data_9IBI # _entry.id 9IBI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.407 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9IBI pdb_00009ibi 10.2210/pdb9ibi/pdb WWPDB D_1292145397 ? ? BMRB 34980 ? 10.13018/BMR34980 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-11-19 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9IBI _pdbx_database_status.recvd_initial_deposition_date 2025-02-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR study of the titin I-band IgI domain I82 reveals conformational dynamics' _pdbx_database_related.db_id 34980 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email mark.pfuhl@kcl.ac.uk _pdbx_contact_author.name_first Mark _pdbx_contact_author.name_last Pfuhl _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9592-6639 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pfuhl, M.' 1 0000-0001-9592-6639 'Gage, M.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution NMR study of the titin I-band IgI domain I82 reveals conformational dynamics' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kelly, C.M.' 1 ? primary 'Abukar, S.' 2 ? primary 'Gage, M.' 3 ? primary 'Pfuhl, M.' 4 0000-0001-9592-6639 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Titin _entity.formula_weight 11715.221 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.11.1 _entity.pdbx_mutation n.a. _entity.pdbx_fragment ? _entity.details 'N-terminal 4 amino acids are a cloning artifact' # _entity_name_com.entity_id 1 _entity_name_com.name Connectin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GIDPFTIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTC KHEDLETSAELRIEKGELRSGC ; _entity_poly.pdbx_seq_one_letter_code_can ;GIDPFTIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTC KHEDLETSAELRIEKGELRSGC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 ASP n 1 4 PRO n 1 5 PHE n 1 6 THR n 1 7 ILE n 1 8 GLU n 1 9 PRO n 1 10 ALA n 1 11 TRP n 1 12 GLU n 1 13 ARG n 1 14 HIS n 1 15 LEU n 1 16 GLN n 1 17 ASP n 1 18 VAL n 1 19 THR n 1 20 LEU n 1 21 LYS n 1 22 GLU n 1 23 GLY n 1 24 GLN n 1 25 THR n 1 26 CYS n 1 27 THR n 1 28 MET n 1 29 THR n 1 30 CYS n 1 31 GLN n 1 32 PHE n 1 33 SER n 1 34 VAL n 1 35 PRO n 1 36 ASN n 1 37 VAL n 1 38 LYS n 1 39 SER n 1 40 GLU n 1 41 TRP n 1 42 PHE n 1 43 ARG n 1 44 ASN n 1 45 GLY n 1 46 ARG n 1 47 VAL n 1 48 LEU n 1 49 LYS n 1 50 PRO n 1 51 GLN n 1 52 GLY n 1 53 ARG n 1 54 VAL n 1 55 LYS n 1 56 THR n 1 57 GLU n 1 58 VAL n 1 59 GLU n 1 60 HIS n 1 61 LYS n 1 62 VAL n 1 63 HIS n 1 64 LYS n 1 65 LEU n 1 66 THR n 1 67 ILE n 1 68 ALA n 1 69 ASP n 1 70 VAL n 1 71 ARG n 1 72 ALA n 1 73 GLU n 1 74 ASP n 1 75 GLN n 1 76 GLY n 1 77 GLN n 1 78 TYR n 1 79 THR n 1 80 CYS n 1 81 LYS n 1 82 HIS n 1 83 GLU n 1 84 ASP n 1 85 LEU n 1 86 GLU n 1 87 THR n 1 88 SER n 1 89 ALA n 1 90 GLU n 1 91 LEU n 1 92 ARG n 1 93 ILE n 1 94 GLU n 1 95 LYS n 1 96 GLY n 1 97 GLU n 1 98 LEU n 1 99 ARG n 1 100 SER n 1 101 GLY n 1 102 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 102 _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Ttn _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue muscle _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell myocyte _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'BL21 STAR' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-151dTOPO _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 CYS 102 102 102 CYS CYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9IBI _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9IBI _struct.title 'Solution NMR study of the titin I-band IgI domain I82 reveals conformational dynamics' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9IBI _struct_keywords.text 'muscle scaffold contraction I-band, STRUCTURAL PROTEIN' _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TITIN_MOUSE _struct_ref.pdbx_db_accession A2ASS6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLE TSAELRIE ; _struct_ref.pdbx_align_begin 9631 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9IBI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A2ASS6 _struct_ref_seq.db_align_beg 9631 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 9718 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 7 _struct_ref_seq.pdbx_auth_seq_align_end 94 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9IBI GLY A 1 ? UNP A2ASS6 ? ? 'expression tag' 1 1 1 9IBI ILE A 2 ? UNP A2ASS6 ? ? 'expression tag' 2 2 1 9IBI ASP A 3 ? UNP A2ASS6 ? ? 'expression tag' 3 3 1 9IBI PRO A 4 ? UNP A2ASS6 ? ? 'expression tag' 4 4 1 9IBI PHE A 5 ? UNP A2ASS6 ? ? 'expression tag' 5 5 1 9IBI THR A 6 ? UNP A2ASS6 ? ? 'expression tag' 6 6 1 9IBI LYS A 95 ? UNP A2ASS6 ? ? 'expression tag' 95 7 1 9IBI GLY A 96 ? UNP A2ASS6 ? ? 'expression tag' 96 8 1 9IBI GLU A 97 ? UNP A2ASS6 ? ? 'expression tag' 97 9 1 9IBI LEU A 98 ? UNP A2ASS6 ? ? 'expression tag' 98 10 1 9IBI ARG A 99 ? UNP A2ASS6 ? ? 'expression tag' 99 11 1 9IBI SER A 100 ? UNP A2ASS6 ? ? 'expression tag' 100 12 1 9IBI GLY A 101 ? UNP A2ASS6 ? ? 'expression tag' 101 13 1 9IBI CYS A 102 ? UNP A2ASS6 ? ? 'expression tag' 102 14 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR relaxation study' _pdbx_struct_assembly_auth_evidence.details 'rotational correlation time compatible with monomeric protein' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 71 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 75 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 71 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 75 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 11 ? ARG A 13 ? TRP A 11 ARG A 13 AA1 2 CYS A 26 ? PHE A 32 ? CYS A 26 PHE A 32 AA1 3 VAL A 62 ? ILE A 67 ? VAL A 62 ILE A 67 AA1 4 VAL A 54 ? VAL A 58 ? VAL A 54 VAL A 58 AA2 1 THR A 19 ? LEU A 20 ? THR A 19 LEU A 20 AA2 2 ARG A 92 ? ILE A 93 ? ARG A 92 ILE A 93 AA3 1 ARG A 46 ? VAL A 47 ? ARG A 46 VAL A 47 AA3 2 GLU A 40 ? ARG A 43 ? GLU A 40 ARG A 43 AA3 3 TYR A 78 ? HIS A 82 ? TYR A 78 HIS A 82 AA3 4 LEU A 85 ? ALA A 89 ? LEU A 85 ALA A 89 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 13 ? N ARG A 13 O GLN A 31 ? O GLN A 31 AA1 2 3 N CYS A 30 ? N CYS A 30 O HIS A 63 ? O HIS A 63 AA1 3 4 O THR A 66 ? O THR A 66 N LYS A 55 ? N LYS A 55 AA2 1 2 N LEU A 20 ? N LEU A 20 O ARG A 92 ? O ARG A 92 AA3 1 2 O ARG A 46 ? O ARG A 46 N ARG A 43 ? N ARG A 43 AA3 2 3 N GLU A 40 ? N GLU A 40 O LYS A 81 ? O LYS A 81 AA3 3 4 N HIS A 82 ? N HIS A 82 O LEU A 85 ? O LEU A 85 # _pdbx_entry_details.entry_id 9IBI _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 HH22 A ARG 53 ? ? OD2 A ASP 74 ? ? 1.56 2 4 OE1 A GLU 22 ? ? HZ2 A LYS 95 ? ? 1.57 3 5 HZ2 A LYS 95 ? ? OE2 A GLU 97 ? ? 1.57 4 18 HH21 A ARG 53 ? ? OD2 A ASP 74 ? ? 1.58 5 19 HZ2 A LYS 55 ? ? OE1 A GLU 57 ? ? 1.54 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 3 N A LYS 95 ? ? CA A LYS 95 ? ? C A LYS 95 ? ? 127.74 111.00 16.74 2.70 N 2 4 N A LYS 95 ? ? CA A LYS 95 ? ? C A LYS 95 ? ? 129.71 111.00 18.71 2.70 N 3 6 N A LYS 95 ? ? CA A LYS 95 ? ? C A LYS 95 ? ? 129.01 111.00 18.01 2.70 N 4 9 N A LYS 95 ? ? CA A LYS 95 ? ? C A LYS 95 ? ? 127.64 111.00 16.64 2.70 N 5 16 N A LYS 95 ? ? CA A LYS 95 ? ? C A LYS 95 ? ? 127.28 111.00 16.28 2.70 N 6 17 N A LYS 95 ? ? CA A LYS 95 ? ? C A LYS 95 ? ? 127.67 111.00 16.67 2.70 N 7 19 N A LYS 95 ? ? CA A LYS 95 ? ? C A LYS 95 ? ? 127.34 111.00 16.34 2.70 N 8 20 N A LYS 95 ? ? CA A LYS 95 ? ? C A LYS 95 ? ? 128.53 111.00 17.53 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 2 ? ? -100.46 -73.32 2 1 ASP A 3 ? ? 49.82 76.44 3 1 PRO A 50 ? ? -67.04 79.55 4 1 GLU A 59 ? ? -99.65 -159.88 5 1 HIS A 60 ? ? -54.90 -77.25 6 1 GLN A 77 ? ? -12.74 103.58 7 1 GLU A 83 ? ? 61.45 -82.91 8 1 GLU A 94 ? ? -81.36 -89.90 9 1 LYS A 95 ? ? 122.18 124.41 10 1 GLU A 97 ? ? -129.07 -60.23 11 1 SER A 100 ? ? -153.28 32.07 12 2 ILE A 2 ? ? -118.88 -70.60 13 2 ASP A 3 ? ? 60.94 83.40 14 2 GLU A 12 ? ? -77.28 -70.73 15 2 PRO A 50 ? ? -69.98 79.87 16 2 GLN A 77 ? ? -6.32 106.45 17 2 GLU A 83 ? ? 65.15 -84.69 18 2 GLU A 97 ? ? -167.46 111.21 19 2 LEU A 98 ? ? -93.22 44.45 20 3 PHE A 5 ? ? -92.98 -65.51 21 3 PRO A 50 ? ? -67.83 79.53 22 3 HIS A 60 ? ? -57.00 -80.49 23 3 GLN A 77 ? ? -8.20 115.83 24 3 GLU A 83 ? ? 63.23 -88.89 25 3 LYS A 95 ? ? -154.53 2.39 26 3 LEU A 98 ? ? -100.10 49.66 27 4 ASP A 3 ? ? 50.36 86.51 28 4 HIS A 60 ? ? -18.50 -79.03 29 4 GLN A 77 ? ? -6.84 112.57 30 4 GLU A 83 ? ? 62.44 -89.10 31 4 LYS A 95 ? ? -148.73 -76.31 32 4 ARG A 99 ? ? 70.60 37.53 33 4 SER A 100 ? ? -151.94 51.42 34 5 SER A 33 ? ? -58.47 -9.24 35 5 GLU A 59 ? ? -118.46 -163.80 36 5 GLN A 77 ? ? -10.34 103.55 37 5 GLU A 83 ? ? 64.51 -85.96 38 5 GLU A 94 ? ? -82.46 -96.95 39 5 LYS A 95 ? ? 81.80 49.63 40 5 GLU A 97 ? ? 73.03 -44.20 41 5 SER A 100 ? ? -151.99 7.53 42 6 ILE A 2 ? ? 62.50 91.35 43 6 PRO A 50 ? ? -66.18 80.50 44 6 HIS A 60 ? ? -54.17 -75.90 45 6 GLN A 77 ? ? -12.08 105.64 46 6 GLU A 83 ? ? 60.59 -90.66 47 6 GLU A 94 ? ? -154.57 -109.03 48 6 LYS A 95 ? ? 114.66 113.15 49 7 PRO A 4 ? ? -73.55 21.90 50 7 PRO A 50 ? ? -63.47 90.11 51 7 GLU A 59 ? ? -95.08 -159.84 52 7 HIS A 60 ? ? -54.30 -74.03 53 7 GLN A 77 ? ? -5.81 111.12 54 7 GLU A 83 ? ? 64.53 -120.13 55 7 GLU A 94 ? ? -141.25 -129.83 56 7 LYS A 95 ? ? 86.13 29.96 57 7 GLU A 97 ? ? 54.75 -100.85 58 7 LEU A 98 ? ? -109.47 -79.61 59 7 ARG A 99 ? ? 67.19 -52.80 60 8 ASP A 3 ? ? 61.32 85.52 61 8 PRO A 50 ? ? -68.60 79.67 62 8 HIS A 60 ? ? -51.48 -71.80 63 8 GLN A 77 ? ? -9.13 109.90 64 8 GLU A 83 ? ? 58.83 -85.29 65 8 GLU A 94 ? ? -136.87 -118.85 66 8 LYS A 95 ? ? 84.24 89.38 67 8 GLU A 97 ? ? 68.29 178.51 68 8 LEU A 98 ? ? 66.62 111.00 69 9 ILE A 2 ? ? 64.26 95.76 70 9 PRO A 4 ? ? -56.51 107.68 71 9 GLU A 59 ? ? -103.60 -162.72 72 9 HIS A 60 ? ? -51.32 -77.60 73 9 ASP A 69 ? ? 54.65 70.22 74 9 GLN A 77 ? ? -15.40 108.95 75 9 GLU A 83 ? ? 63.26 -91.95 76 9 GLU A 94 ? ? -77.41 -85.66 77 9 LYS A 95 ? ? 118.59 100.76 78 9 GLU A 97 ? ? -144.35 -48.33 79 10 SER A 33 ? ? -59.70 -9.56 80 10 PRO A 50 ? ? -69.83 84.37 81 10 HIS A 60 ? ? -57.66 -76.39 82 10 GLN A 77 ? ? -6.61 108.38 83 10 GLU A 83 ? ? 64.93 -83.45 84 10 GLU A 94 ? ? -81.02 -106.94 85 10 LYS A 95 ? ? 92.69 61.07 86 10 GLU A 97 ? ? 69.66 -71.40 87 10 LEU A 98 ? ? -102.26 78.35 88 11 PRO A 50 ? ? -59.34 95.94 89 11 GLU A 59 ? ? -102.88 -162.54 90 11 GLN A 77 ? ? -17.70 107.62 91 11 GLU A 83 ? ? 65.10 -85.95 92 11 GLU A 94 ? ? -85.16 -115.49 93 11 LYS A 95 ? ? 91.05 92.49 94 11 GLU A 97 ? ? 59.92 77.38 95 11 LEU A 98 ? ? -146.35 -73.72 96 11 ARG A 99 ? ? 69.80 -45.86 97 12 SER A 33 ? ? -59.91 -4.73 98 12 PRO A 50 ? ? -56.80 99.54 99 12 GLU A 59 ? ? -103.20 -162.04 100 12 GLN A 77 ? ? -6.97 104.18 101 12 GLU A 83 ? ? 61.62 -89.33 102 12 LYS A 95 ? ? -153.22 2.99 103 12 GLU A 97 ? ? 53.72 81.65 104 13 ASP A 3 ? ? 63.32 68.46 105 13 PHE A 5 ? ? -163.53 -41.95 106 13 PRO A 50 ? ? -68.93 86.18 107 13 HIS A 60 ? ? -51.46 -75.00 108 13 GLN A 77 ? ? -16.28 105.53 109 13 GLU A 83 ? ? 64.45 -88.44 110 13 GLU A 94 ? ? -153.60 -128.57 111 13 LYS A 95 ? ? 92.29 129.22 112 14 ASP A 3 ? ? 60.84 72.48 113 14 PRO A 4 ? ? -82.95 38.81 114 14 PHE A 5 ? ? -105.92 -163.32 115 14 GLU A 12 ? ? -78.40 -73.53 116 14 SER A 33 ? ? -72.24 42.99 117 14 PRO A 50 ? ? -69.10 87.86 118 14 HIS A 60 ? ? -55.14 -72.13 119 14 GLN A 77 ? ? -11.91 101.71 120 14 GLU A 83 ? ? 60.59 -90.65 121 14 GLU A 94 ? ? -82.55 -94.80 122 14 LYS A 95 ? ? 96.46 102.98 123 14 GLU A 97 ? ? 61.54 73.34 124 14 LEU A 98 ? ? 60.18 -158.87 125 15 ILE A 2 ? ? 62.76 100.66 126 15 PHE A 5 ? ? -104.68 53.52 127 15 PRO A 50 ? ? -63.86 89.60 128 15 HIS A 60 ? ? -51.10 -70.51 129 15 GLN A 77 ? ? -9.00 106.15 130 15 GLU A 83 ? ? 65.28 -86.80 131 15 GLU A 94 ? ? -82.71 -113.19 132 15 LYS A 95 ? ? 93.95 25.60 133 15 GLU A 97 ? ? -66.52 97.40 134 15 SER A 100 ? ? -154.48 77.47 135 16 PRO A 4 ? ? -77.38 46.58 136 16 PHE A 5 ? ? -102.69 -73.63 137 16 SER A 33 ? ? -56.38 -9.41 138 16 PRO A 50 ? ? -57.99 96.82 139 16 GLN A 77 ? ? -6.99 115.51 140 16 GLU A 83 ? ? 64.29 -86.82 141 16 GLU A 94 ? ? -78.00 -92.45 142 16 LYS A 95 ? ? 123.06 121.69 143 16 GLU A 97 ? ? 65.44 89.94 144 17 PHE A 5 ? ? -113.85 64.43 145 17 SER A 33 ? ? -72.52 43.04 146 17 PRO A 50 ? ? -65.02 91.05 147 17 HIS A 60 ? ? -56.44 -73.05 148 17 GLN A 77 ? ? -5.54 108.38 149 17 GLU A 83 ? ? 61.76 -91.34 150 17 GLU A 94 ? ? -84.28 -100.63 151 17 LYS A 95 ? ? 117.63 84.06 152 17 SER A 100 ? ? 65.90 -164.25 153 18 SER A 33 ? ? -74.76 45.26 154 18 HIS A 60 ? ? -52.76 -75.00 155 18 GLN A 77 ? ? -13.18 105.38 156 18 GLU A 83 ? ? 66.29 -91.88 157 18 GLU A 94 ? ? -148.72 -124.80 158 18 LYS A 95 ? ? 108.67 111.20 159 18 GLU A 97 ? ? -166.09 108.41 160 18 LEU A 98 ? ? -151.37 54.19 161 19 PRO A 50 ? ? -60.12 93.59 162 19 HIS A 60 ? ? -52.15 -78.24 163 19 GLN A 77 ? ? -4.77 110.00 164 19 GLU A 83 ? ? 65.05 -84.89 165 19 GLU A 94 ? ? -83.48 -94.34 166 19 LYS A 95 ? ? 120.43 -37.85 167 20 GLU A 12 ? ? -74.13 -75.26 168 20 GLN A 77 ? ? -10.21 107.94 169 20 GLU A 83 ? ? 63.47 -89.68 170 20 GLU A 94 ? ? -159.01 -112.67 171 20 LYS A 95 ? ? 116.45 74.18 172 20 SER A 100 ? ? 68.19 -62.30 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLU A 94 ? ? LYS A 95 ? ? 124.34 2 2 GLU A 94 ? ? LYS A 95 ? ? -133.12 3 3 GLU A 94 ? ? LYS A 95 ? ? -128.73 4 4 GLU A 94 ? ? LYS A 95 ? ? -133.62 5 5 GLU A 94 ? ? LYS A 95 ? ? 132.96 6 6 GLU A 94 ? ? LYS A 95 ? ? 127.32 7 7 GLU A 94 ? ? LYS A 95 ? ? 132.90 8 8 GLU A 94 ? ? LYS A 95 ? ? 133.51 9 9 GLU A 94 ? ? LYS A 95 ? ? 122.92 10 10 GLU A 94 ? ? LYS A 95 ? ? 130.29 11 11 GLU A 94 ? ? LYS A 95 ? ? 137.24 12 12 GLU A 94 ? ? LYS A 95 ? ? -137.01 13 13 GLU A 94 ? ? LYS A 95 ? ? 138.19 14 14 GLU A 94 ? ? LYS A 95 ? ? 129.57 15 15 GLU A 94 ? ? LYS A 95 ? ? 132.32 16 16 GLU A 94 ? ? LYS A 95 ? ? 123.80 17 17 GLU A 94 ? ? LYS A 95 ? ? 123.90 18 18 GLU A 94 ? ? LYS A 95 ? ? 130.17 19 19 GLU A 94 ? ? LYS A 95 ? ? 123.13 20 20 GLU A 94 ? ? LYS A 95 ? ? 126.00 # _pdbx_nmr_ensemble.entry_id 9IBI _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9IBI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM [U-95% 15N] Titin, 50.0 mM sodium chloride, 20.0 mM HEPES, 2.0 mM DTT, 0.02 % w/v sodium azide, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N_sample solution ? 2 '0.5 mM [U-95% 13C; U-95% 15N] Titin, 50.0 mM sodium chloride, 20.0 mM HEPES, 2.0 mM DTT, 0.02 % w/v sodium azide, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N_13C_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Titin 0.5 ? mM '[U-95% 15N]' 1 'sodium chloride' 50.0 ? mM 'natural abundance' 1 HEPES 20.0 ? mM 'natural abundance' 1 DTT 2.0 ? mM 'natural abundance' 1 'sodium azide' 0.02 ? '% w/v' 'natural abundance' 2 Titin 0.5 ? mM '[U-95% 13C; U-95% 15N]' 2 'sodium chloride' 50.0 ? mM 'natural abundance' 2 HEPES 20.0 ? mM 'natural abundance' 2 DTT 2.0 ? mM 'natural abundance' 2 'sodium azide' 0.02 ? '% w/v' 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50.0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err 1.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err 0.02 _pdbx_nmr_exptl_sample_conditions.temperature_err 0.2 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 2 isotropic 2 1 1 '3D 1H-15N NOESY' 2 isotropic 3 1 1 '3D 1H-15N TOCSY' 2 isotropic 4 1 2 '2D 1H-13C HSQC' 1 isotropic 5 1 2 '2D 1H-13C TROSY aromatic' 1 isotropic 6 1 2 '3D 1H-13C NOESY aliphatic' 1 isotropic 7 1 2 '3D 1H-13C NOESY aromatic' 1 isotropic 8 1 2 '3D HNCACB' 2 isotropic 10 1 2 '3D HNCO' 3 isotropic 9 1 2 '3D HN(COC)C(H)' 3 isotropic 11 1 2 '3D HN(COCC)H' 3 isotropic 12 1 1 '3D HNHA' 2 isotropic # _pdbx_nmr_refine.entry_id 9IBI _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'standard parameters used' _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin 4.3 'Bruker Biospin' 2 'chemical shift assignment' 'CcpNmr Analysis' 2.4.2 CCPN 3 'chemical shift assignment' 'CcpNmr Analysis Assign' 3.2.12 CCPN 4 'structure calculation' ARIA 2.3.3 'Michael Nilges, Benjamin Bardiaux' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'British Heart Foundation' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 1827212 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III HD' ? Bruker 950 Crick 2 'AVANCE NEO' ? Bruker 800 KCL 3 'AVANCE III' ? Bruker 700 KCL # _atom_sites.entry_id 9IBI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #