY CA C N N 130 GLY C C N N 131 GLY O O N N 132 GLY OXT O N N 133 GLY H H N N 134 GLY H2 H N N 135 GLY HA2 H N N 136 GLY HA3 H N N 137 GLY HXT H N N 138 HIS N N N N 139 HIS CA C N S 140 HIS C C N N 141 HIS O O N N 142 HIS CB C N N 143 HIS CG C Y N 144 HIS ND1 N Y N 145 HIS CD2 C Y N 146 HIS CE1 C Y N 147 HIS NE2 N Y N 148 HIS OXT O N N 149 HIS H H N N 150 HIS H2 H N N 151 HIS HA H N N 152 HIS HB2 H N N 153 HIS HB3 H N N 154 HIS HD1 H N N 155 HIS HD2 H N N 156 HIS HE1 H N N 157 HIS HE2 H N N 158 HIS HXT H N N 159 HOH O O N N 160 HOH H1 H N N 161 HOH H2 H N N 162 ILE N N N N 163 ILE CA C N S 164 ILE C C N N 165 ILE O O N N 166 ILE CB C N S 167 ILE CG1 C N N 168 ILE CG2 C N N 169 ILE CD1 C N N 170 ILE OXT O N N 171 ILE H H N N 172 ILE H2 H N N 173 ILE HA H N N 174 ILE HB H N N 175 ILE HG12 H N N 176 ILE HG13 H N N 177 ILE HG21 H N N 178 ILE HG22 H N N 179 ILE HG23 H N N 180 ILE HD11 H N N 181 ILE HD12 H N N 182 ILE HD13 H N N 183 ILE HXT H N N 184 LEU N N N N 185 LEU CA C N S 186 LEU C C N N 187 LEU O O N N 188 LEU CB C N N 189 LEU CG C N N 190 LEU CD1 C N N 191 LEU CD2 C N N 192 LEU OXT O N N 193 LEU H H N N 194 LEU H2 H N N 195 LEU HA H N N 196 LEU HB2 H N N 197 LEU HB3 H N N 198 LEU HG H N N 199 LEU HD11 H N N 200 LEU HD12 H N N 201 LEU HD13 H N N 202 LEU HD21 H N N 203 LEU HD22 H N N 204 LEU HD23 H N N 205 LEU HXT H N N 206 LYS N N N N 207 LYS CA C N S 208 LYS C C N N 209 LYS O O N N 210 LYS CB C N N 211 LYS CG C N N 212 LYS CD C N N 213 LYS CE C N N 214 LYS NZ N N N 215 LYS OXT O N N 216 LYS H H N N 217 LYS H2 H N N 218 LYS HA H N N 219 LYS HB2 H N N 220 LYS HB3 H N N 221 LYS HG2 H N N 222 LYS HG3 H N N 223 LYS HD2 H N N 224 LYS HD3 H N N 225 LYS HE2 H N N 226 LYS HE3 H N N 227 LYS HZ1 H N N 228 LYS HZ2 H N N 229 LYS HZ3 H N N 230 LYS HXT H N N 231 MET N N N N 232 MET CA C N S 233 MET C C N N 234 MET O O N N 235 MET CB C N N 236 MET CG C N N 237 MET SD S N N 238 MET CE C N N 239 MET OXT O N N 240 MET H H N N 241 MET H2 H N N 242 MET HA H N N 243 MET HB2 H N N 244 MET HB3 H N N 245 MET HG2 H N N 246 MET HG3 H N N 247 MET HE1 H N N 248 MET HE2 H N N 249 MET HE3 H N N 250 MET HXT H N N 251 MG MG MG N N 252 PHE N N N N 253 PHE CA C N S 254 PHE C C N N 255 PHE O O N N 256 PHE CB C N N 257 PHE CG C Y N 258 PHE CD1 C Y N 259 PHE CD2 C Y N 260 PHE CE1 C Y N 261 PHE CE2 C Y N 262 PHE CZ C Y N 263 PHE OXT O N N 264 PHE H H N N 265 PHE H2 H N N 266 PHE HA H N N 267 PHE HB2 H N N 268 PHE HB3 H N N 269 PHE HD1 H N N 270 PHE HD2 H N N 271 PHE HE1 H N N 272 PHE HE2 H N N 273 PHE HZ H N N 274 PHE HXT H N N 275 PRO N N N N 276 PRO CA C N S 277 PRO C C N N 278 PRO O O N N 279 PRO CB C N N 280 PRO CG C N N 281 PRO CD C N N 282 PRO OXT O N N 283 PRO H H N N 284 PRO HA H N N 285 PRO HB2 H N N 286 PRO HB3 H N N 287 PRO HG2 H N N 288 PRO HG3 H N N 289 PRO HD2 H N N 290 PRO HD3 H N N 291 PRO HXT H N N 292 SER N N N N 293 SER CA C N S 294 SER C C N N 295 SER O O N N 296 SER CB C N N 297 SER OG O N N 298 SER OXT O N N 299 SER H H N N 300 SER H2 H N N 301 SER HA H N N 302 SER HB2 H N N 303 SER HB3 H N N 304 SER HG H N N 305 SER HXT H N N 306 THR N N N N 307 THR CA C N S 308 THR C C N N 309 THR O O N N 310 THR CB C N R 311 THR OG1 O N N 312 THR CG2 C N N 313 THR OXT O N N 314 THR H H N N 315 THR H2 H N N 316 THR HA H N N 317 THR HB H N N 318 THR HG1 H N N 319 THR HG21 H N N 320 THR HG22 H N N 321 THR HG23 H N N 322 THR HXT H N N 323 TRP N N N N 324 TRP CA C N S 325 TRP C C N N 326 TRP O O N N 327 TRP CB C N N 328 TRP CG C Y N 329 TRP CD1 C Y N 330 TRP CD2 C Y N 331 TRP NE1 N Y N 332 TRP CE2 C Y N 333 TRP CE3 C Y N 334 TRP CZ2 C Y N 335 TRP CZ3 C Y N 336 TRP CH2 C Y N 337 TRP OXT O N N 338 TRP H H N N 339 TRP H2 H N N 340 TRP HA H N N 341 TRP HB2 H N N 342 TRP HB3 H N N 343 TRP HD1 H N N 344 TRP HE1 H N N 345 TRP HE3 H N N 346 TRP HZ2 H N N 347 TRP HZ3 H N N 348 TRP HH2 H N N 349 TRP HXT H N N 350 TYR N N N N 351 TYR CA C N S 352 TYR C C N N 353 TYR O O N N 354 TYR CB C N N 355 TYR CG C Y N 356 TYR CD1 C Y N 357 TYR CD2 C Y N 358 TYR CE1 C Y N 359 TYR CE2 C Y N 360 TYR CZ C Y N 361 TYR OH O N N 362 TYR OXT O N N 363 TYR H H N N 364 TYR H2 H N N 365 TYR HA H N N 366 TYR HB2 H N N 367 TYR HB3 H N N 368 TYR HD1 H N N 369 TYR HD2 H N N 370 TYR HE1 H N N 371 TYR HE2 H N N 372 TYR HH H N N 373 TYR HXT H N N 374 VAL N N N N 375 VAL CA C N S 376 VAL C C N N 377 VAL O O N N 378 VAL CB C N N 379 VAL CG1 C N N 380 VAL CG2 C N N 381 VAL OXT O N N 382 VAL H H N N 383 VAL H2 H N N 384 VAL HA H N N 385 VAL HB H N N 386 VAL HG11 H N N 387 VAL HG12 H N N 388 VAL HG13 H N N 389 VAL HG21 H N N 390 VAL HG22 H N N 391 VAL HG23 H N N 392 VAL HXT H N N 393 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5N27 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'F 4 3 2' _space_group.name_Hall 'F 4 2 3' _space_group.IT_number 209 _space_group.crystal_system cubic _space_group.id 1 # _atom_sites.entry_id 9I19 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.005462 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005462 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005462 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? FE ? ? 20.90327 4.99816 ? ? 2.55100 38.46870 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MG ? ? 9.41153 2.53737 ? ? 2.59044 63.03566 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #