data_9I9G # _entry.id 9I9G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9I9G pdb_00009i9g 10.2210/pdb9i9g/pdb WWPDB D_1292144947 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-02-18 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9I9G _pdbx_database_status.recvd_initial_deposition_date 2025-02-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 3 _pdbx_contact_author.email martin.bushell@glasgow.ac.uk _pdbx_contact_author.name_first Martin _pdbx_contact_author.name_last Bushell _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9938-2691 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Turnbull, A.P.' 1 0000-0001-6545-4108 'Schmidt, T.' 2 ? 'Bushell, M.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'The mechanism of selective eIF4A1-dependent translation' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schmidt, T.' 1 ? primary 'Turnbull, A.P.' 2 0000-0001-6545-4108 primary 'Bushell, M.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Eukaryotic initiation factor 4A-I' 19858.535 1 3.6.4.13 ? ? ? 2 non-polymer syn Hippuristanol 462.662 1 ? ? ? ? 3 water nat water 18.015 167 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'eIF-4A-I,eIF4A-I,ATP-dependent RNA helicase eIF4A-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMR EFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIE EMPLNVADLI ; _entity_poly.pdbx_seq_one_letter_code_can ;GSEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMR EFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIE EMPLNVADLI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 Hippuristanol A1I1L 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLU n 1 4 GLU n 1 5 LEU n 1 6 THR n 1 7 LEU n 1 8 GLU n 1 9 GLY n 1 10 ILE n 1 11 ARG n 1 12 GLN n 1 13 PHE n 1 14 TYR n 1 15 ILE n 1 16 ASN n 1 17 VAL n 1 18 GLU n 1 19 ARG n 1 20 GLU n 1 21 GLU n 1 22 TRP n 1 23 LYS n 1 24 LEU n 1 25 ASP n 1 26 THR n 1 27 LEU n 1 28 CYS n 1 29 ASP n 1 30 LEU n 1 31 TYR n 1 32 GLU n 1 33 THR n 1 34 LEU n 1 35 THR n 1 36 ILE n 1 37 THR n 1 38 GLN n 1 39 ALA n 1 40 VAL n 1 41 ILE n 1 42 PHE n 1 43 ILE n 1 44 ASN n 1 45 THR n 1 46 ARG n 1 47 ARG n 1 48 LYS n 1 49 VAL n 1 50 ASP n 1 51 TRP n 1 52 LEU n 1 53 THR n 1 54 GLU n 1 55 LYS n 1 56 MET n 1 57 HIS n 1 58 ALA n 1 59 ARG n 1 60 ASP n 1 61 PHE n 1 62 THR n 1 63 VAL n 1 64 SER n 1 65 ALA n 1 66 MET n 1 67 HIS n 1 68 GLY n 1 69 ASP n 1 70 MET n 1 71 ASP n 1 72 GLN n 1 73 LYS n 1 74 GLU n 1 75 ARG n 1 76 ASP n 1 77 VAL n 1 78 ILE n 1 79 MET n 1 80 ARG n 1 81 GLU n 1 82 PHE n 1 83 ARG n 1 84 SER n 1 85 GLY n 1 86 SER n 1 87 SER n 1 88 ARG n 1 89 VAL n 1 90 LEU n 1 91 ILE n 1 92 THR n 1 93 THR n 1 94 ASP n 1 95 LEU n 1 96 LEU n 1 97 ALA n 1 98 ARG n 1 99 GLY n 1 100 ILE n 1 101 ASP n 1 102 VAL n 1 103 GLN n 1 104 GLN n 1 105 VAL n 1 106 SER n 1 107 LEU n 1 108 VAL n 1 109 ILE n 1 110 ASN n 1 111 TYR n 1 112 ASP n 1 113 LEU n 1 114 PRO n 1 115 THR n 1 116 ASN n 1 117 ARG n 1 118 GLU n 1 119 ASN n 1 120 TYR n 1 121 ILE n 1 122 HIS n 1 123 ARG n 1 124 ILE n 1 125 GLY n 1 126 ARG n 1 127 GLY n 1 128 GLY n 1 129 ARG n 1 130 PHE n 1 131 GLY n 1 132 ARG n 1 133 LYS n 1 134 GLY n 1 135 VAL n 1 136 ALA n 1 137 ILE n 1 138 ASN n 1 139 MET n 1 140 VAL n 1 141 THR n 1 142 GLU n 1 143 GLU n 1 144 ASP n 1 145 LYS n 1 146 ARG n 1 147 THR n 1 148 LEU n 1 149 ARG n 1 150 ASP n 1 151 ILE n 1 152 GLU n 1 153 THR n 1 154 PHE n 1 155 TYR n 1 156 ASN n 1 157 THR n 1 158 SER n 1 159 ILE n 1 160 GLU n 1 161 GLU n 1 162 MET n 1 163 PRO n 1 164 LEU n 1 165 ASN n 1 166 VAL n 1 167 ALA n 1 168 ASP n 1 169 LEU n 1 170 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 170 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EIF4A1, DDX2A, EIF4A' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1I1L non-polymer . Hippuristanol ;(1S,2S,3'S,4S,6R,7R,8R,9S,11S,12S,13S,16R,18S)-2',2',3',7,9,13-hexamethylspiro[5-oxapentacyclo[10.8.0.0^2,9.0^4,8.0^13,18]icosane-6,5'-oxolane]-7,11,16-triol ; 'C28 H46 O5' 462.662 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 237 ? ? ? A . n A 1 2 SER 2 238 ? ? ? A . n A 1 3 GLU 3 239 ? ? ? A . n A 1 4 GLU 4 240 240 GLU GLU A . n A 1 5 LEU 5 241 241 LEU LEU A . n A 1 6 THR 6 242 242 THR THR A . n A 1 7 LEU 7 243 243 LEU LEU A . n A 1 8 GLU 8 244 244 GLU GLU A . n A 1 9 GLY 9 245 245 GLY GLY A . n A 1 10 ILE 10 246 246 ILE ILE A . n A 1 11 ARG 11 247 247 ARG ARG A . n A 1 12 GLN 12 248 248 GLN GLN A . n A 1 13 PHE 13 249 249 PHE PHE A . n A 1 14 TYR 14 250 250 TYR TYR A . n A 1 15 ILE 15 251 251 ILE ILE A . n A 1 16 ASN 16 252 252 ASN ASN A . n A 1 17 VAL 17 253 253 VAL VAL A . n A 1 18 GLU 18 254 254 GLU GLU A . n A 1 19 ARG 19 255 255 ARG ARG A . n A 1 20 GLU 20 256 256 GLU GLU A . n A 1 21 GLU 21 257 257 GLU GLU A . n A 1 22 TRP 22 258 258 TRP TRP A . n A 1 23 LYS 23 259 259 LYS LYS A . n A 1 24 LEU 24 260 260 LEU LEU A . n A 1 25 ASP 25 261 261 ASP ASP A . n A 1 26 THR 26 262 262 THR THR A . n A 1 27 LEU 27 263 263 LEU LEU A . n A 1 28 CYS 28 264 264 CYS CYS A . n A 1 29 ASP 29 265 265 ASP ASP A . n A 1 30 LEU 30 266 266 LEU LEU A . n A 1 31 TYR 31 267 267 TYR TYR A . n A 1 32 GLU 32 268 268 GLU GLU A . n A 1 33 THR 33 269 269 THR THR A . n A 1 34 LEU 34 270 270 LEU LEU A . n A 1 35 THR 35 271 271 THR THR A . n A 1 36 ILE 36 272 272 ILE ILE A . n A 1 37 THR 37 273 273 THR THR A . n A 1 38 GLN 38 274 274 GLN GLN A . n A 1 39 ALA 39 275 275 ALA ALA A . n A 1 40 VAL 40 276 276 VAL VAL A . n A 1 41 ILE 41 277 277 ILE ILE A . n A 1 42 PHE 42 278 278 PHE PHE A . n A 1 43 ILE 43 279 279 ILE ILE A . n A 1 44 ASN 44 280 280 ASN ASN A . n A 1 45 THR 45 281 281 THR THR A . n A 1 46 ARG 46 282 282 ARG ARG A . n A 1 47 ARG 47 283 283 ARG ARG A . n A 1 48 LYS 48 284 284 LYS LYS A . n A 1 49 VAL 49 285 285 VAL VAL A . n A 1 50 ASP 50 286 286 ASP ASP A . n A 1 51 TRP 51 287 287 TRP TRP A . n A 1 52 LEU 52 288 288 LEU LEU A . n A 1 53 THR 53 289 289 THR THR A . n A 1 54 GLU 54 290 290 GLU GLU A . n A 1 55 LYS 55 291 291 LYS LYS A . n A 1 56 MET 56 292 292 MET MET A . n A 1 57 HIS 57 293 293 HIS HIS A . n A 1 58 ALA 58 294 294 ALA ALA A . n A 1 59 ARG 59 295 295 ARG ARG A . n A 1 60 ASP 60 296 296 ASP ASP A . n A 1 61 PHE 61 297 297 PHE PHE A . n A 1 62 THR 62 298 298 THR THR A . n A 1 63 VAL 63 299 299 VAL VAL A . n A 1 64 SER 64 300 300 SER SER A . n A 1 65 ALA 65 301 301 ALA ALA A . n A 1 66 MET 66 302 302 MET MET A . n A 1 67 HIS 67 303 303 HIS HIS A . n A 1 68 GLY 68 304 304 GLY GLY A . n A 1 69 ASP 69 305 305 ASP ASP A . n A 1 70 MET 70 306 306 MET MET A . n A 1 71 ASP 71 307 307 ASP ASP A . n A 1 72 GLN 72 308 308 GLN GLN A . n A 1 73 LYS 73 309 309 LYS LYS A . n A 1 74 GLU 74 310 310 GLU GLU A . n A 1 75 ARG 75 311 311 ARG ARG A . n A 1 76 ASP 76 312 312 ASP ASP A . n A 1 77 VAL 77 313 313 VAL VAL A . n A 1 78 ILE 78 314 314 ILE ILE A . n A 1 79 MET 79 315 315 MET MET A . n A 1 80 ARG 80 316 316 ARG ARG A . n A 1 81 GLU 81 317 317 GLU GLU A . n A 1 82 PHE 82 318 318 PHE PHE A . n A 1 83 ARG 83 319 319 ARG ARG A . n A 1 84 SER 84 320 320 SER SER A . n A 1 85 GLY 85 321 321 GLY GLY A . n A 1 86 SER 86 322 322 SER SER A . n A 1 87 SER 87 323 323 SER SER A . n A 1 88 ARG 88 324 324 ARG ARG A . n A 1 89 VAL 89 325 325 VAL VAL A . n A 1 90 LEU 90 326 326 LEU LEU A . n A 1 91 ILE 91 327 327 ILE ILE A . n A 1 92 THR 92 328 328 THR THR A . n A 1 93 THR 93 329 329 THR THR A . n A 1 94 ASP 94 330 330 ASP ASP A . n A 1 95 LEU 95 331 331 LEU LEU A . n A 1 96 LEU 96 332 332 LEU LEU A . n A 1 97 ALA 97 333 333 ALA ALA A . n A 1 98 ARG 98 334 334 ARG ARG A . n A 1 99 GLY 99 335 335 GLY GLY A . n A 1 100 ILE 100 336 336 ILE ILE A . n A 1 101 ASP 101 337 337 ASP ASP A . n A 1 102 VAL 102 338 338 VAL VAL A . n A 1 103 GLN 103 339 339 GLN GLN A . n A 1 104 GLN 104 340 340 GLN GLN A . n A 1 105 VAL 105 341 341 VAL VAL A . n A 1 106 SER 106 342 342 SER SER A . n A 1 107 LEU 107 343 343 LEU LEU A . n A 1 108 VAL 108 344 344 VAL VAL A . n A 1 109 ILE 109 345 345 ILE ILE A . n A 1 110 ASN 110 346 346 ASN ASN A . n A 1 111 TYR 111 347 347 TYR TYR A . n A 1 112 ASP 112 348 348 ASP ASP A . n A 1 113 LEU 113 349 349 LEU LEU A . n A 1 114 PRO 114 350 350 PRO PRO A . n A 1 115 THR 115 351 351 THR THR A . n A 1 116 ASN 116 352 352 ASN ASN A . n A 1 117 ARG 117 353 353 ARG ARG A . n A 1 118 GLU 118 354 354 GLU GLU A . n A 1 119 ASN 119 355 355 ASN ASN A . n A 1 120 TYR 120 356 356 TYR TYR A . n A 1 121 ILE 121 357 357 ILE ILE A . n A 1 122 HIS 122 358 358 HIS HIS A . n A 1 123 ARG 123 359 359 ARG ARG A . n A 1 124 ILE 124 360 360 ILE ILE A . n A 1 125 GLY 125 361 361 GLY GLY A . n A 1 126 ARG 126 362 362 ARG ARG A . n A 1 127 GLY 127 363 363 GLY GLY A . n A 1 128 GLY 128 364 364 GLY GLY A . n A 1 129 ARG 129 365 365 ARG ARG A . n A 1 130 PHE 130 366 366 PHE PHE A . n A 1 131 GLY 131 367 367 GLY GLY A . n A 1 132 ARG 132 368 368 ARG ARG A . n A 1 133 LYS 133 369 369 LYS LYS A . n A 1 134 GLY 134 370 370 GLY GLY A . n A 1 135 VAL 135 371 371 VAL VAL A . n A 1 136 ALA 136 372 372 ALA ALA A . n A 1 137 ILE 137 373 373 ILE ILE A . n A 1 138 ASN 138 374 374 ASN ASN A . n A 1 139 MET 139 375 375 MET MET A . n A 1 140 VAL 140 376 376 VAL VAL A . n A 1 141 THR 141 377 377 THR THR A . n A 1 142 GLU 142 378 378 GLU GLU A . n A 1 143 GLU 143 379 379 GLU GLU A . n A 1 144 ASP 144 380 380 ASP ASP A . n A 1 145 LYS 145 381 381 LYS LYS A . n A 1 146 ARG 146 382 382 ARG ARG A . n A 1 147 THR 147 383 383 THR THR A . n A 1 148 LEU 148 384 384 LEU LEU A . n A 1 149 ARG 149 385 385 ARG ARG A . n A 1 150 ASP 150 386 386 ASP ASP A . n A 1 151 ILE 151 387 387 ILE ILE A . n A 1 152 GLU 152 388 388 GLU GLU A . n A 1 153 THR 153 389 389 THR THR A . n A 1 154 PHE 154 390 390 PHE PHE A . n A 1 155 TYR 155 391 391 TYR TYR A . n A 1 156 ASN 156 392 392 ASN ASN A . n A 1 157 THR 157 393 393 THR THR A . n A 1 158 SER 158 394 394 SER SER A . n A 1 159 ILE 159 395 395 ILE ILE A . n A 1 160 GLU 160 396 396 GLU GLU A . n A 1 161 GLU 161 397 397 GLU GLU A . n A 1 162 MET 162 398 398 MET MET A . n A 1 163 PRO 163 399 399 PRO PRO A . n A 1 164 LEU 164 400 400 LEU LEU A . n A 1 165 ASN 165 401 401 ASN ASN A . n A 1 166 VAL 166 402 402 VAL VAL A . n A 1 167 ALA 167 403 403 ALA ALA A . n A 1 168 ASP 168 404 404 ASP ASP A . n A 1 169 LEU 169 405 405 LEU LEU A . n A 1 170 ILE 170 406 406 ILE ILE A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1I1L _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1I1L _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1I1L 1 501 1 A1I1L XXX A . C 3 HOH 1 601 27 HOH HOH A . C 3 HOH 2 602 175 HOH HOH A . C 3 HOH 3 603 85 HOH HOH A . C 3 HOH 4 604 163 HOH HOH A . C 3 HOH 5 605 156 HOH HOH A . C 3 HOH 6 606 26 HOH HOH A . C 3 HOH 7 607 146 HOH HOH A . C 3 HOH 8 608 153 HOH HOH A . C 3 HOH 9 609 18 HOH HOH A . C 3 HOH 10 610 186 HOH HOH A . C 3 HOH 11 611 12 HOH HOH A . C 3 HOH 12 612 100 HOH HOH A . C 3 HOH 13 613 39 HOH HOH A . C 3 HOH 14 614 123 HOH HOH A . C 3 HOH 15 615 86 HOH HOH A . C 3 HOH 16 616 98 HOH HOH A . C 3 HOH 17 617 105 HOH HOH A . C 3 HOH 18 618 58 HOH HOH A . C 3 HOH 19 619 81 HOH HOH A . C 3 HOH 20 620 3 HOH HOH A . C 3 HOH 21 621 51 HOH HOH A . C 3 HOH 22 622 164 HOH HOH A . C 3 HOH 23 623 121 HOH HOH A . C 3 HOH 24 624 185 HOH HOH A . C 3 HOH 25 625 152 HOH HOH A . C 3 HOH 26 626 103 HOH HOH A . C 3 HOH 27 627 113 HOH HOH A . C 3 HOH 28 628 151 HOH HOH A . C 3 HOH 29 629 118 HOH HOH A . C 3 HOH 30 630 158 HOH HOH A . C 3 HOH 31 631 35 HOH HOH A . C 3 HOH 32 632 24 HOH HOH A . C 3 HOH 33 633 169 HOH HOH A . C 3 HOH 34 634 54 HOH HOH A . C 3 HOH 35 635 47 HOH HOH A . C 3 HOH 36 636 40 HOH HOH A . C 3 HOH 37 637 1 HOH HOH A . C 3 HOH 38 638 42 HOH HOH A . C 3 HOH 39 639 166 HOH HOH A . C 3 HOH 40 640 44 HOH HOH A . C 3 HOH 41 641 46 HOH HOH A . C 3 HOH 42 642 36 HOH HOH A . C 3 HOH 43 643 126 HOH HOH A . C 3 HOH 44 644 61 HOH HOH A . C 3 HOH 45 645 154 HOH HOH A . C 3 HOH 46 646 130 HOH HOH A . C 3 HOH 47 647 15 HOH HOH A . C 3 HOH 48 648 115 HOH HOH A . C 3 HOH 49 649 16 HOH HOH A . C 3 HOH 50 650 125 HOH HOH A . C 3 HOH 51 651 23 HOH HOH A . C 3 HOH 52 652 171 HOH HOH A . C 3 HOH 53 653 83 HOH HOH A . C 3 HOH 54 654 9 HOH HOH A . C 3 HOH 55 655 43 HOH HOH A . C 3 HOH 56 656 150 HOH HOH A . C 3 HOH 57 657 68 HOH HOH A . C 3 HOH 58 658 67 HOH HOH A . C 3 HOH 59 659 13 HOH HOH A . C 3 HOH 60 660 19 HOH HOH A . C 3 HOH 61 661 17 HOH HOH A . C 3 HOH 62 662 102 HOH HOH A . C 3 HOH 63 663 119 HOH HOH A . C 3 HOH 64 664 111 HOH HOH A . C 3 HOH 65 665 133 HOH HOH A . C 3 HOH 66 666 32 HOH HOH A . C 3 HOH 67 667 112 HOH HOH A . C 3 HOH 68 668 2 HOH HOH A . C 3 HOH 69 669 5 HOH HOH A . C 3 HOH 70 670 60 HOH HOH A . C 3 HOH 71 671 87 HOH HOH A . C 3 HOH 72 672 137 HOH HOH A . C 3 HOH 73 673 142 HOH HOH A . C 3 HOH 74 674 10 HOH HOH A . C 3 HOH 75 675 77 HOH HOH A . C 3 HOH 76 676 75 HOH HOH A . C 3 HOH 77 677 11 HOH HOH A . C 3 HOH 78 678 91 HOH HOH A . C 3 HOH 79 679 30 HOH HOH A . C 3 HOH 80 680 94 HOH HOH A . C 3 HOH 81 681 25 HOH HOH A . C 3 HOH 82 682 96 HOH HOH A . C 3 HOH 83 683 14 HOH HOH A . C 3 HOH 84 684 45 HOH HOH A . C 3 HOH 85 685 145 HOH HOH A . C 3 HOH 86 686 179 HOH HOH A . C 3 HOH 87 687 182 HOH HOH A . C 3 HOH 88 688 159 HOH HOH A . C 3 HOH 89 689 88 HOH HOH A . C 3 HOH 90 690 34 HOH HOH A . C 3 HOH 91 691 109 HOH HOH A . C 3 HOH 92 692 93 HOH HOH A . C 3 HOH 93 693 129 HOH HOH A . C 3 HOH 94 694 63 HOH HOH A . C 3 HOH 95 695 20 HOH HOH A . C 3 HOH 96 696 64 HOH HOH A . C 3 HOH 97 697 90 HOH HOH A . C 3 HOH 98 698 38 HOH HOH A . C 3 HOH 99 699 70 HOH HOH A . C 3 HOH 100 700 22 HOH HOH A . C 3 HOH 101 701 21 HOH HOH A . C 3 HOH 102 702 141 HOH HOH A . C 3 HOH 103 703 50 HOH HOH A . C 3 HOH 104 704 76 HOH HOH A . C 3 HOH 105 705 149 HOH HOH A . C 3 HOH 106 706 174 HOH HOH A . C 3 HOH 107 707 6 HOH HOH A . C 3 HOH 108 708 183 HOH HOH A . C 3 HOH 109 709 167 HOH HOH A . C 3 HOH 110 710 71 HOH HOH A . C 3 HOH 111 711 79 HOH HOH A . C 3 HOH 112 712 131 HOH HOH A . C 3 HOH 113 713 66 HOH HOH A . C 3 HOH 114 714 124 HOH HOH A . C 3 HOH 115 715 107 HOH HOH A . C 3 HOH 116 716 31 HOH HOH A . C 3 HOH 117 717 134 HOH HOH A . C 3 HOH 118 718 128 HOH HOH A . C 3 HOH 119 719 69 HOH HOH A . C 3 HOH 120 720 59 HOH HOH A . C 3 HOH 121 721 165 HOH HOH A . C 3 HOH 122 722 148 HOH HOH A . C 3 HOH 123 723 127 HOH HOH A . C 3 HOH 124 724 56 HOH HOH A . C 3 HOH 125 725 28 HOH HOH A . C 3 HOH 126 726 162 HOH HOH A . C 3 HOH 127 727 178 HOH HOH A . C 3 HOH 128 728 82 HOH HOH A . C 3 HOH 129 729 181 HOH HOH A . C 3 HOH 130 730 143 HOH HOH A . C 3 HOH 131 731 120 HOH HOH A . C 3 HOH 132 732 106 HOH HOH A . C 3 HOH 133 733 65 HOH HOH A . C 3 HOH 134 734 138 HOH HOH A . C 3 HOH 135 735 41 HOH HOH A . C 3 HOH 136 736 72 HOH HOH A . C 3 HOH 137 737 170 HOH HOH A . C 3 HOH 138 738 8 HOH HOH A . C 3 HOH 139 739 160 HOH HOH A . C 3 HOH 140 740 97 HOH HOH A . C 3 HOH 141 741 180 HOH HOH A . C 3 HOH 142 742 173 HOH HOH A . C 3 HOH 143 743 49 HOH HOH A . C 3 HOH 144 744 144 HOH HOH A . C 3 HOH 145 745 161 HOH HOH A . C 3 HOH 146 746 48 HOH HOH A . C 3 HOH 147 747 135 HOH HOH A . C 3 HOH 148 748 80 HOH HOH A . C 3 HOH 149 749 177 HOH HOH A . C 3 HOH 150 750 176 HOH HOH A . C 3 HOH 151 751 74 HOH HOH A . C 3 HOH 152 752 84 HOH HOH A . C 3 HOH 153 753 122 HOH HOH A . C 3 HOH 154 754 140 HOH HOH A . C 3 HOH 155 755 116 HOH HOH A . C 3 HOH 156 756 37 HOH HOH A . C 3 HOH 157 757 184 HOH HOH A . C 3 HOH 158 758 172 HOH HOH A . C 3 HOH 159 759 157 HOH HOH A . C 3 HOH 160 760 33 HOH HOH A . C 3 HOH 161 761 89 HOH HOH A . C 3 HOH 162 762 95 HOH HOH A . C 3 HOH 163 763 7 HOH HOH A . C 3 HOH 164 764 132 HOH HOH A . C 3 HOH 165 765 78 HOH HOH A . C 3 HOH 166 766 108 HOH HOH A . C 3 HOH 167 767 114 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 291 ? NZ ? A LYS 55 NZ 2 1 Y 1 A LYS 309 ? CD ? A LYS 73 CD 3 1 Y 1 A LYS 309 ? CE ? A LYS 73 CE 4 1 Y 1 A LYS 309 ? NZ ? A LYS 73 NZ 5 1 Y 1 A ARG 311 ? CD ? A ARG 75 CD 6 1 Y 1 A ARG 311 ? NE ? A ARG 75 NE 7 1 Y 1 A ARG 311 ? CZ ? A ARG 75 CZ 8 1 Y 1 A ARG 311 ? NH1 ? A ARG 75 NH1 9 1 Y 1 A ARG 311 ? NH2 ? A ARG 75 NH2 10 1 Y 1 A SER 323 ? OG ? A SER 87 OG 11 1 Y 1 A ARG 324 ? CG ? A ARG 88 CG 12 1 Y 1 A ARG 324 ? CD ? A ARG 88 CD 13 1 Y 1 A ARG 324 ? NE ? A ARG 88 NE 14 1 Y 1 A ARG 324 ? CZ ? A ARG 88 CZ 15 1 Y 1 A ARG 324 ? NH1 ? A ARG 88 NH1 16 1 Y 1 A ARG 324 ? NH2 ? A ARG 88 NH2 17 1 Y 1 A LYS 381 ? CD ? A LYS 145 CD 18 1 Y 1 A LYS 381 ? CE ? A LYS 145 CE 19 1 Y 1 A LYS 381 ? NZ ? A LYS 145 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0411 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 77.093 _cell.angle_alpha_esd ? _cell.angle_beta 74.669 _cell.angle_beta_esd ? _cell.angle_gamma 81.044 _cell.angle_gamma_esd ? _cell.entry_id 9I9G _cell.details ? _cell.formula_units_Z ? _cell.length_a 31.199 _cell.length_a_esd ? _cell.length_b 32.974 _cell.length_b_esd ? _cell.length_c 37.781 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9I9G _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9I9G _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.83 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 32.9 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20 % (w/v) PEG 6000, 0.2 M sodium chloride, 0.1 M sodium acetate, pH 5.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-10-18 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9762 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9762 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9I9G _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.70 _reflns.d_resolution_low 35.76 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15055 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.060 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.73 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 714 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.173 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.967 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.202 _refine.aniso_B[1][2] 0.055 _refine.aniso_B[1][3] -0.114 _refine.aniso_B[2][2] -0.583 _refine.aniso_B[2][3] 0.290 _refine.aniso_B[3][3] 0.381 _refine.B_iso_max ? _refine.B_iso_mean 14.507 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.967 _refine.correlation_coeff_Fo_to_Fc_free 0.946 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9I9G _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.700 _refine.ls_d_res_low 35.002 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15049 _refine.ls_number_reflns_R_free 771 _refine.ls_number_reflns_R_work 14278 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.003 _refine.ls_percent_reflns_R_free 5.123 _refine.ls_R_factor_all 0.151 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.1896 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1489 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.116 _refine.pdbx_overall_ESU_R_Free 0.110 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.096 _refine.overall_SU_ML 0.071 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1354 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.number_atoms_solvent 167 _refine_hist.number_atoms_total 1554 _refine_hist.d_res_high 1.700 _refine_hist.d_res_low 35.002 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.012 1447 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.016 1389 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.775 1.693 1981 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.732 1.625 3179 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.841 5.000 176 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 8.466 5.000 16 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.406 10.000 254 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.605 10.000 74 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.090 0.200 236 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 1.125 0.200 14 ? r_chiral_restr_other ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1697 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 347 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.218 0.200 307 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.197 0.200 1359 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.178 0.200 721 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.082 0.200 829 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.265 0.200 107 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.190 0.200 22 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.190 0.200 67 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.198 0.200 32 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 1.530 1.412 678 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.529 1.411 679 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.371 2.532 847 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.370 2.531 848 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.644 1.717 769 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.642 1.716 770 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 4.077 2.995 1129 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.075 2.993 1130 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.755 24.084 1732 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 5.754 24.075 1733 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.700 1.744 1178 . 61 1016 91.4261 . 0.169 . . 0.169 . . . . . 0.159 . 20 . 0.983 0.982 0.168 'X-RAY DIFFRACTION' 1.744 1.792 1097 . 61 997 96.4449 . 0.167 . . 0.163 . . . . . 0.155 . 20 . 0.984 0.973 0.227 'X-RAY DIFFRACTION' 1.792 1.844 1103 . 53 1004 95.8296 . 0.170 . . 0.166 . . . . . 0.159 . 20 . 0.984 0.969 0.230 'X-RAY DIFFRACTION' 1.844 1.900 1044 . 53 955 96.5517 . 0.158 . . 0.155 . . . . . 0.152 . 20 . 0.985 0.975 0.204 'X-RAY DIFFRACTION' 1.900 1.962 1017 . 54 923 96.0669 . 0.162 . . 0.159 . . . . . 0.155 . 20 . 0.985 0.967 0.229 'X-RAY DIFFRACTION' 1.962 2.031 988 . 43 913 96.7611 . 0.154 . . 0.151 . . . . . 0.149 . 20 . 0.987 0.976 0.216 'X-RAY DIFFRACTION' 2.031 2.107 969 . 45 897 97.2136 . 0.155 . . 0.151 . . . . . 0.151 . 20 . 0.986 0.973 0.219 'X-RAY DIFFRACTION' 2.107 2.193 905 . 40 840 97.2376 . 0.147 . . 0.144 . . . . . 0.147 . 20 . 0.988 0.974 0.208 'X-RAY DIFFRACTION' 2.193 2.290 867 . 45 799 97.3472 . 0.149 . . 0.146 . . . . . 0.149 . 20 . 0.988 0.969 0.208 'X-RAY DIFFRACTION' 2.290 2.401 841 . 42 776 97.2652 . 0.147 . . 0.145 . . . . . 0.151 . 20 . 0.987 0.978 0.178 'X-RAY DIFFRACTION' 2.401 2.531 814 . 44 755 98.1572 . 0.143 . . 0.141 . . . . . 0.148 . 20 . 0.988 0.979 0.186 'X-RAY DIFFRACTION' 2.531 2.683 744 . 33 696 97.9839 . 0.143 . . 0.140 . . . . . 0.146 . 20 . 0.989 0.975 0.205 'X-RAY DIFFRACTION' 2.683 2.867 714 . 42 661 98.4594 . 0.150 . . 0.149 . . . . . 0.159 . 20 . 0.987 0.984 0.167 'X-RAY DIFFRACTION' 2.867 3.095 670 . 31 626 98.0597 . 0.144 . . 0.143 . . . . . 0.155 . 20 . 0.988 0.983 0.158 'X-RAY DIFFRACTION' 3.095 3.388 603 . 34 563 99.0050 . 0.151 . . 0.149 . . . . . 0.165 . 20 . 0.987 0.979 0.178 'X-RAY DIFFRACTION' 3.388 3.783 560 . 31 524 99.1071 . 0.145 . . 0.146 . . . . . 0.161 . 20 . 0.988 0.988 0.141 'X-RAY DIFFRACTION' 3.783 4.360 482 . 15 463 99.1701 . 0.128 . . 0.127 . . . . . 0.148 . 20 . 0.990 0.985 0.152 'X-RAY DIFFRACTION' 4.360 5.320 413 . 13 398 99.5157 . 0.141 . . 0.139 . . . . . 0.166 . 20 . 0.990 0.980 0.189 'X-RAY DIFFRACTION' 5.320 7.438 319 . 20 298 99.6865 . 0.192 . . 0.193 . . . . . 0.219 . 20 . 0.982 0.986 0.186 'X-RAY DIFFRACTION' 7.438 35.002 185 . 11 174 100.0000 . 0.168 . . 0.161 . . . . . 0.183 . 20 . 0.981 0.966 0.279 # _struct.entry_id 9I9G _struct.title 'Crystal structure of human eIF4A1 C-terminal domain in complex with hippuristanol' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9I9G _struct_keywords.text 'INITIATION FACTOR, DEAD-BOX, HELICASE, ATPASE, TRANSLATION' _struct_keywords.pdbx_keywords TRANSLATION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IF4A1_HUMAN _struct_ref.pdbx_db_accession P60842 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREF RSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEM PLNVADLI ; _struct_ref.pdbx_align_begin 239 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9I9G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 170 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P60842 _struct_ref_seq.db_align_beg 239 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 406 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 239 _struct_ref_seq.pdbx_auth_seq_align_end 406 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9I9G GLY A 1 ? UNP P60842 ? ? 'expression tag' 237 1 1 9I9G SER A 2 ? UNP P60842 ? ? 'expression tag' 238 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9010 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 19 ? GLU A 21 ? ARG A 255 GLU A 257 5 ? 3 HELX_P HELX_P2 AA2 TRP A 22 ? LEU A 34 ? TRP A 258 LEU A 270 1 ? 13 HELX_P HELX_P3 AA3 THR A 45 ? ALA A 58 ? THR A 281 ALA A 294 1 ? 14 HELX_P HELX_P4 AA4 ASP A 71 ? SER A 84 ? ASP A 307 SER A 320 1 ? 14 HELX_P HELX_P5 AA5 ASN A 116 ? GLY A 125 ? ASN A 352 GLY A 361 1 ? 10 HELX_P HELX_P6 AA6 ASP A 144 ? TYR A 155 ? ASP A 380 TYR A 391 1 ? 12 HELX_P HELX_P7 AA7 ASN A 165 ? ILE A 170 ? ASN A 401 ILE A 406 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 63 ? MET A 66 ? VAL A 299 MET A 302 AA1 2 VAL A 89 ? THR A 92 ? VAL A 325 THR A 328 AA1 3 GLN A 38 ? PHE A 42 ? GLN A 274 PHE A 278 AA1 4 VAL A 105 ? ASN A 110 ? VAL A 341 ASN A 346 AA1 5 GLY A 134 ? THR A 141 ? GLY A 370 THR A 377 AA1 6 ILE A 10 ? GLU A 18 ? ILE A 246 GLU A 254 AA1 7 ILE A 159 ? GLU A 161 ? ILE A 395 GLU A 397 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 64 ? N SER A 300 O VAL A 89 ? O VAL A 325 AA1 2 3 O LEU A 90 ? O LEU A 326 N ILE A 41 ? N ILE A 277 AA1 3 4 N VAL A 40 ? N VAL A 276 O ILE A 109 ? O ILE A 345 AA1 4 5 N ASN A 110 ? N ASN A 346 O ILE A 137 ? O ILE A 373 AA1 5 6 O ASN A 138 ? O ASN A 374 N PHE A 13 ? N PHE A 249 AA1 6 7 N TYR A 14 ? N TYR A 250 O GLU A 160 ? O GLU A 396 # _pdbx_entry_details.entry_id 9I9G _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 673 ? ? O A HOH 730 ? ? 1.95 2 1 O A HOH 663 ? ? O A HOH 746 ? ? 1.96 3 1 O A HOH 604 ? ? O A HOH 684 ? ? 1.97 4 1 OE1 A GLU 268 ? ? O A HOH 601 ? ? 2.11 5 1 O A HOH 610 ? ? O A HOH 741 ? ? 2.13 6 1 O A HOH 648 ? ? O A HOH 721 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 602 ? ? 1_555 O A HOH 716 ? ? 1_655 2.14 2 1 O A HOH 647 ? ? 1_555 O A HOH 649 ? ? 1_554 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CG _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 MET _pdbx_validate_rmsd_angle.auth_seq_id_1 375 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 SD _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 MET _pdbx_validate_rmsd_angle.auth_seq_id_2 375 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CE _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 MET _pdbx_validate_rmsd_angle.auth_seq_id_3 375 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 89.00 _pdbx_validate_rmsd_angle.angle_target_value 100.20 _pdbx_validate_rmsd_angle.angle_deviation -11.20 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.60 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 254 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 81.86 _pdbx_validate_torsion.psi -56.62 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 283 ? ? 0.082 'SIDE CHAIN' 2 1 ARG A 385 ? ? 0.087 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 237 ? A GLY 1 2 1 Y 1 A SER 238 ? A SER 2 3 1 Y 1 A GLU 239 ? A GLU 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1I1L C7 C N N 1 A1I1L C8 C N R 2 A1I1L C9 C N N 3 A1I1L O1 O N N 4 A1I1L C1 C N R 5 A1I1L C5 C N N 6 A1I1L C6 C N N 7 A1I1L C4 C N N 8 A1I1L O4 O N N 9 A1I1L C3 C N S 10 A1I1L O3 O N N 11 A1I1L C2 C N N 12 A1I1L O O N N 13 A1I1L C C N S 14 A1I1L C10 C N N 15 A1I1L C11 C N S 16 A1I1L C12 C N S 17 A1I1L C13 C N N 18 A1I1L C14 C N N 19 A1I1L C15 C N S 20 A1I1L C16 C N N 21 A1I1L C17 C N R 22 A1I1L C18 C N N 23 A1I1L C19 C N N 24 A1I1L C20 C N S 25 A1I1L C21 C N N 26 A1I1L C22 C N S 27 A1I1L C23 C N S 28 A1I1L C24 C N N 29 A1I1L C25 C N S 30 A1I1L C26 C N N 31 A1I1L C27 C N R 32 A1I1L O2 O N N 33 A1I1L H1 H N N 34 A1I1L H2 H N N 35 A1I1L H3 H N N 36 A1I1L H4 H N N 37 A1I1L H5 H N N 38 A1I1L H6 H N N 39 A1I1L H7 H N N 40 A1I1L H8 H N N 41 A1I1L H9 H N N 42 A1I1L H10 H N N 43 A1I1L H11 H N N 44 A1I1L H12 H N N 45 A1I1L H13 H N N 46 A1I1L H14 H N N 47 A1I1L H15 H N N 48 A1I1L H16 H N N 49 A1I1L H17 H N N 50 A1I1L H18 H N N 51 A1I1L H19 H N N 52 A1I1L H20 H N N 53 A1I1L H21 H N N 54 A1I1L H22 H N N 55 A1I1L H23 H N N 56 A1I1L H24 H N N 57 A1I1L H25 H N N 58 A1I1L H26 H N N 59 A1I1L H27 H N N 60 A1I1L H28 H N N 61 A1I1L H29 H N N 62 A1I1L H30 H N N 63 A1I1L H31 H N N 64 A1I1L H32 H N N 65 A1I1L H33 H N N 66 A1I1L H34 H N N 67 A1I1L H35 H N N 68 A1I1L H36 H N N 69 A1I1L H37 H N N 70 A1I1L H38 H N N 71 A1I1L H39 H N N 72 A1I1L H40 H N N 73 A1I1L H41 H N N 74 A1I1L H42 H N N 75 A1I1L H43 H N N 76 A1I1L H44 H N N 77 A1I1L H45 H N N 78 A1I1L H46 H N N 79 ALA N N N N 80 ALA CA C N S 81 ALA C C N N 82 ALA O O N N 83 ALA CB C N N 84 ALA OXT O N N 85 ALA H H N N 86 ALA H2 H N N 87 ALA HA H N N 88 ALA HB1 H N N 89 ALA HB2 H N N 90 ALA HB3 H N N 91 ALA HXT H N N 92 ARG N N N N 93 ARG CA C N S 94 ARG C C N N 95 ARG O O N N 96 ARG CB C N N 97 ARG CG C N N 98 ARG CD C N N 99 ARG NE N N N 100 ARG CZ C N N 101 ARG NH1 N N N 102 ARG NH2 N N N 103 ARG OXT O N N 104 ARG H H N N 105 ARG H2 H N N 106 ARG HA H N N 107 ARG HB2 H N N 108 ARG HB3 H N N 109 ARG HG2 H N N 110 ARG HG3 H N N 111 ARG HD2 H N N 112 ARG HD3 H N N 113 ARG HE H N N 114 ARG HH11 H N N 115 ARG HH12 H N N 116 ARG HH21 H N N 117 ARG HH22 H N N 118 ARG HXT H N N 119 ASN N N N N 120 ASN CA C N S 121 ASN C C N N 122 ASN O O N N 123 ASN CB C N N 124 ASN CG C N N 125 ASN OD1 O N N 126 ASN ND2 N N N 127 ASN OXT O N N 128 ASN H H N N 129 ASN H2 H N N 130 ASN HA H N N 131 ASN HB2 H N N 132 ASN HB3 H N N 133 ASN HD21 H N N 134 ASN HD22 H N N 135 ASN HXT H N N 136 ASP N N N N 137 ASP CA C N S 138 ASP C C N N 139 ASP O O N N 140 ASP CB C N N 141 ASP CG C N N 142 ASP OD1 O N N 143 ASP OD2 O N N 144 ASP OXT O N N 145 ASP H H N N 146 ASP H2 H N N 147 ASP HA H N N 148 ASP HB2 H N N 149 ASP HB3 H N N 150 ASP HD2 H N N 151 ASP HXT H N N 152 CYS N N N N 153 CYS CA C N R 154 CYS C C N N 155 CYS O O N N 156 CYS CB C N N 157 CYS SG S N N 158 CYS OXT O N N 159 CYS H H N N 160 CYS H2 H N N 161 CYS HA H N N 162 CYS HB2 H N N 163 CYS HB3 H N N 164 CYS HG H N N 165 CYS HXT H N N 166 GLN N N N N 167 GLN CA C N S 168 GLN C C N N 169 GLN O O N N 170 GLN CB C N N 171 GLN CG C N N 172 GLN CD C N N 173 GLN OE1 O N N 174 GLN NE2 N N N 175 GLN OXT O N N 176 GLN H H N N 177 GLN H2 H N N 178 GLN HA H N N 179 GLN HB2 H N N 180 GLN HB3 H N N 181 GLN HG2 H N N 182 GLN HG3 H N N 183 GLN HE21 H N N 184 GLN HE22 H N N 185 GLN HXT H N N 186 GLU N N N N 187 GLU CA C N S 188 GLU C C N N 189 GLU O O N N 190 GLU CB C N N 191 GLU CG C N N 192 GLU CD C N N 193 GLU OE1 O N N 194 GLU OE2 O N N 195 GLU OXT O N N 196 GLU H H N N 197 GLU H2 H N N 198 GLU HA H N N 199 GLU HB2 H N N 200 GLU HB3 H N N 201 GLU HG2 H N N 202 GLU HG3 H N N 203 GLU HE2 H N N 204 GLU HXT H N N 205 GLY N N N N 206 GLY CA C N N 207 GLY C C N N 208 GLY O O N N 209 GLY OXT O N N 210 GLY H H N N 211 GLY H2 H N N 212 GLY HA2 H N N 213 GLY HA3 H N N 214 GLY HXT H N N 215 HIS N N N N 216 HIS CA C N S 217 HIS C C N N 218 HIS O O N N 219 HIS CB C N N 220 HIS CG C Y N 221 HIS ND1 N Y N 222 HIS CD2 C Y N 223 HIS CE1 C Y N 224 HIS NE2 N Y N 225 HIS OXT O N N 226 HIS H H N N 227 HIS H2 H N N 228 HIS HA H N N 229 HIS HB2 H N N 230 HIS HB3 H N N 231 HIS HD1 H N N 232 HIS HD2 H N N 233 HIS HE1 H N N 234 HIS HE2 H N N 235 HIS HXT H N N 236 HOH O O N N 237 HOH H1 H N N 238 HOH H2 H N N 239 ILE N N N N 240 ILE CA C N S 241 ILE C C N N 242 ILE O O N N 243 ILE CB C N S 244 ILE CG1 C N N 245 ILE CG2 C N N 246 ILE CD1 C N N 247 ILE OXT O N N 248 ILE H H N N 249 ILE H2 H N N 250 ILE HA H N N 251 ILE HB H N N 252 ILE HG12 H N N 253 ILE HG13 H N N 254 ILE HG21 H N N 255 ILE HG22 H N N 256 ILE HG23 H N N 257 ILE HD11 H N N 258 ILE HD12 H N N 259 ILE HD13 H N N 260 ILE HXT H N N 261 LEU N N N N 262 LEU CA C N S 263 LEU C C N N 264 LEU O O N N 265 LEU CB C N N 266 LEU CG C N N 267 LEU CD1 C N N 268 LEU CD2 C N N 269 LEU OXT O N N 270 LEU H H N N 271 LEU H2 H N N 272 LEU HA H N N 273 LEU HB2 H N N 274 LEU HB3 H N N 275 LEU HG H N N 276 LEU HD11 H N N 277 LEU HD12 H N N 278 LEU HD13 H N N 279 LEU HD21 H N N 280 LEU HD22 H N N 281 LEU HD23 H N N 282 LEU HXT H N N 283 LYS N N N N 284 LYS CA C N S 285 LYS C C N N 286 LYS O O N N 287 LYS CB C N N 288 LYS CG C N N 289 LYS CD C N N 290 LYS CE C N N 291 LYS NZ N N N 292 LYS OXT O N N 293 LYS H H N N 294 LYS H2 H N N 295 LYS HA H N N 296 LYS HB2 H N N 297 LYS HB3 H N N 298 LYS HG2 H N N 299 LYS HG3 H N N 300 LYS HD2 H N N 301 LYS HD3 H N N 302 LYS HE2 H N N 303 LYS HE3 H N N 304 LYS HZ1 H N N 305 LYS HZ2 H N N 306 LYS HZ3 H N N 307 LYS HXT H N N 308 MET N N N N 309 MET CA C N S 310 MET C C N N 311 MET O O N N 312 MET CB C N N 313 MET CG C N N 314 MET SD S N N 315 MET CE C N N 316 MET OXT O N N 317 MET H H N N 318 MET H2 H N N 319 MET HA H N N 320 MET HB2 H N N 321 MET HB3 H N N 322 MET HG2 H N N 323 MET HG3 H N N 324 MET HE1 H N N 325 MET HE2 H N N 326 MET HE3 H N N 327 MET HXT H N N 328 PHE N N N N 329 PHE CA C N S 330 PHE C C N N 331 PHE O O N N 332 PHE CB C N N 333 PHE CG C Y N 334 PHE CD1 C Y N 335 PHE CD2 C Y N 336 PHE CE1 C Y N 337 PHE CE2 C Y N 338 PHE CZ C Y N 339 PHE OXT O N N 340 PHE H H N N 341 PHE H2 H N N 342 PHE HA H N N 343 PHE HB2 H N N 344 PHE HB3 H N N 345 PHE HD1 H N N 346 PHE HD2 H N N 347 PHE HE1 H N N 348 PHE HE2 H N N 349 PHE HZ H N N 350 PHE HXT H N N 351 PRO N N N N 352 PRO CA C N S 353 PRO C C N N 354 PRO O O N N 355 PRO CB C N N 356 PRO CG C N N 357 PRO CD C N N 358 PRO OXT O N N 359 PRO H H N N 360 PRO HA H N N 361 PRO HB2 H N N 362 PRO HB3 H N N 363 PRO HG2 H N N 364 PRO HG3 H N N 365 PRO HD2 H N N 366 PRO HD3 H N N 367 PRO HXT H N N 368 SER N N N N 369 SER CA C N S 370 SER C C N N 371 SER O O N N 372 SER CB C N N 373 SER OG O N N 374 SER OXT O N N 375 SER H H N N 376 SER H2 H N N 377 SER HA H N N 378 SER HB2 H N N 379 SER HB3 H N N 380 SER HG H N N 381 SER HXT H N N 382 THR N N N N 383 THR CA C N S 384 THR C C N N 385 THR O O N N 386 THR CB C N R 387 THR OG1 O N N 388 THR CG2 C N N 389 THR OXT O N N 390 THR H H N N 391 THR H2 H N N 392 THR HA H N N 393 THR HB H N N 394 THR HG1 H N N 395 THR HG21 H N N 396 THR HG22 H N N 397 THR HG23 H N N 398 THR HXT H N N 399 TRP N N N N 400 TRP CA C N S 401 TRP C C N N 402 TRP O O N N 403 TRP CB C N N 404 TRP CG C Y N 405 TRP CD1 C Y N 406 TRP CD2 C Y N 407 TRP NE1 N Y N 408 TRP CE2 C Y N 409 TRP CE3 C Y N 410 TRP CZ2 C Y N 411 TRP CZ3 C Y N 412 TRP CH2 C Y N 413 TRP OXT O N N 414 TRP H H N N 415 TRP H2 H N N 416 TRP HA H N N 417 TRP HB2 H N N 418 TRP HB3 H N N 419 TRP HD1 H N N 420 TRP HE1 H N N 421 TRP HE3 H N N 422 TRP HZ2 H N N 423 TRP HZ3 H N N 424 TRP HH2 H N N 425 TRP HXT H N N 426 TYR N N N N 427 TYR CA C N S 428 TYR C C N N 429 TYR O O N N 430 TYR CB C N N 431 TYR CG C Y N 432 TYR CD1 C Y N 433 TYR CD2 C Y N 434 TYR CE1 C Y N 435 TYR CE2 C Y N 436 TYR CZ C Y N 437 TYR OH O N N 438 TYR OXT O N N 439 TYR H H N N 440 TYR H2 H N N 441 TYR HA H N N 442 TYR HB2 H N N 443 TYR HB3 H N N 444 TYR HD1 H N N 445 TYR HD2 H N N 446 TYR HE1 H N N 447 TYR HE2 H N N 448 TYR HH H N N 449 TYR HXT H N N 450 VAL N N N N 451 VAL CA C N S 452 VAL C C N N 453 VAL O O N N 454 VAL CB C N N 455 VAL CG1 C N N 456 VAL CG2 C N N 457 VAL OXT O N N 458 VAL H H N N 459 VAL H2 H N N 460 VAL HA H N N 461 VAL HB H N N 462 VAL HG11 H N N 463 VAL HG12 H N N 464 VAL HG13 H N N 465 VAL HG21 H N N 466 VAL HG22 H N N 467 VAL HG23 H N N 468 VAL HXT H N N 469 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1I1L C17 C16 sing N N 1 A1I1L C17 C18 sing N N 2 A1I1L C17 O3 sing N N 3 A1I1L C16 C15 sing N N 4 A1I1L C18 C19 sing N N 5 A1I1L C21 C20 sing N N 6 A1I1L C15 C14 sing N N 7 A1I1L C15 C20 sing N N 8 A1I1L C14 C13 sing N N 9 A1I1L C20 C19 sing N N 10 A1I1L C20 C22 sing N N 11 A1I1L C13 C12 sing N N 12 A1I1L C22 C12 sing N N 13 A1I1L C22 C23 sing N N 14 A1I1L C12 C11 sing N N 15 A1I1L O4 C23 sing N N 16 A1I1L C23 C24 sing N N 17 A1I1L C11 C10 sing N N 18 A1I1L C11 C25 sing N N 19 A1I1L C26 C25 sing N N 20 A1I1L C10 C sing N N 21 A1I1L C24 C25 sing N N 22 A1I1L C25 C27 sing N N 23 A1I1L C7 C5 sing N N 24 A1I1L C C27 sing N N 25 A1I1L C O sing N N 26 A1I1L C27 C8 sing N N 27 A1I1L O1 C5 sing N N 28 A1I1L O1 C1 sing N N 29 A1I1L O C1 sing N N 30 A1I1L C5 C6 sing N N 31 A1I1L C5 C3 sing N N 32 A1I1L O2 C8 sing N N 33 A1I1L C1 C8 sing N N 34 A1I1L C1 C2 sing N N 35 A1I1L C8 C9 sing N N 36 A1I1L C4 C3 sing N N 37 A1I1L C3 C2 sing N N 38 A1I1L C7 H1 sing N N 39 A1I1L C7 H2 sing N N 40 A1I1L C7 H3 sing N N 41 A1I1L C9 H4 sing N N 42 A1I1L C9 H5 sing N N 43 A1I1L C9 H6 sing N N 44 A1I1L C6 H7 sing N N 45 A1I1L C6 H8 sing N N 46 A1I1L C6 H9 sing N N 47 A1I1L C4 H10 sing N N 48 A1I1L C4 H11 sing N N 49 A1I1L C4 H12 sing N N 50 A1I1L O4 H13 sing N N 51 A1I1L C3 H14 sing N N 52 A1I1L O3 H15 sing N N 53 A1I1L C2 H16 sing N N 54 A1I1L C2 H17 sing N N 55 A1I1L C H18 sing N N 56 A1I1L C10 H19 sing N N 57 A1I1L C10 H20 sing N N 58 A1I1L C11 H21 sing N N 59 A1I1L C12 H22 sing N N 60 A1I1L C13 H23 sing N N 61 A1I1L C13 H24 sing N N 62 A1I1L C14 H25 sing N N 63 A1I1L C14 H26 sing N N 64 A1I1L C15 H27 sing N N 65 A1I1L C16 H28 sing N N 66 A1I1L C16 H29 sing N N 67 A1I1L C17 H30 sing N N 68 A1I1L C18 H31 sing N N 69 A1I1L C18 H32 sing N N 70 A1I1L C19 H33 sing N N 71 A1I1L C19 H34 sing N N 72 A1I1L C21 H35 sing N N 73 A1I1L C21 H36 sing N N 74 A1I1L C21 H37 sing N N 75 A1I1L C22 H38 sing N N 76 A1I1L C23 H39 sing N N 77 A1I1L C24 H40 sing N N 78 A1I1L C24 H41 sing N N 79 A1I1L C26 H42 sing N N 80 A1I1L C26 H43 sing N N 81 A1I1L C26 H44 sing N N 82 A1I1L C27 H45 sing N N 83 A1I1L O2 H46 sing N N 84 ALA N CA sing N N 85 ALA N H sing N N 86 ALA N H2 sing N N 87 ALA CA C sing N N 88 ALA CA CB sing N N 89 ALA CA HA sing N N 90 ALA C O doub N N 91 ALA C OXT sing N N 92 ALA CB HB1 sing N N 93 ALA CB HB2 sing N N 94 ALA CB HB3 sing N N 95 ALA OXT HXT sing N N 96 ARG N CA sing N N 97 ARG N H sing N N 98 ARG N H2 sing N N 99 ARG CA C sing N N 100 ARG CA CB sing N N 101 ARG CA HA sing N N 102 ARG C O doub N N 103 ARG C OXT sing N N 104 ARG CB CG sing N N 105 ARG CB HB2 sing N N 106 ARG CB HB3 sing N N 107 ARG CG CD sing N N 108 ARG CG HG2 sing N N 109 ARG CG HG3 sing N N 110 ARG CD NE sing N N 111 ARG CD HD2 sing N N 112 ARG CD HD3 sing N N 113 ARG NE CZ sing N N 114 ARG NE HE sing N N 115 ARG CZ NH1 sing N N 116 ARG CZ NH2 doub N N 117 ARG NH1 HH11 sing N N 118 ARG NH1 HH12 sing N N 119 ARG NH2 HH21 sing N N 120 ARG NH2 HH22 sing N N 121 ARG OXT HXT sing N N 122 ASN N CA sing N N 123 ASN N H sing N N 124 ASN N H2 sing N N 125 ASN CA C sing N N 126 ASN CA CB sing N N 127 ASN CA HA sing N N 128 ASN C O doub N N 129 ASN C OXT sing N N 130 ASN CB CG sing N N 131 ASN CB HB2 sing N N 132 ASN CB HB3 sing N N 133 ASN CG OD1 doub N N 134 ASN CG ND2 sing N N 135 ASN ND2 HD21 sing N N 136 ASN ND2 HD22 sing N N 137 ASN OXT HXT sing N N 138 ASP N CA sing N N 139 ASP N H sing N N 140 ASP N H2 sing N N 141 ASP CA C sing N N 142 ASP CA CB sing N N 143 ASP CA HA sing N N 144 ASP C O doub N N 145 ASP C OXT sing N N 146 ASP CB CG sing N N 147 ASP CB HB2 sing N N 148 ASP CB HB3 sing N N 149 ASP CG OD1 doub N N 150 ASP CG OD2 sing N N 151 ASP OD2 HD2 sing N N 152 ASP OXT HXT sing N N 153 CYS N CA sing N N 154 CYS N H sing N N 155 CYS N H2 sing N N 156 CYS CA C sing N N 157 CYS CA CB sing N N 158 CYS CA HA sing N N 159 CYS C O doub N N 160 CYS C OXT sing N N 161 CYS CB SG sing N N 162 CYS CB HB2 sing N N 163 CYS CB HB3 sing N N 164 CYS SG HG sing N N 165 CYS OXT HXT sing N N 166 GLN N CA sing N N 167 GLN N H sing N N 168 GLN N H2 sing N N 169 GLN CA C sing N N 170 GLN CA CB sing N N 171 GLN CA HA sing N N 172 GLN C O doub N N 173 GLN C OXT sing N N 174 GLN CB CG sing N N 175 GLN CB HB2 sing N N 176 GLN CB HB3 sing N N 177 GLN CG CD sing N N 178 GLN CG HG2 sing N N 179 GLN CG HG3 sing N N 180 GLN CD OE1 doub N N 181 GLN CD NE2 sing N N 182 GLN NE2 HE21 sing N N 183 GLN NE2 HE22 sing N N 184 GLN OXT HXT sing N N 185 GLU N CA sing N N 186 GLU N H sing N N 187 GLU N H2 sing N N 188 GLU CA C sing N N 189 GLU CA CB sing N N 190 GLU CA HA sing N N 191 GLU C O doub N N 192 GLU C OXT sing N N 193 GLU CB CG sing N N 194 GLU CB HB2 sing N N 195 GLU CB HB3 sing N N 196 GLU CG CD sing N N 197 GLU CG HG2 sing N N 198 GLU CG HG3 sing N N 199 GLU CD OE1 doub N N 200 GLU CD OE2 sing N N 201 GLU OE2 HE2 sing N N 202 GLU OXT HXT sing N N 203 GLY N CA sing N N 204 GLY N H sing N N 205 GLY N H2 sing N N 206 GLY CA C sing N N 207 GLY CA HA2 sing N N 208 GLY CA HA3 sing N N 209 GLY C O doub N N 210 GLY C OXT sing N N 211 GLY OXT HXT sing N N 212 HIS N CA sing N N 213 HIS N H sing N N 214 HIS N H2 sing N N 215 HIS CA C sing N N 216 HIS CA CB sing N N 217 HIS CA HA sing N N 218 HIS C O doub N N 219 HIS C OXT sing N N 220 HIS CB CG sing N N 221 HIS CB HB2 sing N N 222 HIS CB HB3 sing N N 223 HIS CG ND1 sing Y N 224 HIS CG CD2 doub Y N 225 HIS ND1 CE1 doub Y N 226 HIS ND1 HD1 sing N N 227 HIS CD2 NE2 sing Y N 228 HIS CD2 HD2 sing N N 229 HIS CE1 NE2 sing Y N 230 HIS CE1 HE1 sing N N 231 HIS NE2 HE2 sing N N 232 HIS OXT HXT sing N N 233 HOH O H1 sing N N 234 HOH O H2 sing N N 235 ILE N CA sing N N 236 ILE N H sing N N 237 ILE N H2 sing N N 238 ILE CA C sing N N 239 ILE CA CB sing N N 240 ILE CA HA sing N N 241 ILE C O doub N N 242 ILE C OXT sing N N 243 ILE CB CG1 sing N N 244 ILE CB CG2 sing N N 245 ILE CB HB sing N N 246 ILE CG1 CD1 sing N N 247 ILE CG1 HG12 sing N N 248 ILE CG1 HG13 sing N N 249 ILE CG2 HG21 sing N N 250 ILE CG2 HG22 sing N N 251 ILE CG2 HG23 sing N N 252 ILE CD1 HD11 sing N N 253 ILE CD1 HD12 sing N N 254 ILE CD1 HD13 sing N N 255 ILE OXT HXT sing N N 256 LEU N CA sing N N 257 LEU N H sing N N 258 LEU N H2 sing N N 259 LEU CA C sing N N 260 LEU CA CB sing N N 261 LEU CA HA sing N N 262 LEU C O doub N N 263 LEU C OXT sing N N 264 LEU CB CG sing N N 265 LEU CB HB2 sing N N 266 LEU CB HB3 sing N N 267 LEU CG CD1 sing N N 268 LEU CG CD2 sing N N 269 LEU CG HG sing N N 270 LEU CD1 HD11 sing N N 271 LEU CD1 HD12 sing N N 272 LEU CD1 HD13 sing N N 273 LEU CD2 HD21 sing N N 274 LEU CD2 HD22 sing N N 275 LEU CD2 HD23 sing N N 276 LEU OXT HXT sing N N 277 LYS N CA sing N N 278 LYS N H sing N N 279 LYS N H2 sing N N 280 LYS CA C sing N N 281 LYS CA CB sing N N 282 LYS CA HA sing N N 283 LYS C O doub N N 284 LYS C OXT sing N N 285 LYS CB CG sing N N 286 LYS CB HB2 sing N N 287 LYS CB HB3 sing N N 288 LYS CG CD sing N N 289 LYS CG HG2 sing N N 290 LYS CG HG3 sing N N 291 LYS CD CE sing N N 292 LYS CD HD2 sing N N 293 LYS CD HD3 sing N N 294 LYS CE NZ sing N N 295 LYS CE HE2 sing N N 296 LYS CE HE3 sing N N 297 LYS NZ HZ1 sing N N 298 LYS NZ HZ2 sing N N 299 LYS NZ HZ3 sing N N 300 LYS OXT HXT sing N N 301 MET N CA sing N N 302 MET N H sing N N 303 MET N H2 sing N N 304 MET CA C sing N N 305 MET CA CB sing N N 306 MET CA HA sing N N 307 MET C O doub N N 308 MET C OXT sing N N 309 MET CB CG sing N N 310 MET CB HB2 sing N N 311 MET CB HB3 sing N N 312 MET CG SD sing N N 313 MET CG HG2 sing N N 314 MET CG HG3 sing N N 315 MET SD CE sing N N 316 MET CE HE1 sing N N 317 MET CE HE2 sing N N 318 MET CE HE3 sing N N 319 MET OXT HXT sing N N 320 PHE N CA sing N N 321 PHE N H sing N N 322 PHE N H2 sing N N 323 PHE CA C sing N N 324 PHE CA CB sing N N 325 PHE CA HA sing N N 326 PHE C O doub N N 327 PHE C OXT sing N N 328 PHE CB CG sing N N 329 PHE CB HB2 sing N N 330 PHE CB HB3 sing N N 331 PHE CG CD1 doub Y N 332 PHE CG CD2 sing Y N 333 PHE CD1 CE1 sing Y N 334 PHE CD1 HD1 sing N N 335 PHE CD2 CE2 doub Y N 336 PHE CD2 HD2 sing N N 337 PHE CE1 CZ doub Y N 338 PHE CE1 HE1 sing N N 339 PHE CE2 CZ sing Y N 340 PHE CE2 HE2 sing N N 341 PHE CZ HZ sing N N 342 PHE OXT HXT sing N N 343 PRO N CA sing N N 344 PRO N CD sing N N 345 PRO N H sing N N 346 PRO CA C sing N N 347 PRO CA CB sing N N 348 PRO CA HA sing N N 349 PRO C O doub N N 350 PRO C OXT sing N N 351 PRO CB CG sing N N 352 PRO CB HB2 sing N N 353 PRO CB HB3 sing N N 354 PRO CG CD sing N N 355 PRO CG HG2 sing N N 356 PRO CG HG3 sing N N 357 PRO CD HD2 sing N N 358 PRO CD HD3 sing N N 359 PRO OXT HXT sing N N 360 SER N CA sing N N 361 SER N H sing N N 362 SER N H2 sing N N 363 SER CA C sing N N 364 SER CA CB sing N N 365 SER CA HA sing N N 366 SER C O doub N N 367 SER C OXT sing N N 368 SER CB OG sing N N 369 SER CB HB2 sing N N 370 SER CB HB3 sing N N 371 SER OG HG sing N N 372 SER OXT HXT sing N N 373 THR N CA sing N N 374 THR N H sing N N 375 THR N H2 sing N N 376 THR CA C sing N N 377 THR CA CB sing N N 378 THR CA HA sing N N 379 THR C O doub N N 380 THR C OXT sing N N 381 THR CB OG1 sing N N 382 THR CB CG2 sing N N 383 THR CB HB sing N N 384 THR OG1 HG1 sing N N 385 THR CG2 HG21 sing N N 386 THR CG2 HG22 sing N N 387 THR CG2 HG23 sing N N 388 THR OXT HXT sing N N 389 TRP N CA sing N N 390 TRP N H sing N N 391 TRP N H2 sing N N 392 TRP CA C sing N N 393 TRP CA CB sing N N 394 TRP CA HA sing N N 395 TRP C O doub N N 396 TRP C OXT sing N N 397 TRP CB CG sing N N 398 TRP CB HB2 sing N N 399 TRP CB HB3 sing N N 400 TRP CG CD1 doub Y N 401 TRP CG CD2 sing Y N 402 TRP CD1 NE1 sing Y N 403 TRP CD1 HD1 sing N N 404 TRP CD2 CE2 doub Y N 405 TRP CD2 CE3 sing Y N 406 TRP NE1 CE2 sing Y N 407 TRP NE1 HE1 sing N N 408 TRP CE2 CZ2 sing Y N 409 TRP CE3 CZ3 doub Y N 410 TRP CE3 HE3 sing N N 411 TRP CZ2 CH2 doub Y N 412 TRP CZ2 HZ2 sing N N 413 TRP CZ3 CH2 sing Y N 414 TRP CZ3 HZ3 sing N N 415 TRP CH2 HH2 sing N N 416 TRP OXT HXT sing N N 417 TYR N CA sing N N 418 TYR N H sing N N 419 TYR N H2 sing N N 420 TYR CA C sing N N 421 TYR CA CB sing N N 422 TYR CA HA sing N N 423 TYR C O doub N N 424 TYR C OXT sing N N 425 TYR CB CG sing N N 426 TYR CB HB2 sing N N 427 TYR CB HB3 sing N N 428 TYR CG CD1 doub Y N 429 TYR CG CD2 sing Y N 430 TYR CD1 CE1 sing Y N 431 TYR CD1 HD1 sing N N 432 TYR CD2 CE2 doub Y N 433 TYR CD2 HD2 sing N N 434 TYR CE1 CZ doub Y N 435 TYR CE1 HE1 sing N N 436 TYR CE2 CZ sing Y N 437 TYR CE2 HE2 sing N N 438 TYR CZ OH sing N N 439 TYR OH HH sing N N 440 TYR OXT HXT sing N N 441 VAL N CA sing N N 442 VAL N H sing N N 443 VAL N H2 sing N N 444 VAL CA C sing N N 445 VAL CA CB sing N N 446 VAL CA HA sing N N 447 VAL C O doub N N 448 VAL C OXT sing N N 449 VAL CB CG1 sing N N 450 VAL CB CG2 sing N N 451 VAL CB HB sing N N 452 VAL CG1 HG11 sing N N 453 VAL CG1 HG12 sing N N 454 VAL CG1 HG13 sing N N 455 VAL CG2 HG21 sing N N 456 VAL CG2 HG22 sing N N 457 VAL CG2 HG23 sing N N 458 VAL OXT HXT sing N N 459 # _pdbx_audit_support.funding_organization 'Cancer Research UK' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'eIF4A1 C-terminal domain' # _atom_sites.entry_id 9I9G _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.032052 _atom_sites.fract_transf_matrix[1][2] -0.005051 _atom_sites.fract_transf_matrix[1][3] -0.007968 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.030701 _atom_sites.fract_transf_matrix[2][3] -0.005982 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027961 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 H 1 1 0.4930 10.5109 0.3229 26.1257 0.1402 3.1424 0.0408 57.7997 0.0030 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.0486 # loop_ #