data_9I49 # _entry.id 9I49 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9I49 pdb_00009i49 10.2210/pdb9i49/pdb WWPDB D_1292144089 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-08-12 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9I49 _pdbx_database_status.recvd_initial_deposition_date 2025-01-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email birte.hoecker@uni-bayreuth.de _pdbx_contact_author.name_first Birte _pdbx_contact_author.name_last Hoecker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8250-9462 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Koch, J.-S.' 1 0000-0002-8498-3504 'Romero-Romero, S.' 2 0000-0003-2144-7912 'Hoecker, B.' 3 0000-0002-8250-9462 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Cobalamin-binding chimeras designed by fold recombination' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Koch, J.-S.' 1 0000-0002-8498-3504 primary 'Romero-Romero, S.' 2 0000-0003-2144-7912 primary 'Toledo-Patino, S.' 3 0000-0003-0632-0075 primary 'Braun, A.E.' 4 0009-0004-0358-0423 primary 'Hoecker, B.' 5 0000-0002-8250-9462 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Coenzyme B12-dependent mutase,Uroporphyrinogen-III synthase' 31493.465 1 4.2.1.75 ? ? ? 2 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 non-polymer syn IMIDAZOLE 69.085 1 ? ? ? ? 5 water nat water 18.015 119 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'UROIIIS,UROS,Hydroxymethylbilane hydrolyase [cyclizing],Uroporphyrinogen-III cosynthase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRRRYKVLVAKMGLDGHDRGAKVVARALRDAGFEVVLIPVLSFEFLSLPSFSEKLSHPEDYGGLIFTSPRAVEAAELCLE QNNKTEVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTEGETCGNAEKLAEYICSRESSALPLLFPCGNLKHEILPKAL KDKGIAMESITVYQTVAHPGIAGNVAMAAVQEDVDVIGVSILNGAHLHLMKRLMAKLRELGADDIPVVLGGTIPIPDLEP LRSLGIREIFLPGTSLGEIIEKVRKLAEEKRMREEAEALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MRRRYKVLVAKMGLDGHDRGAKVVARALRDAGFEVVLIPVLSFEFLSLPSFSEKLSHPEDYGGLIFTSPRAVEAAELCLE QNNKTEVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTEGETCGNAEKLAEYICSRESSALPLLFPCGNLKHEILPKAL KDKGIAMESITVYQTVAHPGIAGNVAMAAVQEDVDVIGVSILNGAHLHLMKRLMAKLRELGADDIPVVLGGTIPIPDLEP LRSLGIREIFLPGTSLGEIIEKVRKLAEEKRMREEAEALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SODIUM ION' NA 3 'CHLORIDE ION' CL 4 IMIDAZOLE IMD 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ARG n 1 4 ARG n 1 5 TYR n 1 6 LYS n 1 7 VAL n 1 8 LEU n 1 9 VAL n 1 10 ALA n 1 11 LYS n 1 12 MET n 1 13 GLY n 1 14 LEU n 1 15 ASP n 1 16 GLY n 1 17 HIS n 1 18 ASP n 1 19 ARG n 1 20 GLY n 1 21 ALA n 1 22 LYS n 1 23 VAL n 1 24 VAL n 1 25 ALA n 1 26 ARG n 1 27 ALA n 1 28 LEU n 1 29 ARG n 1 30 ASP n 1 31 ALA n 1 32 GLY n 1 33 PHE n 1 34 GLU n 1 35 VAL n 1 36 VAL n 1 37 LEU n 1 38 ILE n 1 39 PRO n 1 40 VAL n 1 41 LEU n 1 42 SER n 1 43 PHE n 1 44 GLU n 1 45 PHE n 1 46 LEU n 1 47 SER n 1 48 LEU n 1 49 PRO n 1 50 SER n 1 51 PHE n 1 52 SER n 1 53 GLU n 1 54 LYS n 1 55 LEU n 1 56 SER n 1 57 HIS n 1 58 PRO n 1 59 GLU n 1 60 ASP n 1 61 TYR n 1 62 GLY n 1 63 GLY n 1 64 LEU n 1 65 ILE n 1 66 PHE n 1 67 THR n 1 68 SER n 1 69 PRO n 1 70 ARG n 1 71 ALA n 1 72 VAL n 1 73 GLU n 1 74 ALA n 1 75 ALA n 1 76 GLU n 1 77 LEU n 1 78 CYS n 1 79 LEU n 1 80 GLU n 1 81 GLN n 1 82 ASN n 1 83 ASN n 1 84 LYS n 1 85 THR n 1 86 GLU n 1 87 VAL n 1 88 TRP n 1 89 GLU n 1 90 ARG n 1 91 SER n 1 92 LEU n 1 93 LYS n 1 94 GLU n 1 95 LYS n 1 96 TRP n 1 97 ASN n 1 98 ALA n 1 99 LYS n 1 100 SER n 1 101 VAL n 1 102 TYR n 1 103 VAL n 1 104 VAL n 1 105 GLY n 1 106 ASN n 1 107 ALA n 1 108 THR n 1 109 ALA n 1 110 SER n 1 111 LEU n 1 112 VAL n 1 113 SER n 1 114 LYS n 1 115 ILE n 1 116 GLY n 1 117 LEU n 1 118 ASP n 1 119 THR n 1 120 GLU n 1 121 GLY n 1 122 GLU n 1 123 THR n 1 124 CYS n 1 125 GLY n 1 126 ASN n 1 127 ALA n 1 128 GLU n 1 129 LYS n 1 130 LEU n 1 131 ALA n 1 132 GLU n 1 133 TYR n 1 134 ILE n 1 135 CYS n 1 136 SER n 1 137 ARG n 1 138 GLU n 1 139 SER n 1 140 SER n 1 141 ALA n 1 142 LEU n 1 143 PRO n 1 144 LEU n 1 145 LEU n 1 146 PHE n 1 147 PRO n 1 148 CYS n 1 149 GLY n 1 150 ASN n 1 151 LEU n 1 152 LYS n 1 153 HIS n 1 154 GLU n 1 155 ILE n 1 156 LEU n 1 157 PRO n 1 158 LYS n 1 159 ALA n 1 160 LEU n 1 161 LYS n 1 162 ASP n 1 163 LYS n 1 164 GLY n 1 165 ILE n 1 166 ALA n 1 167 MET n 1 168 GLU n 1 169 SER n 1 170 ILE n 1 171 THR n 1 172 VAL n 1 173 TYR n 1 174 GLN n 1 175 THR n 1 176 VAL n 1 177 ALA n 1 178 HIS n 1 179 PRO n 1 180 GLY n 1 181 ILE n 1 182 ALA n 1 183 GLY n 1 184 ASN n 1 185 VAL n 1 186 ALA n 1 187 MET n 1 188 ALA n 1 189 ALA n 1 190 VAL n 1 191 GLN n 1 192 GLU n 1 193 ASP n 1 194 VAL n 1 195 ASP n 1 196 VAL n 1 197 ILE n 1 198 GLY n 1 199 VAL n 1 200 SER n 1 201 ILE n 1 202 LEU n 1 203 ASN n 1 204 GLY n 1 205 ALA n 1 206 HIS n 1 207 LEU n 1 208 HIS n 1 209 LEU n 1 210 MET n 1 211 LYS n 1 212 ARG n 1 213 LEU n 1 214 MET n 1 215 ALA n 1 216 LYS n 1 217 LEU n 1 218 ARG n 1 219 GLU n 1 220 LEU n 1 221 GLY n 1 222 ALA n 1 223 ASP n 1 224 ASP n 1 225 ILE n 1 226 PRO n 1 227 VAL n 1 228 VAL n 1 229 LEU n 1 230 GLY n 1 231 GLY n 1 232 THR n 1 233 ILE n 1 234 PRO n 1 235 ILE n 1 236 PRO n 1 237 ASP n 1 238 LEU n 1 239 GLU n 1 240 PRO n 1 241 LEU n 1 242 ARG n 1 243 SER n 1 244 LEU n 1 245 GLY n 1 246 ILE n 1 247 ARG n 1 248 GLU n 1 249 ILE n 1 250 PHE n 1 251 LEU n 1 252 PRO n 1 253 GLY n 1 254 THR n 1 255 SER n 1 256 LEU n 1 257 GLY n 1 258 GLU n 1 259 ILE n 1 260 ILE n 1 261 GLU n 1 262 LYS n 1 263 VAL n 1 264 ARG n 1 265 LYS n 1 266 LEU n 1 267 ALA n 1 268 GLU n 1 269 GLU n 1 270 LYS n 1 271 ARG n 1 272 MET n 1 273 ARG n 1 274 GLU n 1 275 GLU n 1 276 ALA n 1 277 GLU n 1 278 ALA n 1 279 LEU n 1 280 GLU n 1 281 HIS n 1 282 HIS n 1 283 HIS n 1 284 HIS n 1 285 HIS n 1 286 HIS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 36 ? ? APE_1686.1 ? ? ? ? ? ? 'Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)' 272557 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 37 184 human ? UROS ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 3 sample 'Biological sequence' 185 286 ? ? APE_1686.1 ? ? ? ? ? ? 'Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)' 272557 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IMD non-polymer . IMIDAZOLE ? 'C3 H5 N2 1' 69.085 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 ASP 15 15 ? ? ? A . n A 1 16 GLY 16 16 ? ? ? A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 CYS 124 124 124 CYS CYS A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 CYS 135 135 135 CYS CYS A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 CYS 148 148 148 CYS CYS A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 MET 167 167 167 MET MET A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 TYR 173 173 173 TYR TYR A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 HIS 178 178 178 HIS HIS A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 ILE 181 181 181 ILE ILE A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 ASN 184 184 184 ASN ASN A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 MET 187 187 187 MET MET A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 GLN 191 191 191 GLN GLN A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 VAL 194 194 194 VAL VAL A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 VAL 196 196 196 VAL VAL A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 GLY 198 198 198 GLY GLY A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 SER 200 200 200 SER SER A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 ASN 203 203 203 ASN ASN A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 ALA 205 205 205 ALA ALA A . n A 1 206 HIS 206 206 206 HIS HIS A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 HIS 208 208 208 HIS HIS A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 MET 210 210 210 MET MET A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 ARG 212 212 212 ARG ARG A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 MET 214 214 214 MET MET A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 ARG 218 218 218 ARG ARG A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 ASP 224 224 224 ASP ASP A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 GLY 230 230 230 GLY GLY A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 THR 232 232 232 THR THR A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 PRO 234 234 234 PRO PRO A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 PRO 236 236 236 PRO PRO A . n A 1 237 ASP 237 237 237 ASP ASP A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 GLU 239 239 239 GLU GLU A . n A 1 240 PRO 240 240 240 PRO PRO A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 ARG 242 242 242 ARG ARG A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 GLY 245 245 245 GLY GLY A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 GLU 248 248 248 GLU GLU A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 PRO 252 252 252 PRO PRO A . n A 1 253 GLY 253 253 253 GLY GLY A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 SER 255 255 255 SER SER A . n A 1 256 LEU 256 256 256 LEU LEU A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 GLU 258 258 258 GLU GLU A . n A 1 259 ILE 259 259 259 ILE ILE A . n A 1 260 ILE 260 260 260 ILE ILE A . n A 1 261 GLU 261 261 261 GLU GLU A . n A 1 262 LYS 262 262 262 LYS LYS A . n A 1 263 VAL 263 263 263 VAL VAL A . n A 1 264 ARG 264 264 264 ARG ARG A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 ALA 267 267 267 ALA ALA A . n A 1 268 GLU 268 268 268 GLU GLU A . n A 1 269 GLU 269 269 269 GLU GLU A . n A 1 270 LYS 270 270 270 LYS LYS A . n A 1 271 ARG 271 271 271 ARG ARG A . n A 1 272 MET 272 272 272 MET MET A . n A 1 273 ARG 273 273 273 ARG ARG A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 GLU 275 275 275 GLU GLU A . n A 1 276 ALA 276 276 276 ALA ALA A . n A 1 277 GLU 277 277 ? ? ? A . n A 1 278 ALA 278 278 ? ? ? A . n A 1 279 LEU 279 279 ? ? ? A . n A 1 280 GLU 280 280 ? ? ? A . n A 1 281 HIS 281 281 ? ? ? A . n A 1 282 HIS 282 282 ? ? ? A . n A 1 283 HIS 283 283 ? ? ? A . n A 1 284 HIS 284 284 ? ? ? A . n A 1 285 HIS 285 285 ? ? ? A . n A 1 286 HIS 286 286 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NA 1 301 1 NA NA A . C 3 CL 1 302 1 CL CL A . D 4 IMD 1 303 301 IMD IMD A . E 5 HOH 1 401 39 HOH HOH A . E 5 HOH 2 402 20 HOH HOH A . E 5 HOH 3 403 125 HOH HOH A . E 5 HOH 4 404 51 HOH HOH A . E 5 HOH 5 405 4 HOH HOH A . E 5 HOH 6 406 52 HOH HOH A . E 5 HOH 7 407 46 HOH HOH A . E 5 HOH 8 408 8 HOH HOH A . E 5 HOH 9 409 108 HOH HOH A . E 5 HOH 10 410 112 HOH HOH A . E 5 HOH 11 411 97 HOH HOH A . E 5 HOH 12 412 1 HOH HOH A . E 5 HOH 13 413 55 HOH HOH A . E 5 HOH 14 414 56 HOH HOH A . E 5 HOH 15 415 14 HOH HOH A . E 5 HOH 16 416 9 HOH HOH A . E 5 HOH 17 417 75 HOH HOH A . E 5 HOH 18 418 94 HOH HOH A . E 5 HOH 19 419 121 HOH HOH A . E 5 HOH 20 420 105 HOH HOH A . E 5 HOH 21 421 16 HOH HOH A . E 5 HOH 22 422 60 HOH HOH A . E 5 HOH 23 423 26 HOH HOH A . E 5 HOH 24 424 93 HOH HOH A . E 5 HOH 25 425 71 HOH HOH A . E 5 HOH 26 426 25 HOH HOH A . E 5 HOH 27 427 5 HOH HOH A . E 5 HOH 28 428 58 HOH HOH A . E 5 HOH 29 429 6 HOH HOH A . E 5 HOH 30 430 48 HOH HOH A . E 5 HOH 31 431 2 HOH HOH A . E 5 HOH 32 432 24 HOH HOH A . E 5 HOH 33 433 85 HOH HOH A . E 5 HOH 34 434 11 HOH HOH A . E 5 HOH 35 435 17 HOH HOH A . E 5 HOH 36 436 106 HOH HOH A . E 5 HOH 37 437 62 HOH HOH A . E 5 HOH 38 438 92 HOH HOH A . E 5 HOH 39 439 59 HOH HOH A . E 5 HOH 40 440 7 HOH HOH A . E 5 HOH 41 441 43 HOH HOH A . E 5 HOH 42 442 15 HOH HOH A . E 5 HOH 43 443 23 HOH HOH A . E 5 HOH 44 444 33 HOH HOH A . E 5 HOH 45 445 28 HOH HOH A . E 5 HOH 46 446 31 HOH HOH A . E 5 HOH 47 447 107 HOH HOH A . E 5 HOH 48 448 76 HOH HOH A . E 5 HOH 49 449 95 HOH HOH A . E 5 HOH 50 450 47 HOH HOH A . E 5 HOH 51 451 67 HOH HOH A . E 5 HOH 52 452 50 HOH HOH A . E 5 HOH 53 453 80 HOH HOH A . E 5 HOH 54 454 54 HOH HOH A . E 5 HOH 55 455 99 HOH HOH A . E 5 HOH 56 456 72 HOH HOH A . E 5 HOH 57 457 3 HOH HOH A . E 5 HOH 58 458 82 HOH HOH A . E 5 HOH 59 459 19 HOH HOH A . E 5 HOH 60 460 123 HOH HOH A . E 5 HOH 61 461 13 HOH HOH A . E 5 HOH 62 462 36 HOH HOH A . E 5 HOH 63 463 64 HOH HOH A . E 5 HOH 64 464 12 HOH HOH A . E 5 HOH 65 465 21 HOH HOH A . E 5 HOH 66 466 49 HOH HOH A . E 5 HOH 67 467 38 HOH HOH A . E 5 HOH 68 468 98 HOH HOH A . E 5 HOH 69 469 122 HOH HOH A . E 5 HOH 70 470 65 HOH HOH A . E 5 HOH 71 471 30 HOH HOH A . E 5 HOH 72 472 74 HOH HOH A . E 5 HOH 73 473 32 HOH HOH A . E 5 HOH 74 474 70 HOH HOH A . E 5 HOH 75 475 22 HOH HOH A . E 5 HOH 76 476 57 HOH HOH A . E 5 HOH 77 477 10 HOH HOH A . E 5 HOH 78 478 104 HOH HOH A . E 5 HOH 79 479 69 HOH HOH A . E 5 HOH 80 480 44 HOH HOH A . E 5 HOH 81 481 89 HOH HOH A . E 5 HOH 82 482 37 HOH HOH A . E 5 HOH 83 483 68 HOH HOH A . E 5 HOH 84 484 18 HOH HOH A . E 5 HOH 85 485 118 HOH HOH A . E 5 HOH 86 486 90 HOH HOH A . E 5 HOH 87 487 109 HOH HOH A . E 5 HOH 88 488 101 HOH HOH A . E 5 HOH 89 489 102 HOH HOH A . E 5 HOH 90 490 126 HOH HOH A . E 5 HOH 91 491 53 HOH HOH A . E 5 HOH 92 492 61 HOH HOH A . E 5 HOH 93 493 88 HOH HOH A . E 5 HOH 94 494 29 HOH HOH A . E 5 HOH 95 495 111 HOH HOH A . E 5 HOH 96 496 103 HOH HOH A . E 5 HOH 97 497 113 HOH HOH A . E 5 HOH 98 498 63 HOH HOH A . E 5 HOH 99 499 45 HOH HOH A . E 5 HOH 100 500 119 HOH HOH A . E 5 HOH 101 501 66 HOH HOH A . E 5 HOH 102 502 116 HOH HOH A . E 5 HOH 103 503 91 HOH HOH A . E 5 HOH 104 504 84 HOH HOH A . E 5 HOH 105 505 41 HOH HOH A . E 5 HOH 106 506 117 HOH HOH A . E 5 HOH 107 507 78 HOH HOH A . E 5 HOH 108 508 86 HOH HOH A . E 5 HOH 109 509 114 HOH HOH A . E 5 HOH 110 510 110 HOH HOH A . E 5 HOH 111 511 96 HOH HOH A . E 5 HOH 112 512 27 HOH HOH A . E 5 HOH 113 513 120 HOH HOH A . E 5 HOH 114 514 34 HOH HOH A . E 5 HOH 115 515 73 HOH HOH A . E 5 HOH 116 516 115 HOH HOH A . E 5 HOH 117 517 124 HOH HOH A . E 5 HOH 118 518 87 HOH HOH A . E 5 HOH 119 519 81 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 1 ? CG ? A MET 1 CG 2 1 Y 1 A MET 1 ? SD ? A MET 1 SD 3 1 Y 1 A MET 1 ? CE ? A MET 1 CE 4 1 Y 1 A ARG 2 ? CG ? A ARG 2 CG 5 1 Y 1 A ARG 2 ? CD ? A ARG 2 CD 6 1 Y 1 A ARG 2 ? NE ? A ARG 2 NE 7 1 Y 1 A ARG 2 ? CZ ? A ARG 2 CZ 8 1 Y 1 A ARG 2 ? NH1 ? A ARG 2 NH1 9 1 Y 1 A ARG 2 ? NH2 ? A ARG 2 NH2 10 1 Y 1 A ARG 3 ? CD ? A ARG 3 CD 11 1 Y 1 A ARG 3 ? NE ? A ARG 3 NE 12 1 Y 1 A ARG 3 ? CZ ? A ARG 3 CZ 13 1 Y 1 A ARG 3 ? NH1 ? A ARG 3 NH1 14 1 Y 1 A ARG 3 ? NH2 ? A ARG 3 NH2 15 1 Y 1 A HIS 17 ? CG ? A HIS 17 CG 16 1 Y 1 A HIS 17 ? ND1 ? A HIS 17 ND1 17 1 Y 1 A HIS 17 ? CD2 ? A HIS 17 CD2 18 1 Y 1 A HIS 17 ? CE1 ? A HIS 17 CE1 19 1 Y 1 A HIS 17 ? NE2 ? A HIS 17 NE2 20 1 Y 1 A ASP 18 ? CG ? A ASP 18 CG 21 1 Y 1 A ASP 18 ? OD1 ? A ASP 18 OD1 22 1 Y 1 A ASP 18 ? OD2 ? A ASP 18 OD2 23 1 Y 1 A ARG 19 ? CG ? A ARG 19 CG 24 1 Y 1 A ARG 19 ? CD ? A ARG 19 CD 25 1 Y 1 A ARG 19 ? NE ? A ARG 19 NE 26 1 Y 1 A ARG 19 ? CZ ? A ARG 19 CZ 27 1 Y 1 A ARG 19 ? NH1 ? A ARG 19 NH1 28 1 Y 1 A ARG 19 ? NH2 ? A ARG 19 NH2 29 1 Y 1 A LYS 22 ? CG ? A LYS 22 CG 30 1 Y 1 A LYS 22 ? CD ? A LYS 22 CD 31 1 Y 1 A LYS 22 ? CE ? A LYS 22 CE 32 1 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 33 1 Y 1 A ARG 26 ? CD ? A ARG 26 CD 34 1 Y 1 A ARG 26 ? NE ? A ARG 26 NE 35 1 Y 1 A ARG 26 ? CZ ? A ARG 26 CZ 36 1 Y 1 A ARG 26 ? NH1 ? A ARG 26 NH1 37 1 Y 1 A ARG 26 ? NH2 ? A ARG 26 NH2 38 1 Y 1 A VAL 40 ? CG1 ? A VAL 40 CG1 39 1 Y 1 A VAL 40 ? CG2 ? A VAL 40 CG2 40 1 Y 1 A LEU 41 ? CD1 ? A LEU 41 CD1 41 1 Y 1 A LEU 41 ? CD2 ? A LEU 41 CD2 42 1 Y 1 A SER 42 ? OG ? A SER 42 OG 43 1 Y 1 A GLU 53 ? CG ? A GLU 53 CG 44 1 Y 1 A GLU 53 ? CD ? A GLU 53 CD 45 1 Y 1 A GLU 53 ? OE1 ? A GLU 53 OE1 46 1 Y 1 A GLU 53 ? OE2 ? A GLU 53 OE2 47 1 Y 1 A GLU 76 ? OE2 ? A GLU 76 OE2 48 1 Y 1 A GLU 80 ? OE1 ? A GLU 80 OE1 49 1 Y 1 A ASN 83 ? OD1 ? A ASN 83 OD1 50 1 Y 1 A ASN 83 ? ND2 ? A ASN 83 ND2 51 1 Y 1 A LYS 84 ? NZ ? A LYS 84 NZ 52 1 Y 1 A THR 85 ? CG2 ? A THR 85 CG2 53 1 Y 1 A GLU 86 ? CG ? A GLU 86 CG 54 1 Y 1 A GLU 86 ? CD ? A GLU 86 CD 55 1 Y 1 A GLU 86 ? OE1 ? A GLU 86 OE1 56 1 Y 1 A GLU 86 ? OE2 ? A GLU 86 OE2 57 1 Y 1 A LYS 93 ? NZ ? A LYS 93 NZ 58 1 Y 1 A GLU 94 ? CG ? A GLU 94 CG 59 1 Y 1 A GLU 94 ? CD ? A GLU 94 CD 60 1 Y 1 A GLU 94 ? OE1 ? A GLU 94 OE1 61 1 Y 1 A GLU 94 ? OE2 ? A GLU 94 OE2 62 1 Y 1 A LYS 95 ? NZ ? A LYS 95 NZ 63 1 Y 1 A LYS 114 ? CE ? A LYS 114 CE 64 1 Y 1 A LYS 114 ? NZ ? A LYS 114 NZ 65 1 Y 1 A GLU 120 ? CG ? A GLU 120 CG 66 1 Y 1 A GLU 120 ? CD ? A GLU 120 CD 67 1 Y 1 A GLU 120 ? OE1 ? A GLU 120 OE1 68 1 Y 1 A GLU 120 ? OE2 ? A GLU 120 OE2 69 1 Y 1 A GLU 122 ? CG ? A GLU 122 CG 70 1 Y 1 A GLU 122 ? CD ? A GLU 122 CD 71 1 Y 1 A GLU 122 ? OE1 ? A GLU 122 OE1 72 1 Y 1 A GLU 122 ? OE2 ? A GLU 122 OE2 73 1 Y 1 A LYS 129 ? CD ? A LYS 129 CD 74 1 Y 1 A LYS 129 ? CE ? A LYS 129 CE 75 1 Y 1 A LYS 129 ? NZ ? A LYS 129 NZ 76 1 Y 1 A LEU 151 ? CD1 ? A LEU 151 CD1 77 1 Y 1 A LYS 152 ? CG ? A LYS 152 CG 78 1 Y 1 A LYS 152 ? CD ? A LYS 152 CD 79 1 Y 1 A LYS 152 ? CE ? A LYS 152 CE 80 1 Y 1 A LYS 152 ? NZ ? A LYS 152 NZ 81 1 Y 1 A LYS 161 ? CD ? A LYS 161 CD 82 1 Y 1 A LYS 161 ? CE ? A LYS 161 CE 83 1 Y 1 A LYS 161 ? NZ ? A LYS 161 NZ 84 1 Y 1 A LYS 163 ? CD ? A LYS 163 CD 85 1 Y 1 A LYS 163 ? CE ? A LYS 163 CE 86 1 Y 1 A LYS 163 ? NZ ? A LYS 163 NZ 87 1 Y 1 A HIS 178 ? CG ? A HIS 178 CG 88 1 Y 1 A HIS 178 ? ND1 ? A HIS 178 ND1 89 1 Y 1 A HIS 178 ? CD2 ? A HIS 178 CD2 90 1 Y 1 A HIS 178 ? CE1 ? A HIS 178 CE1 91 1 Y 1 A HIS 178 ? NE2 ? A HIS 178 NE2 92 1 Y 1 A MET 187 ? CG ? A MET 187 CG 93 1 Y 1 A MET 187 ? SD ? A MET 187 SD 94 1 Y 1 A MET 187 ? CE ? A MET 187 CE 95 1 Y 1 A GLN 191 ? CG ? A GLN 191 CG 96 1 Y 1 A GLN 191 ? CD ? A GLN 191 CD 97 1 Y 1 A GLN 191 ? OE1 ? A GLN 191 OE1 98 1 Y 1 A GLN 191 ? NE2 ? A GLN 191 NE2 99 1 Y 1 A HIS 208 ? ND1 ? A HIS 208 ND1 100 1 Y 1 A HIS 208 ? CD2 ? A HIS 208 CD2 101 1 Y 1 A HIS 208 ? CE1 ? A HIS 208 CE1 102 1 Y 1 A HIS 208 ? NE2 ? A HIS 208 NE2 103 1 Y 1 A LYS 211 ? CD ? A LYS 211 CD 104 1 Y 1 A LYS 211 ? CE ? A LYS 211 CE 105 1 Y 1 A LYS 211 ? NZ ? A LYS 211 NZ 106 1 Y 1 A ARG 212 ? CD ? A ARG 212 CD 107 1 Y 1 A ARG 212 ? NE ? A ARG 212 NE 108 1 Y 1 A ARG 212 ? CZ ? A ARG 212 CZ 109 1 Y 1 A ARG 212 ? NH1 ? A ARG 212 NH1 110 1 Y 1 A ARG 212 ? NH2 ? A ARG 212 NH2 111 1 Y 1 A LYS 216 ? CE ? A LYS 216 CE 112 1 Y 1 A LYS 216 ? NZ ? A LYS 216 NZ 113 1 Y 1 A ASP 224 ? OD2 ? A ASP 224 OD2 114 1 Y 1 A LEU 238 ? CD1 ? A LEU 238 CD1 115 1 Y 1 A ARG 242 ? NH2 ? A ARG 242 NH2 116 1 Y 1 A LYS 265 ? CD ? A LYS 265 CD 117 1 Y 1 A LYS 265 ? CE ? A LYS 265 CE 118 1 Y 1 A LYS 265 ? NZ ? A LYS 265 NZ 119 1 Y 1 A ARG 273 ? CG ? A ARG 273 CG 120 1 Y 1 A ARG 273 ? CD ? A ARG 273 CD 121 1 Y 1 A ARG 273 ? NE ? A ARG 273 NE 122 1 Y 1 A ARG 273 ? CZ ? A ARG 273 CZ 123 1 Y 1 A ARG 273 ? NH1 ? A ARG 273 NH1 124 1 Y 1 A ARG 273 ? NH2 ? A ARG 273 NH2 125 1 Y 1 A GLU 275 ? CD ? A GLU 275 CD 126 1 Y 1 A GLU 275 ? OE1 ? A GLU 275 OE1 127 1 Y 1 A GLU 275 ? OE2 ? A GLU 275 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.970 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9I49 _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.480 _cell.length_a_esd ? _cell.length_b 42.130 _cell.length_b_esd ? _cell.length_c 57.390 _cell.length_c_esd ? _cell.volume 122035.108 _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9I49 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall 'P 2yb' _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9I49 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.90 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 35.2 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M imidazole pH 8.0, 0.2 M zinc acetate, 2.5 M sodium chloride' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-03-03 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'BESSY BEAMLINE 14.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 14.2 _diffrn_source.pdbx_synchrotron_site BESSY # _reflns.B_iso_Wilson_estimate 37.61 _reflns.entry_id 9I49 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.82 _reflns.d_resolution_low 37.58 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21459 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.18 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.23 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.09653 _reflns.pdbx_Rpim_I_all 0.05042 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.08188 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.822 _reflns_shell.d_res_low 1.887 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.47 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1927 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.6 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.999 _reflns_shell.pdbx_Rpim_I_all 0.999 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.312 _reflns_shell.pdbx_CC_star 0.592 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 89.62 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.8 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 48.30 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9I49 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.82 _refine.ls_d_res_low 37.58 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 21412 _refine.ls_number_reflns_R_free 1072 _refine.ls_number_reflns_R_work 20340 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.20 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2120 _refine.ls_R_factor_R_free 0.2552 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2097 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.5715 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3133 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.82 _refine_hist.d_res_low 37.58 _refine_hist.number_atoms_solvent 119 _refine_hist.number_atoms_total 2096 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1970 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0024 ? 2005 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5112 ? 2719 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0425 ? 329 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0048 ? 348 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 4.7326 ? 286 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.82 1.90 . . 123 2328 91.59 . . . . 0.3941 . . . . . . . . . . . 0.4401 'X-RAY DIFFRACTION' 1.90 2.01 . . 135 2555 98.75 . . . . 0.3625 . . . . . . . . . . . 0.3757 'X-RAY DIFFRACTION' 2.01 2.13 . . 134 2527 98.70 . . . . 0.3047 . . . . . . . . . . . 0.3538 'X-RAY DIFFRACTION' 2.13 2.30 . . 134 2575 99.38 . . . . 0.2732 . . . . . . . . . . . 0.3466 'X-RAY DIFFRACTION' 2.30 2.53 . . 135 2561 99.63 . . . . 0.2405 . . . . . . . . . . . 0.3013 'X-RAY DIFFRACTION' 2.53 2.89 . . 135 2570 99.45 . . . . 0.2264 . . . . . . . . . . . 0.2816 'X-RAY DIFFRACTION' 2.89 3.64 . . 137 2596 99.45 . . . . 0.1988 . . . . . . . . . . . 0.2164 'X-RAY DIFFRACTION' 3.64 37.58 . . 139 2628 98.54 . . . . 0.1622 . . . . . . . . . . . 0.2175 # _struct.entry_id 9I49 _struct.title 'Cobalamin-binding chimera 10 (Cob10) (crystallization condition 1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9I49 _struct_keywords.text 'Cobalamin-binding protein, Chimera, Flavodoxin-like fold, HemD-like fold, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q9YBB1_AERPE Q9YBB1 ? 1 RRRYKVLVAKMGLDGHDRGAKVVARALRDAGFEVV 16 2 UNP HEM4_HUMAN P10746 ? 1 ;LIPVLSFEFLSLPSFSEKLSHPEDYGGLIFTSPRAVEAAELCLEQNNKTEVWERSLKEKWNAKSVYVVGNATASLVSKIG LDTEGETCGNAEKLAEYICSRESSALPLLFPCGNLKREILPKALKDKGIAMESITVYQTVAHPGI ; 32 3 UNP Q9YBB1_AERPE Q9YBB1 ? 1 ;VAMAAVQEDVDVIGVSILNGAHLHLMKRLMAKLRELGADDIPVVLGGTIPIPDLEPLRSLGIREIFLPGTSLGEIIEKVR KLAEEKRMREEAEA ; 61 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9I49 A 2 ? 36 ? Q9YBB1 16 ? 50 ? 2 36 2 2 9I49 A 37 ? 181 ? P10746 32 ? 176 ? 37 181 3 3 9I49 A 185 ? 278 ? Q9YBB1 61 ? 154 ? 185 278 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9I49 MET A 1 ? UNP Q9YBB1 ? ? 'initiating methionine' 1 1 2 9I49 HIS A 153 ? UNP P10746 ARG 148 'engineered mutation' 153 2 2 9I49 ALA A 182 ? UNP P10746 ? ? linker 182 3 2 9I49 GLY A 183 ? UNP P10746 ? ? linker 183 4 2 9I49 ASN A 184 ? UNP P10746 ? ? linker 184 5 3 9I49 LEU A 279 ? UNP Q9YBB1 ? ? 'expression tag' 279 6 3 9I49 GLU A 280 ? UNP Q9YBB1 ? ? 'expression tag' 280 7 3 9I49 HIS A 281 ? UNP Q9YBB1 ? ? 'expression tag' 281 8 3 9I49 HIS A 282 ? UNP Q9YBB1 ? ? 'expression tag' 282 9 3 9I49 HIS A 283 ? UNP Q9YBB1 ? ? 'expression tag' 283 10 3 9I49 HIS A 284 ? UNP Q9YBB1 ? ? 'expression tag' 284 11 3 9I49 HIS A 285 ? UNP Q9YBB1 ? ? 'expression tag' 285 12 3 9I49 HIS A 286 ? UNP Q9YBB1 ? ? 'expression tag' 286 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 530 ? 1 MORE -21 ? 1 'SSA (A^2)' 13310 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'light scattering' ? 2 1 'gel filtration' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 19 ? ALA A 31 ? ARG A 19 ALA A 31 1 ? 13 HELX_P HELX_P2 AA2 SER A 47 ? SER A 56 ? SER A 47 SER A 56 1 ? 10 HELX_P HELX_P3 AA3 HIS A 57 ? TYR A 61 ? HIS A 57 TYR A 61 5 ? 5 HELX_P HELX_P4 AA4 SER A 68 ? ASN A 82 ? SER A 68 ASN A 82 1 ? 15 HELX_P HELX_P5 AA5 LYS A 84 ? SER A 91 ? LYS A 84 SER A 91 1 ? 8 HELX_P HELX_P6 AA6 SER A 91 ? ALA A 98 ? SER A 91 ALA A 98 1 ? 8 HELX_P HELX_P7 AA7 GLY A 105 ? ILE A 115 ? GLY A 105 ILE A 115 1 ? 11 HELX_P HELX_P8 AA8 ASN A 126 ? GLU A 138 ? ASN A 126 GLU A 138 1 ? 13 HELX_P HELX_P9 AA9 ASN A 150 ? GLU A 154 ? ASN A 150 GLU A 154 5 ? 5 HELX_P HELX_P10 AB1 ILE A 155 ? LYS A 163 ? ILE A 155 LYS A 163 1 ? 9 HELX_P HELX_P11 AB2 ILE A 181 ? ASP A 193 ? ILE A 181 ASP A 193 1 ? 13 HELX_P HELX_P12 AB3 ALA A 205 ? LEU A 220 ? ALA A 205 LEU A 220 1 ? 16 HELX_P HELX_P13 AB4 PRO A 234 ? PRO A 236 ? PRO A 234 PRO A 236 5 ? 3 HELX_P HELX_P14 AB5 ASP A 237 ? LEU A 244 ? ASP A 237 LEU A 244 1 ? 8 HELX_P HELX_P15 AB6 SER A 255 ? GLU A 274 ? SER A 255 GLU A 274 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id GLU _struct_conn.ptnr1_label_seq_id 154 _struct_conn.ptnr1_label_atom_id OE1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id NA _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id NA _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id GLU _struct_conn.ptnr1_auth_seq_id 154 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NA _struct_conn.ptnr2_auth_seq_id 301 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 3.041 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 34 ? LEU A 37 ? GLU A 34 LEU A 37 AA1 2 LYS A 6 ? LYS A 11 ? LYS A 6 LYS A 11 AA1 3 VAL A 196 ? SER A 200 ? VAL A 196 SER A 200 AA1 4 VAL A 227 ? GLY A 230 ? VAL A 227 GLY A 230 AA1 5 GLU A 248 ? PHE A 250 ? GLU A 248 PHE A 250 AA2 1 LEU A 41 ? PHE A 45 ? LEU A 41 PHE A 45 AA2 2 TYR A 173 ? ALA A 177 ? TYR A 173 ALA A 177 AA3 1 SER A 100 ? VAL A 103 ? SER A 100 VAL A 103 AA3 2 GLY A 63 ? PHE A 66 ? GLY A 63 PHE A 66 AA3 3 LEU A 144 ? CYS A 148 ? LEU A 144 CYS A 148 AA3 4 MET A 167 ? THR A 171 ? MET A 167 THR A 171 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 34 ? O GLU A 34 N VAL A 7 ? N VAL A 7 AA1 2 3 N LEU A 8 ? N LEU A 8 O GLY A 198 ? O GLY A 198 AA1 3 4 N ILE A 197 ? N ILE A 197 O VAL A 228 ? O VAL A 228 AA1 4 5 N LEU A 229 ? N LEU A 229 O PHE A 250 ? O PHE A 250 AA2 1 2 N SER A 42 ? N SER A 42 O VAL A 176 ? O VAL A 176 AA3 1 2 O TYR A 102 ? O TYR A 102 N LEU A 64 ? N LEU A 64 AA3 2 3 N GLY A 63 ? N GLY A 63 O LEU A 145 ? O LEU A 145 AA3 3 4 N LEU A 144 ? N LEU A 144 O GLU A 168 ? O GLU A 168 # _pdbx_entry_details.entry_id 9I49 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 19 ? ? -98.70 30.50 2 1 SER A 91 ? ? -145.61 -46.51 3 1 ARG A 137 ? ? -143.78 -10.68 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y+1/2,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 12.587989921 14.7901202196 8.12537940816 0.324910033348 ? -0.0328809755576 ? 0.0152858841806 ? 0.328296858897 ? -0.010751621217 ? 0.257586003632 ? 7.10925764802 ? 2.42346884347 ? -4.62670616841 ? 1.06104028335 ? -0.896451093672 ? 3.31241517948 ? 0.0809509491997 ? -0.137462235504 ? -0.0330259453801 ? 0.298354412557 ? -0.0988037033092 ? 0.0736934861124 ? 0.0671358800895 ? -0.227765357328 ? 0.0794545948413 ? 2 'X-RAY DIFFRACTION' ? refined -11.570151716 8.25957524721 33.3107090847 0.215989404847 ? 0.025493838904 ? 0.0372295306867 ? 0.292158529959 ? -0.047660671871 ? 0.243302002705 ? 3.68895669325 ? -0.276549661273 ? 0.277538861862 ? 5.83636418971 ? -1.74164590562 ? 4.57215701731 ? -0.07629783189 ? -0.0609538477428 ? 0.0993645114308 ? 0.100146343993 ? 0.0553252049924 ? 0.198964021854 ? -0.144479117493 ? -0.226666658615 ? 0.00415162587591 ? 3 'X-RAY DIFFRACTION' ? refined 6.51781844879 11.9342444421 -1.78446122988 0.319963713105 ? -0.0466451880078 ? -0.0625655192541 ? 0.391982020361 ? -0.0394228709359 ? 0.393458342476 ? 2.59826894604 ? 0.586453116293 ? -1.70672174886 ? 0.0868745316343 ? -0.0956751172814 ? 3.7937213567 ? 0.0302051758759 ? 0.168637070315 ? -0.0950569633578 ? 0.10243737006 ? -0.0836758585423 ? 0.244355122689 ? 0.376950270862 ? -0.691672787153 ? 0.0471384192442 ? 4 'X-RAY DIFFRACTION' ? refined 19.5398092814 15.0040813992 -8.00463057519 0.322330693883 ? 0.0166932856751 ? 0.0974712792699 ? 0.327634285905 ? 0.00474532137164 ? 0.261398610759 ? 5.43044806138 ? -2.85366369642 ? 1.68188605138 ? 6.24216514506 ? -0.76843939174 ? 4.43691473637 ? 0.21090378998 ? 0.367415689532 ? 0.195507534001 ? -0.687469609494 ? -0.0747966647129 ? -0.102543888029 ? -0.213659472613 ? 0.0179180204688 ? -0.116966758967 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 2 A 2 ? A 44 A 47 ? ? ;chain 'A' and (resid 2 through 47 ) ; 2 'X-RAY DIFFRACTION' 2 A 45 A 48 ? A 168 A 171 ? ? ;chain 'A' and (resid 48 through 171 ) ; 3 'X-RAY DIFFRACTION' 3 A 169 A 172 ? A 231 A 234 ? ? ;chain 'A' and (resid 172 through 234 ) ; 4 'X-RAY DIFFRACTION' 4 A 232 A 235 ? A 272 A 275 ? ? ;chain 'A' and (resid 235 through 275 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 14 ? A LEU 14 2 1 Y 1 A ASP 15 ? A ASP 15 3 1 Y 1 A GLY 16 ? A GLY 16 4 1 Y 1 A GLU 277 ? A GLU 277 5 1 Y 1 A ALA 278 ? A ALA 278 6 1 Y 1 A LEU 279 ? A LEU 279 7 1 Y 1 A GLU 280 ? A GLU 280 8 1 Y 1 A HIS 281 ? A HIS 281 9 1 Y 1 A HIS 282 ? A HIS 282 10 1 Y 1 A HIS 283 ? A HIS 283 11 1 Y 1 A HIS 284 ? A HIS 284 12 1 Y 1 A HIS 285 ? A HIS 285 13 1 Y 1 A HIS 286 ? A HIS 286 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 IMD N1 N Y N 184 IMD C2 C Y N 185 IMD N3 N Y N 186 IMD C4 C Y N 187 IMD C5 C Y N 188 IMD HN1 H N N 189 IMD H2 H N N 190 IMD HN3 H N N 191 IMD H4 H N N 192 IMD H5 H N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 NA NA NA N N 261 PHE N N N N 262 PHE CA C N S 263 PHE C C N N 264 PHE O O N N 265 PHE CB C N N 266 PHE CG C Y N 267 PHE CD1 C Y N 268 PHE CD2 C Y N 269 PHE CE1 C Y N 270 PHE CE2 C Y N 271 PHE CZ C Y N 272 PHE OXT O N N 273 PHE H H N N 274 PHE H2 H N N 275 PHE HA H N N 276 PHE HB2 H N N 277 PHE HB3 H N N 278 PHE HD1 H N N 279 PHE HD2 H N N 280 PHE HE1 H N N 281 PHE HE2 H N N 282 PHE HZ H N N 283 PHE HXT H N N 284 PRO N N N N 285 PRO CA C N S 286 PRO C C N N 287 PRO O O N N 288 PRO CB C N N 289 PRO CG C N N 290 PRO CD C N N 291 PRO OXT O N N 292 PRO H H N N 293 PRO HA H N N 294 PRO HB2 H N N 295 PRO HB3 H N N 296 PRO HG2 H N N 297 PRO HG3 H N N 298 PRO HD2 H N N 299 PRO HD3 H N N 300 PRO HXT H N N 301 SER N N N N 302 SER CA C N S 303 SER C C N N 304 SER O O N N 305 SER CB C N N 306 SER OG O N N 307 SER OXT O N N 308 SER H H N N 309 SER H2 H N N 310 SER HA H N N 311 SER HB2 H N N 312 SER HB3 H N N 313 SER HG H N N 314 SER HXT H N N 315 THR N N N N 316 THR CA C N S 317 THR C C N N 318 THR O O N N 319 THR CB C N R 320 THR OG1 O N N 321 THR CG2 C N N 322 THR OXT O N N 323 THR H H N N 324 THR H2 H N N 325 THR HA H N N 326 THR HB H N N 327 THR HG1 H N N 328 THR HG21 H N N 329 THR HG22 H N N 330 THR HG23 H N N 331 THR HXT H N N 332 TRP N N N N 333 TRP CA C N S 334 TRP C C N N 335 TRP O O N N 336 TRP CB C N N 337 TRP CG C Y N 338 TRP CD1 C Y N 339 TRP CD2 C Y N 340 TRP NE1 N Y N 341 TRP CE2 C Y N 342 TRP CE3 C Y N 343 TRP CZ2 C Y N 344 TRP CZ3 C Y N 345 TRP CH2 C Y N 346 TRP OXT O N N 347 TRP H H N N 348 TRP H2 H N N 349 TRP HA H N N 350 TRP HB2 H N N 351 TRP HB3 H N N 352 TRP HD1 H N N 353 TRP HE1 H N N 354 TRP HE3 H N N 355 TRP HZ2 H N N 356 TRP HZ3 H N N 357 TRP HH2 H N N 358 TRP HXT H N N 359 TYR N N N N 360 TYR CA C N S 361 TYR C C N N 362 TYR O O N N 363 TYR CB C N N 364 TYR CG C Y N 365 TYR CD1 C Y N 366 TYR CD2 C Y N 367 TYR CE1 C Y N 368 TYR CE2 C Y N 369 TYR CZ C Y N 370 TYR OH O N N 371 TYR OXT O N N 372 TYR H H N N 373 TYR H2 H N N 374 TYR HA H N N 375 TYR HB2 H N N 376 TYR HB3 H N N 377 TYR HD1 H N N 378 TYR HD2 H N N 379 TYR HE1 H N N 380 TYR HE2 H N N 381 TYR HH H N N 382 TYR HXT H N N 383 VAL N N N N 384 VAL CA C N S 385 VAL C C N N 386 VAL O O N N 387 VAL CB C N N 388 VAL CG1 C N N 389 VAL CG2 C N N 390 VAL OXT O N N 391 VAL H H N N 392 VAL H2 H N N 393 VAL HA H N N 394 VAL HB H N N 395 VAL HG11 H N N 396 VAL HG12 H N N 397 VAL HG13 H N N 398 VAL HG21 H N N 399 VAL HG22 H N N 400 VAL HG23 H N N 401 VAL HXT H N N 402 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 IMD N1 C2 sing Y N 173 IMD N1 C5 sing Y N 174 IMD N1 HN1 sing N N 175 IMD C2 N3 doub Y N 176 IMD C2 H2 sing N N 177 IMD N3 C4 sing Y N 178 IMD N3 HN3 sing N N 179 IMD C4 C5 doub Y N 180 IMD C4 H4 sing N N 181 IMD C5 H5 sing N N 182 LEU N CA sing N N 183 LEU N H sing N N 184 LEU N H2 sing N N 185 LEU CA C sing N N 186 LEU CA CB sing N N 187 LEU CA HA sing N N 188 LEU C O doub N N 189 LEU C OXT sing N N 190 LEU CB CG sing N N 191 LEU CB HB2 sing N N 192 LEU CB HB3 sing N N 193 LEU CG CD1 sing N N 194 LEU CG CD2 sing N N 195 LEU CG HG sing N N 196 LEU CD1 HD11 sing N N 197 LEU CD1 HD12 sing N N 198 LEU CD1 HD13 sing N N 199 LEU CD2 HD21 sing N N 200 LEU CD2 HD22 sing N N 201 LEU CD2 HD23 sing N N 202 LEU OXT HXT sing N N 203 LYS N CA sing N N 204 LYS N H sing N N 205 LYS N H2 sing N N 206 LYS CA C sing N N 207 LYS CA CB sing N N 208 LYS CA HA sing N N 209 LYS C O doub N N 210 LYS C OXT sing N N 211 LYS CB CG sing N N 212 LYS CB HB2 sing N N 213 LYS CB HB3 sing N N 214 LYS CG CD sing N N 215 LYS CG HG2 sing N N 216 LYS CG HG3 sing N N 217 LYS CD CE sing N N 218 LYS CD HD2 sing N N 219 LYS CD HD3 sing N N 220 LYS CE NZ sing N N 221 LYS CE HE2 sing N N 222 LYS CE HE3 sing N N 223 LYS NZ HZ1 sing N N 224 LYS NZ HZ2 sing N N 225 LYS NZ HZ3 sing N N 226 LYS OXT HXT sing N N 227 MET N CA sing N N 228 MET N H sing N N 229 MET N H2 sing N N 230 MET CA C sing N N 231 MET CA CB sing N N 232 MET CA HA sing N N 233 MET C O doub N N 234 MET C OXT sing N N 235 MET CB CG sing N N 236 MET CB HB2 sing N N 237 MET CB HB3 sing N N 238 MET CG SD sing N N 239 MET CG HG2 sing N N 240 MET CG HG3 sing N N 241 MET SD CE sing N N 242 MET CE HE1 sing N N 243 MET CE HE2 sing N N 244 MET CE HE3 sing N N 245 MET OXT HXT sing N N 246 PHE N CA sing N N 247 PHE N H sing N N 248 PHE N H2 sing N N 249 PHE CA C sing N N 250 PHE CA CB sing N N 251 PHE CA HA sing N N 252 PHE C O doub N N 253 PHE C OXT sing N N 254 PHE CB CG sing N N 255 PHE CB HB2 sing N N 256 PHE CB HB3 sing N N 257 PHE CG CD1 doub Y N 258 PHE CG CD2 sing Y N 259 PHE CD1 CE1 sing Y N 260 PHE CD1 HD1 sing N N 261 PHE CD2 CE2 doub Y N 262 PHE CD2 HD2 sing N N 263 PHE CE1 CZ doub Y N 264 PHE CE1 HE1 sing N N 265 PHE CE2 CZ sing Y N 266 PHE CE2 HE2 sing N N 267 PHE CZ HZ sing N N 268 PHE OXT HXT sing N N 269 PRO N CA sing N N 270 PRO N CD sing N N 271 PRO N H sing N N 272 PRO CA C sing N N 273 PRO CA CB sing N N 274 PRO CA HA sing N N 275 PRO C O doub N N 276 PRO C OXT sing N N 277 PRO CB CG sing N N 278 PRO CB HB2 sing N N 279 PRO CB HB3 sing N N 280 PRO CG CD sing N N 281 PRO CG HG2 sing N N 282 PRO CG HG3 sing N N 283 PRO CD HD2 sing N N 284 PRO CD HD3 sing N N 285 PRO OXT HXT sing N N 286 SER N CA sing N N 287 SER N H sing N N 288 SER N H2 sing N N 289 SER CA C sing N N 290 SER CA CB sing N N 291 SER CA HA sing N N 292 SER C O doub N N 293 SER C OXT sing N N 294 SER CB OG sing N N 295 SER CB HB2 sing N N 296 SER CB HB3 sing N N 297 SER OG HG sing N N 298 SER OXT HXT sing N N 299 THR N CA sing N N 300 THR N H sing N N 301 THR N H2 sing N N 302 THR CA C sing N N 303 THR CA CB sing N N 304 THR CA HA sing N N 305 THR C O doub N N 306 THR C OXT sing N N 307 THR CB OG1 sing N N 308 THR CB CG2 sing N N 309 THR CB HB sing N N 310 THR OG1 HG1 sing N N 311 THR CG2 HG21 sing N N 312 THR CG2 HG22 sing N N 313 THR CG2 HG23 sing N N 314 THR OXT HXT sing N N 315 TRP N CA sing N N 316 TRP N H sing N N 317 TRP N H2 sing N N 318 TRP CA C sing N N 319 TRP CA CB sing N N 320 TRP CA HA sing N N 321 TRP C O doub N N 322 TRP C OXT sing N N 323 TRP CB CG sing N N 324 TRP CB HB2 sing N N 325 TRP CB HB3 sing N N 326 TRP CG CD1 doub Y N 327 TRP CG CD2 sing Y N 328 TRP CD1 NE1 sing Y N 329 TRP CD1 HD1 sing N N 330 TRP CD2 CE2 doub Y N 331 TRP CD2 CE3 sing Y N 332 TRP NE1 CE2 sing Y N 333 TRP NE1 HE1 sing N N 334 TRP CE2 CZ2 sing Y N 335 TRP CE3 CZ3 doub Y N 336 TRP CE3 HE3 sing N N 337 TRP CZ2 CH2 doub Y N 338 TRP CZ2 HZ2 sing N N 339 TRP CZ3 CH2 sing Y N 340 TRP CZ3 HZ3 sing N N 341 TRP CH2 HH2 sing N N 342 TRP OXT HXT sing N N 343 TYR N CA sing N N 344 TYR N H sing N N 345 TYR N H2 sing N N 346 TYR CA C sing N N 347 TYR CA CB sing N N 348 TYR CA HA sing N N 349 TYR C O doub N N 350 TYR C OXT sing N N 351 TYR CB CG sing N N 352 TYR CB HB2 sing N N 353 TYR CB HB3 sing N N 354 TYR CG CD1 doub Y N 355 TYR CG CD2 sing Y N 356 TYR CD1 CE1 sing Y N 357 TYR CD1 HD1 sing N N 358 TYR CD2 CE2 doub Y N 359 TYR CD2 HD2 sing N N 360 TYR CE1 CZ doub Y N 361 TYR CE1 HE1 sing N N 362 TYR CE2 CZ sing Y N 363 TYR CE2 HE2 sing N N 364 TYR CZ OH sing N N 365 TYR OH HH sing N N 366 TYR OXT HXT sing N N 367 VAL N CA sing N N 368 VAL N H sing N N 369 VAL N H2 sing N N 370 VAL CA C sing N N 371 VAL CA CB sing N N 372 VAL CA HA sing N N 373 VAL C O doub N N 374 VAL C OXT sing N N 375 VAL CB CG1 sing N N 376 VAL CB CG2 sing N N 377 VAL CB HB sing N N 378 VAL CG1 HG11 sing N N 379 VAL CG1 HG12 sing N N 380 VAL CG1 HG13 sing N N 381 VAL CG2 HG21 sing N N 382 VAL CG2 HG22 sing N N 383 VAL CG2 HG23 sing N N 384 VAL OXT HXT sing N N 385 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'European Research Council (ERC)' 'European Union' '647548 Protein Lego' 1 'Volkswagen Foundation' Germany 94747 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'Model built manually from chimeric parts' # _space_group.name_H-M_alt 'P 1 21 1' _space_group.name_Hall 'P 2yb' _space_group.IT_number 4 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 9I49 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.019810 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000335 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023736 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017427 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? NA ? ? 9.38062 1.54875 ? ? 3.38349 72.32734 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #