data_9IAE # _entry.id 9IAE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9IAE pdb_00009iae 10.2210/pdb9iae/pdb WWPDB D_1292145394 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-01-28 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9IAE _pdbx_database_status.recvd_initial_deposition_date 2025-02-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email mickael.blaise@irim.cnrs.fr _pdbx_contact_author.name_first Mickael _pdbx_contact_author.name_last Blaise _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7860-3464 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Arnaud-Arnould, M.' 1 0000-0003-2799-1011 'Rebendenne, A.' 2 0000-0001-8913-837X 'Tauziet, M.' 3 0000-0001-7924-0055 'Urbach, S.' 4 0000-0001-8663-2006 'El Koulali, K.' 5 0000-0001-7273-3383 'Ricci, E.' 6 0000-0002-9789-5837 'Wencker, M.' 7 0000-0003-4200-0079 'Moncorge, O.' 8 0000-0003-0512-1824 'Blaise, M.' 9 0000-0002-7860-3464 'Goujon, C.' 10 0000-0001-8571-1108 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biorxiv _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2692-8205 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'SNX-BAR proteins 5 and 6 are required for NCOA7-AS antiviral activity against influenza A virus' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1101/2025.04.01.646557 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Arnaud-Arnould, M.' 1 ? primary 'Rebendenne, A.' 2 ? primary 'Tauziet, M.' 3 ? primary 'Urbach, S.' 4 ? primary 'El Koulali, K.' 5 ? primary 'Ricci, E.' 6 ? primary 'Wencker, M.' 7 ? primary 'Moncorge, O.' 8 ? primary 'Blaise, M.' 9 ? primary 'Goujon, C.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Sorting nexin-5,Nuclear receptor coactivator 7' 20698.514 1 ? ? ? ;This protein is a fusion protein and thus a chimeric protein made of the human Phox domain of the SNX5 protein and the N-terminal domain of the human NCOA7-AS protein. The first glycine is an additionnal residue coming from the TEV protease cleavage site,This protein is a fusion protein and thus a chimeric protein made of the human Phox domain of the SNX5 protein and the N-terminal domain of the human NCOA7-AS protein. The first glycine is an additionnal residue coming from the TEV protease cleavage site,This protein is a fusion protein and thus a chimeric protein made of the human Phox domain of the SNX5 protein and the N-terminal domain of the human NCOA7-AS protein. The first glycine is an additionnal residue coming from the TEV protease cleavage site,This protein is a fusion protein and thus a chimeric protein made of the human Phox domain of the SNX5 protein and the N-terminal domain of the human NCOA7-AS protein. The first glycine is an additionnal residue coming from the TEV protease cleavage site ; 2 water nat water 18.015 161 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPR EKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQRLPLDIQIFY (CME)ARPDEEPFVKIITVEEAKRR ; _entity_poly.pdbx_seq_one_letter_code_can ;GLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPR EKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQRLPLDIQIFYCAR PDEEPFVKIITVEEAKRR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 ASN n 1 4 VAL n 1 5 ASP n 1 6 PRO n 1 7 SER n 1 8 LEU n 1 9 GLN n 1 10 ILE n 1 11 ASP n 1 12 ILE n 1 13 PRO n 1 14 ASP n 1 15 ALA n 1 16 LEU n 1 17 SER n 1 18 GLU n 1 19 ARG n 1 20 ASP n 1 21 LYS n 1 22 VAL n 1 23 LYS n 1 24 PHE n 1 25 THR n 1 26 VAL n 1 27 HIS n 1 28 THR n 1 29 LYS n 1 30 THR n 1 31 THR n 1 32 LEU n 1 33 PRO n 1 34 THR n 1 35 PHE n 1 36 GLN n 1 37 SER n 1 38 PRO n 1 39 GLU n 1 40 PHE n 1 41 SER n 1 42 VAL n 1 43 THR n 1 44 ARG n 1 45 GLN n 1 46 HIS n 1 47 GLU n 1 48 ASP n 1 49 PHE n 1 50 VAL n 1 51 TRP n 1 52 LEU n 1 53 HIS n 1 54 ASP n 1 55 THR n 1 56 LEU n 1 57 ILE n 1 58 GLU n 1 59 THR n 1 60 THR n 1 61 ASP n 1 62 TYR n 1 63 ALA n 1 64 GLY n 1 65 LEU n 1 66 ILE n 1 67 ILE n 1 68 PRO n 1 69 PRO n 1 70 ALA n 1 71 PRO n 1 72 THR n 1 73 LYS n 1 74 PRO n 1 75 ASP n 1 76 PHE n 1 77 ASP n 1 78 GLY n 1 79 PRO n 1 80 ARG n 1 81 GLU n 1 82 LYS n 1 83 MET n 1 84 GLN n 1 85 LYS n 1 86 LEU n 1 87 GLY n 1 88 GLU n 1 89 GLY n 1 90 GLU n 1 91 GLY n 1 92 SER n 1 93 MET n 1 94 THR n 1 95 LYS n 1 96 GLU n 1 97 GLU n 1 98 PHE n 1 99 ALA n 1 100 LYS n 1 101 MET n 1 102 LYS n 1 103 GLN n 1 104 GLU n 1 105 LEU n 1 106 GLU n 1 107 ALA n 1 108 GLU n 1 109 TYR n 1 110 LEU n 1 111 ALA n 1 112 VAL n 1 113 PHE n 1 114 LYS n 1 115 LYS n 1 116 THR n 1 117 VAL n 1 118 SER n 1 119 SER n 1 120 HIS n 1 121 GLU n 1 122 VAL n 1 123 PHE n 1 124 LEU n 1 125 GLN n 1 126 ARG n 1 127 LEU n 1 128 SER n 1 129 SER n 1 130 HIS n 1 131 PRO n 1 132 VAL n 1 133 LEU n 1 134 SER n 1 135 LYS n 1 136 ASP n 1 137 ARG n 1 138 ASN n 1 139 PHE n 1 140 HIS n 1 141 VAL n 1 142 PHE n 1 143 LEU n 1 144 GLU n 1 145 TYR n 1 146 ASP n 1 147 GLN n 1 148 ARG n 1 149 LEU n 1 150 PRO n 1 151 LEU n 1 152 ASP n 1 153 ILE n 1 154 GLN n 1 155 ILE n 1 156 PHE n 1 157 TYR n 1 158 CME n 1 159 ALA n 1 160 ARG n 1 161 PRO n 1 162 ASP n 1 163 GLU n 1 164 GLU n 1 165 PRO n 1 166 PHE n 1 167 VAL n 1 168 LYS n 1 169 ILE n 1 170 ILE n 1 171 THR n 1 172 VAL n 1 173 GLU n 1 174 GLU n 1 175 ALA n 1 176 LYS n 1 177 ARG n 1 178 ARG n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 147 human ? SNX5 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 148 178 human ? NCOA7 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CME 'L-peptide linking' n 'S,S-(2-HYDROXYETHYL)THIOCYSTEINE' ? 'C5 H11 N O3 S2' 197.276 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 24 ? ? ? A . n A 1 2 LEU 2 25 ? ? ? A . n A 1 3 ASN 3 26 ? ? ? A . n A 1 4 VAL 4 27 ? ? ? A . n A 1 5 ASP 5 28 ? ? ? A . n A 1 6 PRO 6 29 29 PRO PRO A . n A 1 7 SER 7 30 30 SER SER A . n A 1 8 LEU 8 31 31 LEU LEU A . n A 1 9 GLN 9 32 32 GLN GLN A . n A 1 10 ILE 10 33 33 ILE ILE A . n A 1 11 ASP 11 34 34 ASP ASP A . n A 1 12 ILE 12 35 35 ILE ILE A . n A 1 13 PRO 13 36 36 PRO PRO A . n A 1 14 ASP 14 37 37 ASP ASP A . n A 1 15 ALA 15 38 38 ALA ALA A . n A 1 16 LEU 16 39 39 LEU LEU A . n A 1 17 SER 17 40 40 SER SER A . n A 1 18 GLU 18 41 41 GLU GLU A . n A 1 19 ARG 19 42 42 ARG ARG A . n A 1 20 ASP 20 43 43 ASP ASP A . n A 1 21 LYS 21 44 44 LYS LYS A . n A 1 22 VAL 22 45 45 VAL VAL A . n A 1 23 LYS 23 46 46 LYS LYS A . n A 1 24 PHE 24 47 47 PHE PHE A . n A 1 25 THR 25 48 48 THR THR A . n A 1 26 VAL 26 49 49 VAL VAL A . n A 1 27 HIS 27 50 50 HIS HIS A . n A 1 28 THR 28 51 51 THR THR A . n A 1 29 LYS 29 52 52 LYS LYS A . n A 1 30 THR 30 53 53 THR THR A . n A 1 31 THR 31 54 54 THR THR A . n A 1 32 LEU 32 55 55 LEU LEU A . n A 1 33 PRO 33 56 56 PRO PRO A . n A 1 34 THR 34 57 57 THR THR A . n A 1 35 PHE 35 58 58 PHE PHE A . n A 1 36 GLN 36 59 59 GLN GLN A . n A 1 37 SER 37 60 60 SER SER A . n A 1 38 PRO 38 61 61 PRO PRO A . n A 1 39 GLU 39 62 62 GLU GLU A . n A 1 40 PHE 40 63 63 PHE PHE A . n A 1 41 SER 41 64 64 SER SER A . n A 1 42 VAL 42 65 65 VAL VAL A . n A 1 43 THR 43 66 66 THR THR A . n A 1 44 ARG 44 67 67 ARG ARG A . n A 1 45 GLN 45 68 68 GLN GLN A . n A 1 46 HIS 46 69 69 HIS HIS A . n A 1 47 GLU 47 70 70 GLU GLU A . n A 1 48 ASP 48 71 71 ASP ASP A . n A 1 49 PHE 49 72 72 PHE PHE A . n A 1 50 VAL 50 73 73 VAL VAL A . n A 1 51 TRP 51 74 74 TRP TRP A . n A 1 52 LEU 52 75 75 LEU LEU A . n A 1 53 HIS 53 76 76 HIS HIS A . n A 1 54 ASP 54 77 77 ASP ASP A . n A 1 55 THR 55 78 78 THR THR A . n A 1 56 LEU 56 79 79 LEU LEU A . n A 1 57 ILE 57 80 80 ILE ILE A . n A 1 58 GLU 58 81 81 GLU GLU A . n A 1 59 THR 59 82 82 THR THR A . n A 1 60 THR 60 83 83 THR THR A . n A 1 61 ASP 61 84 84 ASP ASP A . n A 1 62 TYR 62 85 85 TYR TYR A . n A 1 63 ALA 63 86 86 ALA ALA A . n A 1 64 GLY 64 87 87 GLY GLY A . n A 1 65 LEU 65 88 88 LEU LEU A . n A 1 66 ILE 66 89 89 ILE ILE A . n A 1 67 ILE 67 90 90 ILE ILE A . n A 1 68 PRO 68 91 91 PRO PRO A . n A 1 69 PRO 69 92 92 PRO PRO A . n A 1 70 ALA 70 93 93 ALA ALA A . n A 1 71 PRO 71 94 94 PRO PRO A . n A 1 72 THR 72 95 95 THR THR A . n A 1 73 LYS 73 96 96 LYS LYS A . n A 1 74 PRO 74 97 97 PRO PRO A . n A 1 75 ASP 75 98 98 ASP ASP A . n A 1 76 PHE 76 99 99 PHE PHE A . n A 1 77 ASP 77 100 100 ASP ASP A . n A 1 78 GLY 78 101 101 GLY GLY A . n A 1 79 PRO 79 102 102 PRO PRO A . n A 1 80 ARG 80 103 103 ARG ARG A . n A 1 81 GLU 81 104 104 GLU GLU A . n A 1 82 LYS 82 105 105 LYS LYS A . n A 1 83 MET 83 106 106 MET MET A . n A 1 84 GLN 84 107 107 GLN GLN A . n A 1 85 LYS 85 108 108 LYS LYS A . n A 1 86 LEU 86 109 109 LEU LEU A . n A 1 87 GLY 87 110 110 GLY GLY A . n A 1 88 GLU 88 111 111 GLU GLU A . n A 1 89 GLY 89 112 112 GLY GLY A . n A 1 90 GLU 90 113 113 GLU GLU A . n A 1 91 GLY 91 114 114 GLY GLY A . n A 1 92 SER 92 115 115 SER SER A . n A 1 93 MET 93 116 116 MET MET A . n A 1 94 THR 94 117 117 THR THR A . n A 1 95 LYS 95 118 118 LYS LYS A . n A 1 96 GLU 96 119 119 GLU GLU A . n A 1 97 GLU 97 120 120 GLU GLU A . n A 1 98 PHE 98 121 121 PHE PHE A . n A 1 99 ALA 99 122 122 ALA ALA A . n A 1 100 LYS 100 123 123 LYS LYS A . n A 1 101 MET 101 124 124 MET MET A . n A 1 102 LYS 102 125 125 LYS LYS A . n A 1 103 GLN 103 126 126 GLN GLN A . n A 1 104 GLU 104 127 127 GLU GLU A . n A 1 105 LEU 105 128 128 LEU LEU A . n A 1 106 GLU 106 129 129 GLU GLU A . n A 1 107 ALA 107 130 130 ALA ALA A . n A 1 108 GLU 108 131 131 GLU GLU A . n A 1 109 TYR 109 132 132 TYR TYR A . n A 1 110 LEU 110 133 133 LEU LEU A . n A 1 111 ALA 111 134 134 ALA ALA A . n A 1 112 VAL 112 135 135 VAL VAL A . n A 1 113 PHE 113 136 136 PHE PHE A . n A 1 114 LYS 114 137 137 LYS LYS A . n A 1 115 LYS 115 138 138 LYS LYS A . n A 1 116 THR 116 139 139 THR THR A . n A 1 117 VAL 117 140 140 VAL VAL A . n A 1 118 SER 118 141 141 SER SER A . n A 1 119 SER 119 142 142 SER SER A . n A 1 120 HIS 120 143 143 HIS HIS A . n A 1 121 GLU 121 144 144 GLU GLU A . n A 1 122 VAL 122 145 145 VAL VAL A . n A 1 123 PHE 123 146 146 PHE PHE A . n A 1 124 LEU 124 147 147 LEU LEU A . n A 1 125 GLN 125 148 148 GLN GLN A . n A 1 126 ARG 126 149 149 ARG ARG A . n A 1 127 LEU 127 150 150 LEU LEU A . n A 1 128 SER 128 151 151 SER SER A . n A 1 129 SER 129 152 152 SER SER A . n A 1 130 HIS 130 153 153 HIS HIS A . n A 1 131 PRO 131 154 154 PRO PRO A . n A 1 132 VAL 132 155 155 VAL VAL A . n A 1 133 LEU 133 156 156 LEU LEU A . n A 1 134 SER 134 157 157 SER SER A . n A 1 135 LYS 135 158 158 LYS LYS A . n A 1 136 ASP 136 159 159 ASP ASP A . n A 1 137 ARG 137 160 160 ARG ARG A . n A 1 138 ASN 138 161 161 ASN ASN A . n A 1 139 PHE 139 162 162 PHE PHE A . n A 1 140 HIS 140 163 163 HIS HIS A . n A 1 141 VAL 141 164 164 VAL VAL A . n A 1 142 PHE 142 165 165 PHE PHE A . n A 1 143 LEU 143 166 166 LEU LEU A . n A 1 144 GLU 144 167 167 GLU GLU A . n A 1 145 TYR 145 168 168 TYR TYR A . n A 1 146 ASP 146 169 169 ASP ASP A . n A 1 147 GLN 147 170 170 GLN GLN A . n A 1 148 ARG 148 171 171 ARG ARG A . n A 1 149 LEU 149 172 172 LEU LEU A . n A 1 150 PRO 150 173 173 PRO PRO A . n A 1 151 LEU 151 174 174 LEU LEU A . n A 1 152 ASP 152 175 175 ASP ASP A . n A 1 153 ILE 153 176 176 ILE ILE A . n A 1 154 GLN 154 177 177 GLN GLN A . n A 1 155 ILE 155 178 178 ILE ILE A . n A 1 156 PHE 156 179 179 PHE PHE A . n A 1 157 TYR 157 180 180 TYR TYR A . n A 1 158 CME 158 181 181 CME CME A . n A 1 159 ALA 159 182 182 ALA ALA A . n A 1 160 ARG 160 183 183 ARG ARG A . n A 1 161 PRO 161 184 184 PRO PRO A . n A 1 162 ASP 162 185 185 ASP ASP A . n A 1 163 GLU 163 186 186 GLU GLU A . n A 1 164 GLU 164 187 187 GLU GLU A . n A 1 165 PRO 165 188 188 PRO PRO A . n A 1 166 PHE 166 189 189 PHE PHE A . n A 1 167 VAL 167 190 190 VAL VAL A . n A 1 168 LYS 168 191 191 LYS LYS A . n A 1 169 ILE 169 192 192 ILE ILE A . n A 1 170 ILE 170 193 193 ILE ILE A . n A 1 171 THR 171 194 194 THR THR A . n A 1 172 VAL 172 195 195 VAL VAL A . n A 1 173 GLU 173 196 196 GLU GLU A . n A 1 174 GLU 174 197 197 GLU GLU A . n A 1 175 ALA 175 198 198 ALA ALA A . n A 1 176 LYS 176 199 199 LYS LYS A . n A 1 177 ARG 177 200 200 ARG ARG A . n A 1 178 ARG 178 201 201 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 37 HOH HOH A . B 2 HOH 2 302 91 HOH HOH A . B 2 HOH 3 303 39 HOH HOH A . B 2 HOH 4 304 49 HOH HOH A . B 2 HOH 5 305 80 HOH HOH A . B 2 HOH 6 306 100 HOH HOH A . B 2 HOH 7 307 70 HOH HOH A . B 2 HOH 8 308 220 HOH HOH A . B 2 HOH 9 309 56 HOH HOH A . B 2 HOH 10 310 157 HOH HOH A . B 2 HOH 11 311 89 HOH HOH A . B 2 HOH 12 312 178 HOH HOH A . B 2 HOH 13 313 68 HOH HOH A . B 2 HOH 14 314 10 HOH HOH A . B 2 HOH 15 315 5 HOH HOH A . B 2 HOH 16 316 50 HOH HOH A . B 2 HOH 17 317 45 HOH HOH A . B 2 HOH 18 318 47 HOH HOH A . B 2 HOH 19 319 22 HOH HOH A . B 2 HOH 20 320 118 HOH HOH A . B 2 HOH 21 321 24 HOH HOH A . B 2 HOH 22 322 486 HOH HOH A . B 2 HOH 23 323 79 HOH HOH A . B 2 HOH 24 324 16 HOH HOH A . B 2 HOH 25 325 78 HOH HOH A . B 2 HOH 26 326 81 HOH HOH A . B 2 HOH 27 327 261 HOH HOH A . B 2 HOH 28 328 31 HOH HOH A . B 2 HOH 29 329 77 HOH HOH A . B 2 HOH 30 330 2 HOH HOH A . B 2 HOH 31 331 12 HOH HOH A . B 2 HOH 32 332 36 HOH HOH A . B 2 HOH 33 333 132 HOH HOH A . B 2 HOH 34 334 505 HOH HOH A . B 2 HOH 35 335 21 HOH HOH A . B 2 HOH 36 336 186 HOH HOH A . B 2 HOH 37 337 53 HOH HOH A . B 2 HOH 38 338 41 HOH HOH A . B 2 HOH 39 339 13 HOH HOH A . B 2 HOH 40 340 312 HOH HOH A . B 2 HOH 41 341 25 HOH HOH A . B 2 HOH 42 342 11 HOH HOH A . B 2 HOH 43 343 130 HOH HOH A . B 2 HOH 44 344 128 HOH HOH A . B 2 HOH 45 345 72 HOH HOH A . B 2 HOH 46 346 33 HOH HOH A . B 2 HOH 47 347 6 HOH HOH A . B 2 HOH 48 348 83 HOH HOH A . B 2 HOH 49 349 104 HOH HOH A . B 2 HOH 50 350 18 HOH HOH A . B 2 HOH 51 351 69 HOH HOH A . B 2 HOH 52 352 73 HOH HOH A . B 2 HOH 53 353 14 HOH HOH A . B 2 HOH 54 354 92 HOH HOH A . B 2 HOH 55 355 58 HOH HOH A . B 2 HOH 56 356 8 HOH HOH A . B 2 HOH 57 357 20 HOH HOH A . B 2 HOH 58 358 34 HOH HOH A . B 2 HOH 59 359 28 HOH HOH A . B 2 HOH 60 360 134 HOH HOH A . B 2 HOH 61 361 71 HOH HOH A . B 2 HOH 62 362 26 HOH HOH A . B 2 HOH 63 363 4 HOH HOH A . B 2 HOH 64 364 3 HOH HOH A . B 2 HOH 65 365 7 HOH HOH A . B 2 HOH 66 366 54 HOH HOH A . B 2 HOH 67 367 44 HOH HOH A . B 2 HOH 68 368 82 HOH HOH A . B 2 HOH 69 369 32 HOH HOH A . B 2 HOH 70 370 97 HOH HOH A . B 2 HOH 71 371 61 HOH HOH A . B 2 HOH 72 372 99 HOH HOH A . B 2 HOH 73 373 57 HOH HOH A . B 2 HOH 74 374 48 HOH HOH A . B 2 HOH 75 375 9 HOH HOH A . B 2 HOH 76 376 87 HOH HOH A . B 2 HOH 77 377 29 HOH HOH A . B 2 HOH 78 378 23 HOH HOH A . B 2 HOH 79 379 428 HOH HOH A . B 2 HOH 80 380 332 HOH HOH A . B 2 HOH 81 381 148 HOH HOH A . B 2 HOH 82 382 17 HOH HOH A . B 2 HOH 83 383 15 HOH HOH A . B 2 HOH 84 384 46 HOH HOH A . B 2 HOH 85 385 62 HOH HOH A . B 2 HOH 86 386 66 HOH HOH A . B 2 HOH 87 387 43 HOH HOH A . B 2 HOH 88 388 51 HOH HOH A . B 2 HOH 89 389 40 HOH HOH A . B 2 HOH 90 390 60 HOH HOH A . B 2 HOH 91 391 30 HOH HOH A . B 2 HOH 92 392 105 HOH HOH A . B 2 HOH 93 393 488 HOH HOH A . B 2 HOH 94 394 76 HOH HOH A . B 2 HOH 95 395 93 HOH HOH A . B 2 HOH 96 396 64 HOH HOH A . B 2 HOH 97 397 85 HOH HOH A . B 2 HOH 98 398 107 HOH HOH A . B 2 HOH 99 399 114 HOH HOH A . B 2 HOH 100 400 126 HOH HOH A . B 2 HOH 101 401 42 HOH HOH A . B 2 HOH 102 402 35 HOH HOH A . B 2 HOH 103 403 407 HOH HOH A . B 2 HOH 104 404 88 HOH HOH A . B 2 HOH 105 405 38 HOH HOH A . B 2 HOH 106 406 95 HOH HOH A . B 2 HOH 107 407 153 HOH HOH A . B 2 HOH 108 408 90 HOH HOH A . B 2 HOH 109 409 386 HOH HOH A . B 2 HOH 110 410 165 HOH HOH A . B 2 HOH 111 411 112 HOH HOH A . B 2 HOH 112 412 108 HOH HOH A . B 2 HOH 113 413 499 HOH HOH A . B 2 HOH 114 414 329 HOH HOH A . B 2 HOH 115 415 119 HOH HOH A . B 2 HOH 116 416 170 HOH HOH A . B 2 HOH 117 417 232 HOH HOH A . B 2 HOH 118 418 445 HOH HOH A . B 2 HOH 119 419 152 HOH HOH A . B 2 HOH 120 420 52 HOH HOH A . B 2 HOH 121 421 94 HOH HOH A . B 2 HOH 122 422 257 HOH HOH A . B 2 HOH 123 423 166 HOH HOH A . B 2 HOH 124 424 135 HOH HOH A . B 2 HOH 125 425 137 HOH HOH A . B 2 HOH 126 426 164 HOH HOH A . B 2 HOH 127 427 109 HOH HOH A . B 2 HOH 128 428 171 HOH HOH A . B 2 HOH 129 429 304 HOH HOH A . B 2 HOH 130 430 84 HOH HOH A . B 2 HOH 131 431 227 HOH HOH A . B 2 HOH 132 432 131 HOH HOH A . B 2 HOH 133 433 277 HOH HOH A . B 2 HOH 134 434 103 HOH HOH A . B 2 HOH 135 435 106 HOH HOH A . B 2 HOH 136 436 138 HOH HOH A . B 2 HOH 137 437 149 HOH HOH A . B 2 HOH 138 438 250 HOH HOH A . B 2 HOH 139 439 194 HOH HOH A . B 2 HOH 140 440 27 HOH HOH A . B 2 HOH 141 441 260 HOH HOH A . B 2 HOH 142 442 86 HOH HOH A . B 2 HOH 143 443 136 HOH HOH A . B 2 HOH 144 444 213 HOH HOH A . B 2 HOH 145 445 146 HOH HOH A . B 2 HOH 146 446 140 HOH HOH A . B 2 HOH 147 447 59 HOH HOH A . B 2 HOH 148 448 206 HOH HOH A . B 2 HOH 149 449 101 HOH HOH A . B 2 HOH 150 450 127 HOH HOH A . B 2 HOH 151 451 74 HOH HOH A . B 2 HOH 152 452 181 HOH HOH A . B 2 HOH 153 453 151 HOH HOH A . B 2 HOH 154 454 98 HOH HOH A . B 2 HOH 155 455 116 HOH HOH A . B 2 HOH 156 456 273 HOH HOH A . B 2 HOH 157 457 421 HOH HOH A . B 2 HOH 158 458 286 HOH HOH A . B 2 HOH 159 459 141 HOH HOH A . B 2 HOH 160 460 253 HOH HOH A . B 2 HOH 161 461 282 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21rc1_5008 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9IAE _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.130 _cell.length_a_esd ? _cell.length_b 63.130 _cell.length_b_esd ? _cell.length_c 101.510 _cell.length_c_esd ? _cell.volume 350357.212 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9IAE _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9IAE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.6 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.2 M Calcium acetate hydrate 0.1 M Sodium Cacodylate pH 6.5 18% PEG 8000 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-22 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06DA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06DA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 37.38 _reflns.entry_id 9IAE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 48.13 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10729 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.02 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.193 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.4 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1269 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 20.14 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.66 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.755 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 44.91 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9IAE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 48.13 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10727 _refine.ls_number_reflns_R_free 1076 _refine.ls_number_reflns_R_work 9651 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.61 _refine.ls_percent_reflns_R_free 10.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2053 _refine.ls_R_factor_R_free 0.2404 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2011 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.8117 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2890 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 48.13 _refine_hist.number_atoms_solvent 161 _refine_hist.number_atoms_total 1584 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1423 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0024 ? 1472 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4543 ? 1991 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0560 ? 217 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0040 ? 258 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.9364 ? 564 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.30 2.40 . . 132 1200 100.00 . . . . 0.2470 . . . . . . . . . . . 0.3462 'X-RAY DIFFRACTION' 2.40 2.53 . . 135 1218 100.00 . . . . 0.2387 . . . . . . . . . . . 0.2709 'X-RAY DIFFRACTION' 2.53 2.69 . . 134 1175 100.00 . . . . 0.2591 . . . . . . . . . . . 0.3159 'X-RAY DIFFRACTION' 2.69 2.90 . . 133 1219 99.93 . . . . 0.2192 . . . . . . . . . . . 0.3258 'X-RAY DIFFRACTION' 2.90 3.19 . . 133 1197 100.00 . . . . 0.2246 . . . . . . . . . . . 0.2932 'X-RAY DIFFRACTION' 3.19 3.64 . . 136 1205 100.00 . . . . 0.2011 . . . . . . . . . . . 0.2668 'X-RAY DIFFRACTION' 3.70 4.60 . . 125 1124 99.28 . . . . 0.1748 . . . . . . . . . . . 0.1911 # _struct.entry_id 9IAE _struct.title 'Structure of a Chimeric Protein Composed of the SNX5 PX Domain and the N-Terminal Region of NCOA7-AS, crystal form I' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9IAE _struct_keywords.text 'SNX5, NCOA7-AS, chimeric protein, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SNX5_HUMAN Q9Y5X3 ? 1 ;LNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPRE KMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQ ; 25 2 UNP H0Y6T0_HUMAN H0Y6T0 ? 1 RLPLDIQIFYCARPDEEPFVKIITVEEAKRR 5 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9IAE A 2 ? 147 ? Q9Y5X3 25 ? 170 ? 25 170 2 2 9IAE A 148 ? 178 ? H0Y6T0 5 ? 35 ? 171 201 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9IAE _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9Y5X3 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 24 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3280 ? 1 MORE -22 ? 1 'SSA (A^2)' 20340 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'the protein forms a homodimer in solution' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+1/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 33.8366666667 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 46 ? THR A 59 ? HIS A 69 THR A 82 1 ? 14 HELX_P HELX_P2 AA2 THR A 60 ? ALA A 63 ? THR A 83 ALA A 86 5 ? 4 HELX_P HELX_P3 AA3 PHE A 76 ? GLY A 87 ? PHE A 99 GLY A 110 1 ? 12 HELX_P HELX_P4 AA4 THR A 94 ? HIS A 130 ? THR A 117 HIS A 153 1 ? 37 HELX_P HELX_P5 AA5 VAL A 132 ? LYS A 135 ? VAL A 155 LYS A 158 5 ? 4 HELX_P HELX_P6 AA6 ASP A 136 ? TYR A 145 ? ASP A 159 TYR A 168 1 ? 10 HELX_P HELX_P7 AA7 THR A 171 ? ARG A 177 ? THR A 194 ARG A 200 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A TYR 157 C ? ? ? 1_555 A CME 158 N ? ? A TYR 180 A CME 181 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A CME 158 C ? ? ? 1_555 A ALA 159 N ? ? A CME 181 A ALA 182 1_555 ? ? ? ? ? ? ? 1.328 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CME _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 158 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id CME _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 181 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id CME _pdbx_modification_feature.type Beta-mercaptoethanol _pdbx_modification_feature.category 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 8 ? ASP A 11 ? LEU A 31 ASP A 34 AA1 2 LYS A 21 ? THR A 30 ? LYS A 44 THR A 53 AA1 3 ALA A 15 ? GLU A 18 ? ALA A 38 GLU A 41 AA2 1 LEU A 8 ? ASP A 11 ? LEU A 31 ASP A 34 AA2 2 LYS A 21 ? THR A 30 ? LYS A 44 THR A 53 AA2 3 GLU A 39 ? GLN A 45 ? GLU A 62 GLN A 68 AA3 1 GLN A 154 ? CME A 158 ? GLN A 177 CME A 181 AA3 2 PHE A 166 ? ILE A 170 ? PHE A 189 ILE A 193 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 11 ? N ASP A 34 O HIS A 27 ? O HIS A 50 AA1 2 3 O LYS A 23 ? O LYS A 46 N LEU A 16 ? N LEU A 39 AA2 1 2 N ASP A 11 ? N ASP A 34 O HIS A 27 ? O HIS A 50 AA2 2 3 N PHE A 24 ? N PHE A 47 O ARG A 44 ? O ARG A 67 AA3 1 2 N GLN A 154 ? N GLN A 177 O ILE A 170 ? O ILE A 193 # _pdbx_entry_details.entry_id 9IAE _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 314 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 426 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.11 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 42 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 58.84 _pdbx_validate_torsion.psi -117.38 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CME _pdbx_struct_mod_residue.label_seq_id 158 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CME _pdbx_struct_mod_residue.auth_seq_id 181 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id PHE _pdbx_struct_special_symmetry.auth_seq_id 121 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id A _pdbx_struct_special_symmetry.label_comp_id PHE _pdbx_struct_special_symmetry.label_seq_id 98 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -14.1949430078 _pdbx_refine_tls.origin_y 4.29068930634 _pdbx_refine_tls.origin_z 7.24842229869 _pdbx_refine_tls.T[1][1] 0.208113452734 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.000287239450869 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0324235281422 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.195205068989 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0138581150453 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.337392236286 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.696400967281 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.0458311419498 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.116390790953 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.635432556345 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.313275386798 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.43539320383 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.000682964658419 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0182033831126 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0571614235663 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0064757888592 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.02996971155 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0576199626006 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0813061098127 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.00169086104558 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.040027251924 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 29 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 173 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 201 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details 'Chain A' # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 459 ? 5.94 . 2 1 O ? A HOH 460 ? 6.08 . 3 1 O ? A HOH 461 ? 6.21 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 24 ? A GLY 1 2 1 Y 1 A LEU 25 ? A LEU 2 3 1 Y 1 A ASN 26 ? A ASN 3 4 1 Y 1 A VAL 27 ? A VAL 4 5 1 Y 1 A ASP 28 ? A ASP 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CME N N N N 74 CME CA C N R 75 CME CB C N N 76 CME SG S N N 77 CME SD S N N 78 CME CE C N N 79 CME CZ C N N 80 CME OH O N N 81 CME C C N N 82 CME O O N N 83 CME OXT O N N 84 CME H H N N 85 CME H2 H N N 86 CME HA H N N 87 CME HB2 H N N 88 CME HB3 H N N 89 CME HE2 H N N 90 CME HE3 H N N 91 CME HZ2 H N N 92 CME HZ3 H N N 93 CME HH H N N 94 CME HXT H N N 95 GLN N N N N 96 GLN CA C N S 97 GLN C C N N 98 GLN O O N N 99 GLN CB C N N 100 GLN CG C N N 101 GLN CD C N N 102 GLN OE1 O N N 103 GLN NE2 N N N 104 GLN OXT O N N 105 GLN H H N N 106 GLN H2 H N N 107 GLN HA H N N 108 GLN HB2 H N N 109 GLN HB3 H N N 110 GLN HG2 H N N 111 GLN HG3 H N N 112 GLN HE21 H N N 113 GLN HE22 H N N 114 GLN HXT H N N 115 GLU N N N N 116 GLU CA C N S 117 GLU C C N N 118 GLU O O N N 119 GLU CB C N N 120 GLU CG C N N 121 GLU CD C N N 122 GLU OE1 O N N 123 GLU OE2 O N N 124 GLU OXT O N N 125 GLU H H N N 126 GLU H2 H N N 127 GLU HA H N N 128 GLU HB2 H N N 129 GLU HB3 H N N 130 GLU HG2 H N N 131 GLU HG3 H N N 132 GLU HE2 H N N 133 GLU HXT H N N 134 GLY N N N N 135 GLY CA C N N 136 GLY C C N N 137 GLY O O N N 138 GLY OXT O N N 139 GLY H H N N 140 GLY H2 H N N 141 GLY HA2 H N N 142 GLY HA3 H N N 143 GLY HXT H N N 144 HIS N N N N 145 HIS CA C N S 146 HIS C C N N 147 HIS O O N N 148 HIS CB C N N 149 HIS CG C Y N 150 HIS ND1 N Y N 151 HIS CD2 C Y N 152 HIS CE1 C Y N 153 HIS NE2 N Y N 154 HIS OXT O N N 155 HIS H H N N 156 HIS H2 H N N 157 HIS HA H N N 158 HIS HB2 H N N 159 HIS HB3 H N N 160 HIS HD1 H N N 161 HIS HD2 H N N 162 HIS HE1 H N N 163 HIS HE2 H N N 164 HIS HXT H N N 165 HOH O O N N 166 HOH H1 H N N 167 HOH H2 H N N 168 ILE N N N N 169 ILE CA C N S 170 ILE C C N N 171 ILE O O N N 172 ILE CB C N S 173 ILE CG1 C N N 174 ILE CG2 C N N 175 ILE CD1 C N N 176 ILE OXT O N N 177 ILE H H N N 178 ILE H2 H N N 179 ILE HA H N N 180 ILE HB H N N 181 ILE HG12 H N N 182 ILE HG13 H N N 183 ILE HG21 H N N 184 ILE HG22 H N N 185 ILE HG23 H N N 186 ILE HD11 H N N 187 ILE HD12 H N N 188 ILE HD13 H N N 189 ILE HXT H N N 190 LEU N N N N 191 LEU CA C N S 192 LEU C C N N 193 LEU O O N N 194 LEU CB C N N 195 LEU CG C N N 196 LEU CD1 C N N 197 LEU CD2 C N N 198 LEU OXT O N N 199 LEU H H N N 200 LEU H2 H N N 201 LEU HA H N N 202 LEU HB2 H N N 203 LEU HB3 H N N 204 LEU HG H N N 205 LEU HD11 H N N 206 LEU HD12 H N N 207 LEU HD13 H N N 208 LEU HD21 H N N 209 LEU HD22 H N N 210 LEU HD23 H N N 211 LEU HXT H N N 212 LYS N N N N 213 LYS CA C N S 214 LYS C C N N 215 LYS O O N N 216 LYS CB C N N 217 LYS CG C N N 218 LYS CD C N N 219 LYS CE C N N 220 LYS NZ N N N 221 LYS OXT O N N 222 LYS H H N N 223 LYS H2 H N N 224 LYS HA H N N 225 LYS HB2 H N N 226 LYS HB3 H N N 227 LYS HG2 H N N 228 LYS HG3 H N N 229 LYS HD2 H N N 230 LYS HD3 H N N 231 LYS HE2 H N N 232 LYS HE3 H N N 233 LYS HZ1 H N N 234 LYS HZ2 H N N 235 LYS HZ3 H N N 236 LYS HXT H N N 237 MET N N N N 238 MET CA C N S 239 MET C C N N 240 MET O O N N 241 MET CB C N N 242 MET CG C N N 243 MET SD S N N 244 MET CE C N N 245 MET OXT O N N 246 MET H H N N 247 MET H2 H N N 248 MET HA H N N 249 MET HB2 H N N 250 MET HB3 H N N 251 MET HG2 H N N 252 MET HG3 H N N 253 MET HE1 H N N 254 MET HE2 H N N 255 MET HE3 H N N 256 MET HXT H N N 257 PHE N N N N 258 PHE CA C N S 259 PHE C C N N 260 PHE O O N N 261 PHE CB C N N 262 PHE CG C Y N 263 PHE CD1 C Y N 264 PHE CD2 C Y N 265 PHE CE1 C Y N 266 PHE CE2 C Y N 267 PHE CZ C Y N 268 PHE OXT O N N 269 PHE H H N N 270 PHE H2 H N N 271 PHE HA H N N 272 PHE HB2 H N N 273 PHE HB3 H N N 274 PHE HD1 H N N 275 PHE HD2 H N N 276 PHE HE1 H N N 277 PHE HE2 H N N 278 PHE HZ H N N 279 PHE HXT H N N 280 PRO N N N N 281 PRO CA C N S 282 PRO C C N N 283 PRO O O N N 284 PRO CB C N N 285 PRO CG C N N 286 PRO CD C N N 287 PRO OXT O N N 288 PRO H H N N 289 PRO HA H N N 290 PRO HB2 H N N 291 PRO HB3 H N N 292 PRO HG2 H N N 293 PRO HG3 H N N 294 PRO HD2 H N N 295 PRO HD3 H N N 296 PRO HXT H N N 297 SER N N N N 298 SER CA C N S 299 SER C C N N 300 SER O O N N 301 SER CB C N N 302 SER OG O N N 303 SER OXT O N N 304 SER H H N N 305 SER H2 H N N 306 SER HA H N N 307 SER HB2 H N N 308 SER HB3 H N N 309 SER HG H N N 310 SER HXT H N N 311 THR N N N N 312 THR CA C N S 313 THR C C N N 314 THR O O N N 315 THR CB C N R 316 THR OG1 O N N 317 THR CG2 C N N 318 THR OXT O N N 319 THR H H N N 320 THR H2 H N N 321 THR HA H N N 322 THR HB H N N 323 THR HG1 H N N 324 THR HG21 H N N 325 THR HG22 H N N 326 THR HG23 H N N 327 THR HXT H N N 328 TRP N N N N 329 TRP CA C N S 330 TRP C C N N 331 TRP O O N N 332 TRP CB C N N 333 TRP CG C Y N 334 TRP CD1 C Y N 335 TRP CD2 C Y N 336 TRP NE1 N Y N 337 TRP CE2 C Y N 338 TRP CE3 C Y N 339 TRP CZ2 C Y N 340 TRP CZ3 C Y N 341 TRP CH2 C Y N 342 TRP OXT O N N 343 TRP H H N N 344 TRP H2 H N N 345 TRP HA H N N 346 TRP HB2 H N N 347 TRP HB3 H N N 348 TRP HD1 H N N 349 TRP HE1 H N N 350 TRP HE3 H N N 351 TRP HZ2 H N N 352 TRP HZ3 H N N 353 TRP HH2 H N N 354 TRP HXT H N N 355 TYR N N N N 356 TYR CA C N S 357 TYR C C N N 358 TYR O O N N 359 TYR CB C N N 360 TYR CG C Y N 361 TYR CD1 C Y N 362 TYR CD2 C Y N 363 TYR CE1 C Y N 364 TYR CE2 C Y N 365 TYR CZ C Y N 366 TYR OH O N N 367 TYR OXT O N N 368 TYR H H N N 369 TYR H2 H N N 370 TYR HA H N N 371 TYR HB2 H N N 372 TYR HB3 H N N 373 TYR HD1 H N N 374 TYR HD2 H N N 375 TYR HE1 H N N 376 TYR HE2 H N N 377 TYR HH H N N 378 TYR HXT H N N 379 VAL N N N N 380 VAL CA C N S 381 VAL C C N N 382 VAL O O N N 383 VAL CB C N N 384 VAL CG1 C N N 385 VAL CG2 C N N 386 VAL OXT O N N 387 VAL H H N N 388 VAL H2 H N N 389 VAL HA H N N 390 VAL HB H N N 391 VAL HG11 H N N 392 VAL HG12 H N N 393 VAL HG13 H N N 394 VAL HG21 H N N 395 VAL HG22 H N N 396 VAL HG23 H N N 397 VAL HXT H N N 398 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CME N CA sing N N 70 CME N H sing N N 71 CME N H2 sing N N 72 CME CA CB sing N N 73 CME CA C sing N N 74 CME CA HA sing N N 75 CME CB SG sing N N 76 CME CB HB2 sing N N 77 CME CB HB3 sing N N 78 CME SG SD sing N N 79 CME SD CE sing N N 80 CME CE CZ sing N N 81 CME CE HE2 sing N N 82 CME CE HE3 sing N N 83 CME CZ OH sing N N 84 CME CZ HZ2 sing N N 85 CME CZ HZ3 sing N N 86 CME OH HH sing N N 87 CME C O doub N N 88 CME C OXT sing N N 89 CME OXT HXT sing N N 90 GLN N CA sing N N 91 GLN N H sing N N 92 GLN N H2 sing N N 93 GLN CA C sing N N 94 GLN CA CB sing N N 95 GLN CA HA sing N N 96 GLN C O doub N N 97 GLN C OXT sing N N 98 GLN CB CG sing N N 99 GLN CB HB2 sing N N 100 GLN CB HB3 sing N N 101 GLN CG CD sing N N 102 GLN CG HG2 sing N N 103 GLN CG HG3 sing N N 104 GLN CD OE1 doub N N 105 GLN CD NE2 sing N N 106 GLN NE2 HE21 sing N N 107 GLN NE2 HE22 sing N N 108 GLN OXT HXT sing N N 109 GLU N CA sing N N 110 GLU N H sing N N 111 GLU N H2 sing N N 112 GLU CA C sing N N 113 GLU CA CB sing N N 114 GLU CA HA sing N N 115 GLU C O doub N N 116 GLU C OXT sing N N 117 GLU CB CG sing N N 118 GLU CB HB2 sing N N 119 GLU CB HB3 sing N N 120 GLU CG CD sing N N 121 GLU CG HG2 sing N N 122 GLU CG HG3 sing N N 123 GLU CD OE1 doub N N 124 GLU CD OE2 sing N N 125 GLU OE2 HE2 sing N N 126 GLU OXT HXT sing N N 127 GLY N CA sing N N 128 GLY N H sing N N 129 GLY N H2 sing N N 130 GLY CA C sing N N 131 GLY CA HA2 sing N N 132 GLY CA HA3 sing N N 133 GLY C O doub N N 134 GLY C OXT sing N N 135 GLY OXT HXT sing N N 136 HIS N CA sing N N 137 HIS N H sing N N 138 HIS N H2 sing N N 139 HIS CA C sing N N 140 HIS CA CB sing N N 141 HIS CA HA sing N N 142 HIS C O doub N N 143 HIS C OXT sing N N 144 HIS CB CG sing N N 145 HIS CB HB2 sing N N 146 HIS CB HB3 sing N N 147 HIS CG ND1 sing Y N 148 HIS CG CD2 doub Y N 149 HIS ND1 CE1 doub Y N 150 HIS ND1 HD1 sing N N 151 HIS CD2 NE2 sing Y N 152 HIS CD2 HD2 sing N N 153 HIS CE1 NE2 sing Y N 154 HIS CE1 HE1 sing N N 155 HIS NE2 HE2 sing N N 156 HIS OXT HXT sing N N 157 HOH O H1 sing N N 158 HOH O H2 sing N N 159 ILE N CA sing N N 160 ILE N H sing N N 161 ILE N H2 sing N N 162 ILE CA C sing N N 163 ILE CA CB sing N N 164 ILE CA HA sing N N 165 ILE C O doub N N 166 ILE C OXT sing N N 167 ILE CB CG1 sing N N 168 ILE CB CG2 sing N N 169 ILE CB HB sing N N 170 ILE CG1 CD1 sing N N 171 ILE CG1 HG12 sing N N 172 ILE CG1 HG13 sing N N 173 ILE CG2 HG21 sing N N 174 ILE CG2 HG22 sing N N 175 ILE CG2 HG23 sing N N 176 ILE CD1 HD11 sing N N 177 ILE CD1 HD12 sing N N 178 ILE CD1 HD13 sing N N 179 ILE OXT HXT sing N N 180 LEU N CA sing N N 181 LEU N H sing N N 182 LEU N H2 sing N N 183 LEU CA C sing N N 184 LEU CA CB sing N N 185 LEU CA HA sing N N 186 LEU C O doub N N 187 LEU C OXT sing N N 188 LEU CB CG sing N N 189 LEU CB HB2 sing N N 190 LEU CB HB3 sing N N 191 LEU CG CD1 sing N N 192 LEU CG CD2 sing N N 193 LEU CG HG sing N N 194 LEU CD1 HD11 sing N N 195 LEU CD1 HD12 sing N N 196 LEU CD1 HD13 sing N N 197 LEU CD2 HD21 sing N N 198 LEU CD2 HD22 sing N N 199 LEU CD2 HD23 sing N N 200 LEU OXT HXT sing N N 201 LYS N CA sing N N 202 LYS N H sing N N 203 LYS N H2 sing N N 204 LYS CA C sing N N 205 LYS CA CB sing N N 206 LYS CA HA sing N N 207 LYS C O doub N N 208 LYS C OXT sing N N 209 LYS CB CG sing N N 210 LYS CB HB2 sing N N 211 LYS CB HB3 sing N N 212 LYS CG CD sing N N 213 LYS CG HG2 sing N N 214 LYS CG HG3 sing N N 215 LYS CD CE sing N N 216 LYS CD HD2 sing N N 217 LYS CD HD3 sing N N 218 LYS CE NZ sing N N 219 LYS CE HE2 sing N N 220 LYS CE HE3 sing N N 221 LYS NZ HZ1 sing N N 222 LYS NZ HZ2 sing N N 223 LYS NZ HZ3 sing N N 224 LYS OXT HXT sing N N 225 MET N CA sing N N 226 MET N H sing N N 227 MET N H2 sing N N 228 MET CA C sing N N 229 MET CA CB sing N N 230 MET CA HA sing N N 231 MET C O doub N N 232 MET C OXT sing N N 233 MET CB CG sing N N 234 MET CB HB2 sing N N 235 MET CB HB3 sing N N 236 MET CG SD sing N N 237 MET CG HG2 sing N N 238 MET CG HG3 sing N N 239 MET SD CE sing N N 240 MET CE HE1 sing N N 241 MET CE HE2 sing N N 242 MET CE HE3 sing N N 243 MET OXT HXT sing N N 244 PHE N CA sing N N 245 PHE N H sing N N 246 PHE N H2 sing N N 247 PHE CA C sing N N 248 PHE CA CB sing N N 249 PHE CA HA sing N N 250 PHE C O doub N N 251 PHE C OXT sing N N 252 PHE CB CG sing N N 253 PHE CB HB2 sing N N 254 PHE CB HB3 sing N N 255 PHE CG CD1 doub Y N 256 PHE CG CD2 sing Y N 257 PHE CD1 CE1 sing Y N 258 PHE CD1 HD1 sing N N 259 PHE CD2 CE2 doub Y N 260 PHE CD2 HD2 sing N N 261 PHE CE1 CZ doub Y N 262 PHE CE1 HE1 sing N N 263 PHE CE2 CZ sing Y N 264 PHE CE2 HE2 sing N N 265 PHE CZ HZ sing N N 266 PHE OXT HXT sing N N 267 PRO N CA sing N N 268 PRO N CD sing N N 269 PRO N H sing N N 270 PRO CA C sing N N 271 PRO CA CB sing N N 272 PRO CA HA sing N N 273 PRO C O doub N N 274 PRO C OXT sing N N 275 PRO CB CG sing N N 276 PRO CB HB2 sing N N 277 PRO CB HB3 sing N N 278 PRO CG CD sing N N 279 PRO CG HG2 sing N N 280 PRO CG HG3 sing N N 281 PRO CD HD2 sing N N 282 PRO CD HD3 sing N N 283 PRO OXT HXT sing N N 284 SER N CA sing N N 285 SER N H sing N N 286 SER N H2 sing N N 287 SER CA C sing N N 288 SER CA CB sing N N 289 SER CA HA sing N N 290 SER C O doub N N 291 SER C OXT sing N N 292 SER CB OG sing N N 293 SER CB HB2 sing N N 294 SER CB HB3 sing N N 295 SER OG HG sing N N 296 SER OXT HXT sing N N 297 THR N CA sing N N 298 THR N H sing N N 299 THR N H2 sing N N 300 THR CA C sing N N 301 THR CA CB sing N N 302 THR CA HA sing N N 303 THR C O doub N N 304 THR C OXT sing N N 305 THR CB OG1 sing N N 306 THR CB CG2 sing N N 307 THR CB HB sing N N 308 THR OG1 HG1 sing N N 309 THR CG2 HG21 sing N N 310 THR CG2 HG22 sing N N 311 THR CG2 HG23 sing N N 312 THR OXT HXT sing N N 313 TRP N CA sing N N 314 TRP N H sing N N 315 TRP N H2 sing N N 316 TRP CA C sing N N 317 TRP CA CB sing N N 318 TRP CA HA sing N N 319 TRP C O doub N N 320 TRP C OXT sing N N 321 TRP CB CG sing N N 322 TRP CB HB2 sing N N 323 TRP CB HB3 sing N N 324 TRP CG CD1 doub Y N 325 TRP CG CD2 sing Y N 326 TRP CD1 NE1 sing Y N 327 TRP CD1 HD1 sing N N 328 TRP CD2 CE2 doub Y N 329 TRP CD2 CE3 sing Y N 330 TRP NE1 CE2 sing Y N 331 TRP NE1 HE1 sing N N 332 TRP CE2 CZ2 sing Y N 333 TRP CE3 CZ3 doub Y N 334 TRP CE3 HE3 sing N N 335 TRP CZ2 CH2 doub Y N 336 TRP CZ2 HZ2 sing N N 337 TRP CZ3 CH2 sing Y N 338 TRP CZ3 HZ3 sing N N 339 TRP CH2 HH2 sing N N 340 TRP OXT HXT sing N N 341 TYR N CA sing N N 342 TYR N H sing N N 343 TYR N H2 sing N N 344 TYR CA C sing N N 345 TYR CA CB sing N N 346 TYR CA HA sing N N 347 TYR C O doub N N 348 TYR C OXT sing N N 349 TYR CB CG sing N N 350 TYR CB HB2 sing N N 351 TYR CB HB3 sing N N 352 TYR CG CD1 doub Y N 353 TYR CG CD2 sing Y N 354 TYR CD1 CE1 sing Y N 355 TYR CD1 HD1 sing N N 356 TYR CD2 CE2 doub Y N 357 TYR CD2 HD2 sing N N 358 TYR CE1 CZ doub Y N 359 TYR CE1 HE1 sing N N 360 TYR CE2 CZ sing Y N 361 TYR CE2 HE2 sing N N 362 TYR CZ OH sing N N 363 TYR OH HH sing N N 364 TYR OXT HXT sing N N 365 VAL N CA sing N N 366 VAL N H sing N N 367 VAL N H2 sing N N 368 VAL CA C sing N N 369 VAL CA CB sing N N 370 VAL CA HA sing N N 371 VAL C O doub N N 372 VAL C OXT sing N N 373 VAL CB CG1 sing N N 374 VAL CB CG2 sing N N 375 VAL CB HB sing N N 376 VAL CG1 HG11 sing N N 377 VAL CG1 HG12 sing N N 378 VAL CG1 HG13 sing N N 379 VAL CG2 HG21 sing N N 380 VAL CG2 HG22 sing N N 381 VAL CG2 HG23 sing N N 382 VAL OXT HXT sing N N 383 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Agence Nationale de la Recherche (ANR)' France ANR-20-CE15-0010-02 1 'European Research Council (ERC)' 'European Union' 759226 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5wy2 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9IAE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015840 _atom_sites.fract_transf_matrix[1][2] 0.009145 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018291 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009851 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #