data_9ILE # _entry.id 9ILE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9ILE pdb_00009ile 10.2210/pdb9ile/pdb WWPDB D_1300049073 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-07-02 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9ILE _pdbx_database_status.recvd_initial_deposition_date 2024-06-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email saugata.iitk@gmail.com _pdbx_contact_author.name_first Saugata _pdbx_contact_author.name_last Hazra _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3074-1534 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Dhankhar, K.' 1 ? 'Hazra, S.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of SME-1 Carbapenemase in Complex with Relebactam' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dhankhar, K.' 1 ? primary 'Hazra, S.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man beta-lactamase 30403.297 1 3.5.2.6 ? ? 'Class A Carbapenemase' 2 non-polymer syn '(2S,5R)-1-formyl-N-(piperidin-4-yl)-5-[(sulfooxy)amino]piperidine-2-carboxamide' 350.391 1 ? ? ? ? 3 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 2 ? ? ? ? 4 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 1 ? ? ? ? 5 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 6 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 7 water nat water 18.015 45 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name SME-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGNKSDAAAKQIKKLEEDFDGRIGVFAIDTGSGNTFGYRSDERFPLCSSFKGFLAAAVLERVQQKKLDINQKVKYESRDL EYHSPITTKYKGSGMTLGDMASAALQYSDNGATNIIMERFLGGPEGMTKFMRSIGDNEFRLDRWELELNTAIPGDKRDTS TPKAVANSLNKLALGNVLNAKVKAIYQNWLKGNTTGDARIRASVPADWVVGDKTGSCGAYGTANDYAVIWPKNRAPLIVS IYTTRKSKDDKHSDKTIAEASRIAIQAIDHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGNKSDAAAKQIKKLEEDFDGRIGVFAIDTGSGNTFGYRSDERFPLCSSFKGFLAAAVLERVQQKKLDINQKVKYESRDL EYHSPITTKYKGSGMTLGDMASAALQYSDNGATNIIMERFLGGPEGMTKFMRSIGDNEFRLDRWELELNTAIPGDKRDTS TPKAVANSLNKLALGNVLNAKVKAIYQNWLKGNTTGDARIRASVPADWVVGDKTGSCGAYGTANDYAVIWPKNRAPLIVS IYTTRKSKDDKHSDKTIAEASRIAIQAIDHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2S,5R)-1-formyl-N-(piperidin-4-yl)-5-[(sulfooxy)amino]piperidine-2-carboxamide' MK7 3 'DI(HYDROXYETHYL)ETHER' PEG 4 'TETRAETHYLENE GLYCOL' PG4 5 1,2-ETHANEDIOL EDO 6 'CHLORIDE ION' CL 7 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ASN n 1 4 LYS n 1 5 SER n 1 6 ASP n 1 7 ALA n 1 8 ALA n 1 9 ALA n 1 10 LYS n 1 11 GLN n 1 12 ILE n 1 13 LYS n 1 14 LYS n 1 15 LEU n 1 16 GLU n 1 17 GLU n 1 18 ASP n 1 19 PHE n 1 20 ASP n 1 21 GLY n 1 22 ARG n 1 23 ILE n 1 24 GLY n 1 25 VAL n 1 26 PHE n 1 27 ALA n 1 28 ILE n 1 29 ASP n 1 30 THR n 1 31 GLY n 1 32 SER n 1 33 GLY n 1 34 ASN n 1 35 THR n 1 36 PHE n 1 37 GLY n 1 38 TYR n 1 39 ARG n 1 40 SER n 1 41 ASP n 1 42 GLU n 1 43 ARG n 1 44 PHE n 1 45 PRO n 1 46 LEU n 1 47 CYS n 1 48 SER n 1 49 SER n 1 50 PHE n 1 51 LYS n 1 52 GLY n 1 53 PHE n 1 54 LEU n 1 55 ALA n 1 56 ALA n 1 57 ALA n 1 58 VAL n 1 59 LEU n 1 60 GLU n 1 61 ARG n 1 62 VAL n 1 63 GLN n 1 64 GLN n 1 65 LYS n 1 66 LYS n 1 67 LEU n 1 68 ASP n 1 69 ILE n 1 70 ASN n 1 71 GLN n 1 72 LYS n 1 73 VAL n 1 74 LYS n 1 75 TYR n 1 76 GLU n 1 77 SER n 1 78 ARG n 1 79 ASP n 1 80 LEU n 1 81 GLU n 1 82 TYR n 1 83 HIS n 1 84 SER n 1 85 PRO n 1 86 ILE n 1 87 THR n 1 88 THR n 1 89 LYS n 1 90 TYR n 1 91 LYS n 1 92 GLY n 1 93 SER n 1 94 GLY n 1 95 MET n 1 96 THR n 1 97 LEU n 1 98 GLY n 1 99 ASP n 1 100 MET n 1 101 ALA n 1 102 SER n 1 103 ALA n 1 104 ALA n 1 105 LEU n 1 106 GLN n 1 107 TYR n 1 108 SER n 1 109 ASP n 1 110 ASN n 1 111 GLY n 1 112 ALA n 1 113 THR n 1 114 ASN n 1 115 ILE n 1 116 ILE n 1 117 MET n 1 118 GLU n 1 119 ARG n 1 120 PHE n 1 121 LEU n 1 122 GLY n 1 123 GLY n 1 124 PRO n 1 125 GLU n 1 126 GLY n 1 127 MET n 1 128 THR n 1 129 LYS n 1 130 PHE n 1 131 MET n 1 132 ARG n 1 133 SER n 1 134 ILE n 1 135 GLY n 1 136 ASP n 1 137 ASN n 1 138 GLU n 1 139 PHE n 1 140 ARG n 1 141 LEU n 1 142 ASP n 1 143 ARG n 1 144 TRP n 1 145 GLU n 1 146 LEU n 1 147 GLU n 1 148 LEU n 1 149 ASN n 1 150 THR n 1 151 ALA n 1 152 ILE n 1 153 PRO n 1 154 GLY n 1 155 ASP n 1 156 LYS n 1 157 ARG n 1 158 ASP n 1 159 THR n 1 160 SER n 1 161 THR n 1 162 PRO n 1 163 LYS n 1 164 ALA n 1 165 VAL n 1 166 ALA n 1 167 ASN n 1 168 SER n 1 169 LEU n 1 170 ASN n 1 171 LYS n 1 172 LEU n 1 173 ALA n 1 174 LEU n 1 175 GLY n 1 176 ASN n 1 177 VAL n 1 178 LEU n 1 179 ASN n 1 180 ALA n 1 181 LYS n 1 182 VAL n 1 183 LYS n 1 184 ALA n 1 185 ILE n 1 186 TYR n 1 187 GLN n 1 188 ASN n 1 189 TRP n 1 190 LEU n 1 191 LYS n 1 192 GLY n 1 193 ASN n 1 194 THR n 1 195 THR n 1 196 GLY n 1 197 ASP n 1 198 ALA n 1 199 ARG n 1 200 ILE n 1 201 ARG n 1 202 ALA n 1 203 SER n 1 204 VAL n 1 205 PRO n 1 206 ALA n 1 207 ASP n 1 208 TRP n 1 209 VAL n 1 210 VAL n 1 211 GLY n 1 212 ASP n 1 213 LYS n 1 214 THR n 1 215 GLY n 1 216 SER n 1 217 CYS n 1 218 GLY n 1 219 ALA n 1 220 TYR n 1 221 GLY n 1 222 THR n 1 223 ALA n 1 224 ASN n 1 225 ASP n 1 226 TYR n 1 227 ALA n 1 228 VAL n 1 229 ILE n 1 230 TRP n 1 231 PRO n 1 232 LYS n 1 233 ASN n 1 234 ARG n 1 235 ALA n 1 236 PRO n 1 237 LEU n 1 238 ILE n 1 239 VAL n 1 240 SER n 1 241 ILE n 1 242 TYR n 1 243 THR n 1 244 THR n 1 245 ARG n 1 246 LYS n 1 247 SER n 1 248 LYS n 1 249 ASP n 1 250 ASP n 1 251 LYS n 1 252 HIS n 1 253 SER n 1 254 ASP n 1 255 LYS n 1 256 THR n 1 257 ILE n 1 258 ALA n 1 259 GLU n 1 260 ALA n 1 261 SER n 1 262 ARG n 1 263 ILE n 1 264 ALA n 1 265 ILE n 1 266 GLN n 1 267 ALA n 1 268 ILE n 1 269 ASP n 1 270 HIS n 1 271 HIS n 1 272 HIS n 1 273 HIS n 1 274 HIS n 1 275 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 275 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'sme-2, blaSME-1, blaSME-4, blaSME1, SME12620_22' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Serratia marcescens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 615 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MK7 non-polymer . '(2S,5R)-1-formyl-N-(piperidin-4-yl)-5-[(sulfooxy)amino]piperidine-2-carboxamide' 'MK-7655, bound form' 'C12 H22 N4 O6 S' 350.391 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -1 ? ? ? A . n A 1 2 GLY 2 0 ? ? ? A . n A 1 3 ASN 3 1 1 ASN ASN A . n A 1 4 LYS 4 2 2 LYS LYS A . n A 1 5 SER 5 3 3 SER SER A . n A 1 6 ASP 6 4 4 ASP ASP A . n A 1 7 ALA 7 5 5 ALA ALA A . n A 1 8 ALA 8 6 6 ALA ALA A . n A 1 9 ALA 9 7 7 ALA ALA A . n A 1 10 LYS 10 8 8 LYS LYS A . n A 1 11 GLN 11 9 9 GLN GLN A . n A 1 12 ILE 12 10 10 ILE ILE A . n A 1 13 LYS 13 11 11 LYS LYS A . n A 1 14 LYS 14 12 12 LYS LYS A . n A 1 15 LEU 15 13 13 LEU LEU A . n A 1 16 GLU 16 14 14 GLU GLU A . n A 1 17 GLU 17 15 15 GLU GLU A . n A 1 18 ASP 18 16 16 ASP ASP A . n A 1 19 PHE 19 17 17 PHE PHE A . n A 1 20 ASP 20 18 18 ASP ASP A . n A 1 21 GLY 21 19 19 GLY GLY A . n A 1 22 ARG 22 20 20 ARG ARG A . n A 1 23 ILE 23 21 21 ILE ILE A . n A 1 24 GLY 24 22 22 GLY GLY A . n A 1 25 VAL 25 23 23 VAL VAL A . n A 1 26 PHE 26 24 24 PHE PHE A . n A 1 27 ALA 27 25 25 ALA ALA A . n A 1 28 ILE 28 26 26 ILE ILE A . n A 1 29 ASP 29 27 27 ASP ASP A . n A 1 30 THR 30 28 28 THR THR A . n A 1 31 GLY 31 29 29 GLY GLY A . n A 1 32 SER 32 30 30 SER SER A . n A 1 33 GLY 33 31 31 GLY GLY A . n A 1 34 ASN 34 32 32 ASN ASN A . n A 1 35 THR 35 33 33 THR THR A . n A 1 36 PHE 36 34 34 PHE PHE A . n A 1 37 GLY 37 35 35 GLY GLY A . n A 1 38 TYR 38 36 36 TYR TYR A . n A 1 39 ARG 39 37 37 ARG ARG A . n A 1 40 SER 40 38 38 SER SER A . n A 1 41 ASP 41 39 39 ASP ASP A . n A 1 42 GLU 42 40 40 GLU GLU A . n A 1 43 ARG 43 41 41 ARG ARG A . n A 1 44 PHE 44 42 42 PHE PHE A . n A 1 45 PRO 45 43 43 PRO PRO A . n A 1 46 LEU 46 44 44 LEU LEU A . n A 1 47 CYS 47 45 45 CYS CYS A . n A 1 48 SER 48 46 46 SER SER A . n A 1 49 SER 49 47 47 SER SER A . n A 1 50 PHE 50 48 48 PHE PHE A . n A 1 51 LYS 51 49 49 LYS LYS A . n A 1 52 GLY 52 50 50 GLY GLY A . n A 1 53 PHE 53 51 51 PHE PHE A . n A 1 54 LEU 54 52 52 LEU LEU A . n A 1 55 ALA 55 53 53 ALA ALA A . n A 1 56 ALA 56 54 54 ALA ALA A . n A 1 57 ALA 57 55 55 ALA ALA A . n A 1 58 VAL 58 56 56 VAL VAL A . n A 1 59 LEU 59 57 57 LEU LEU A . n A 1 60 GLU 60 58 58 GLU GLU A . n A 1 61 ARG 61 59 59 ARG ARG A . n A 1 62 VAL 62 60 60 VAL VAL A . n A 1 63 GLN 63 61 61 GLN GLN A . n A 1 64 GLN 64 62 62 GLN GLN A . n A 1 65 LYS 65 63 63 LYS LYS A . n A 1 66 LYS 66 64 64 LYS LYS A . n A 1 67 LEU 67 65 65 LEU LEU A . n A 1 68 ASP 68 66 66 ASP ASP A . n A 1 69 ILE 69 67 67 ILE ILE A . n A 1 70 ASN 70 68 68 ASN ASN A . n A 1 71 GLN 71 69 69 GLN GLN A . n A 1 72 LYS 72 70 70 LYS LYS A . n A 1 73 VAL 73 71 71 VAL VAL A . n A 1 74 LYS 74 72 72 LYS LYS A . n A 1 75 TYR 75 73 73 TYR TYR A . n A 1 76 GLU 76 74 74 GLU GLU A . n A 1 77 SER 77 75 75 SER SER A . n A 1 78 ARG 78 76 76 ARG ARG A . n A 1 79 ASP 79 77 77 ASP ASP A . n A 1 80 LEU 80 78 78 LEU LEU A . n A 1 81 GLU 81 79 79 GLU GLU A . n A 1 82 TYR 82 80 80 TYR TYR A . n A 1 83 HIS 83 81 81 HIS HIS A . n A 1 84 SER 84 82 82 SER SER A . n A 1 85 PRO 85 83 83 PRO PRO A . n A 1 86 ILE 86 84 84 ILE ILE A . n A 1 87 THR 87 85 85 THR THR A . n A 1 88 THR 88 86 86 THR THR A . n A 1 89 LYS 89 87 87 LYS LYS A . n A 1 90 TYR 90 88 88 TYR TYR A . n A 1 91 LYS 91 89 89 LYS LYS A . n A 1 92 GLY 92 90 90 GLY GLY A . n A 1 93 SER 93 91 91 SER SER A . n A 1 94 GLY 94 92 92 GLY GLY A . n A 1 95 MET 95 93 93 MET MET A . n A 1 96 THR 96 94 94 THR THR A . n A 1 97 LEU 97 95 95 LEU LEU A . n A 1 98 GLY 98 96 96 GLY GLY A . n A 1 99 ASP 99 97 97 ASP ASP A . n A 1 100 MET 100 98 98 MET MET A . n A 1 101 ALA 101 99 99 ALA ALA A . n A 1 102 SER 102 100 100 SER SER A . n A 1 103 ALA 103 101 101 ALA ALA A . n A 1 104 ALA 104 102 102 ALA ALA A . n A 1 105 LEU 105 103 103 LEU LEU A . n A 1 106 GLN 106 104 104 GLN GLN A . n A 1 107 TYR 107 105 105 TYR TYR A . n A 1 108 SER 108 106 106 SER SER A . n A 1 109 ASP 109 107 107 ASP ASP A . n A 1 110 ASN 110 108 108 ASN ASN A . n A 1 111 GLY 111 109 109 GLY GLY A . n A 1 112 ALA 112 110 110 ALA ALA A . n A 1 113 THR 113 111 111 THR THR A . n A 1 114 ASN 114 112 112 ASN ASN A . n A 1 115 ILE 115 113 113 ILE ILE A . n A 1 116 ILE 116 114 114 ILE ILE A . n A 1 117 MET 117 115 115 MET MET A . n A 1 118 GLU 118 116 116 GLU GLU A . n A 1 119 ARG 119 117 117 ARG ARG A . n A 1 120 PHE 120 118 118 PHE PHE A . n A 1 121 LEU 121 119 119 LEU LEU A . n A 1 122 GLY 122 120 120 GLY GLY A . n A 1 123 GLY 123 121 121 GLY GLY A . n A 1 124 PRO 124 122 122 PRO PRO A . n A 1 125 GLU 125 123 123 GLU GLU A . n A 1 126 GLY 126 124 124 GLY GLY A . n A 1 127 MET 127 125 125 MET MET A . n A 1 128 THR 128 126 126 THR THR A . n A 1 129 LYS 129 127 127 LYS LYS A . n A 1 130 PHE 130 128 128 PHE PHE A . n A 1 131 MET 131 129 129 MET MET A . n A 1 132 ARG 132 130 130 ARG ARG A . n A 1 133 SER 133 131 131 SER SER A . n A 1 134 ILE 134 132 132 ILE ILE A . n A 1 135 GLY 135 133 133 GLY GLY A . n A 1 136 ASP 136 134 134 ASP ASP A . n A 1 137 ASN 137 135 135 ASN ASN A . n A 1 138 GLU 138 136 136 GLU GLU A . n A 1 139 PHE 139 137 137 PHE PHE A . n A 1 140 ARG 140 138 138 ARG ARG A . n A 1 141 LEU 141 139 139 LEU LEU A . n A 1 142 ASP 142 140 140 ASP ASP A . n A 1 143 ARG 143 141 141 ARG ARG A . n A 1 144 TRP 144 142 142 TRP TRP A . n A 1 145 GLU 145 143 143 GLU GLU A . n A 1 146 LEU 146 144 144 LEU LEU A . n A 1 147 GLU 147 145 145 GLU GLU A . n A 1 148 LEU 148 146 146 LEU LEU A . n A 1 149 ASN 149 147 147 ASN ASN A . n A 1 150 THR 150 148 148 THR THR A . n A 1 151 ALA 151 149 149 ALA ALA A . n A 1 152 ILE 152 150 150 ILE ILE A . n A 1 153 PRO 153 151 151 PRO PRO A . n A 1 154 GLY 154 152 152 GLY GLY A . n A 1 155 ASP 155 153 153 ASP ASP A . n A 1 156 LYS 156 154 154 LYS LYS A . n A 1 157 ARG 157 155 155 ARG ARG A . n A 1 158 ASP 158 156 156 ASP ASP A . n A 1 159 THR 159 157 157 THR THR A . n A 1 160 SER 160 158 158 SER SER A . n A 1 161 THR 161 159 159 THR THR A . n A 1 162 PRO 162 160 160 PRO PRO A . n A 1 163 LYS 163 161 161 LYS LYS A . n A 1 164 ALA 164 162 162 ALA ALA A . n A 1 165 VAL 165 163 163 VAL VAL A . n A 1 166 ALA 166 164 164 ALA ALA A . n A 1 167 ASN 167 165 165 ASN ASN A . n A 1 168 SER 168 166 166 SER SER A . n A 1 169 LEU 169 167 167 LEU LEU A . n A 1 170 ASN 170 168 168 ASN ASN A . n A 1 171 LYS 171 169 169 LYS LYS A . n A 1 172 LEU 172 170 170 LEU LEU A . n A 1 173 ALA 173 171 171 ALA ALA A . n A 1 174 LEU 174 172 172 LEU LEU A . n A 1 175 GLY 175 173 173 GLY GLY A . n A 1 176 ASN 176 174 174 ASN ASN A . n A 1 177 VAL 177 175 175 VAL VAL A . n A 1 178 LEU 178 176 176 LEU LEU A . n A 1 179 ASN 179 177 177 ASN ASN A . n A 1 180 ALA 180 178 178 ALA ALA A . n A 1 181 LYS 181 179 179 LYS LYS A . n A 1 182 VAL 182 180 180 VAL VAL A . n A 1 183 LYS 183 181 181 LYS LYS A . n A 1 184 ALA 184 182 182 ALA ALA A . n A 1 185 ILE 185 183 183 ILE ILE A . n A 1 186 TYR 186 184 184 TYR TYR A . n A 1 187 GLN 187 185 185 GLN GLN A . n A 1 188 ASN 188 186 186 ASN ASN A . n A 1 189 TRP 189 187 187 TRP TRP A . n A 1 190 LEU 190 188 188 LEU LEU A . n A 1 191 LYS 191 189 189 LYS LYS A . n A 1 192 GLY 192 190 190 GLY GLY A . n A 1 193 ASN 193 191 191 ASN ASN A . n A 1 194 THR 194 192 192 THR THR A . n A 1 195 THR 195 193 193 THR THR A . n A 1 196 GLY 196 194 194 GLY GLY A . n A 1 197 ASP 197 195 195 ASP ASP A . n A 1 198 ALA 198 196 196 ALA ALA A . n A 1 199 ARG 199 197 197 ARG ARG A . n A 1 200 ILE 200 198 198 ILE ILE A . n A 1 201 ARG 201 199 199 ARG ARG A . n A 1 202 ALA 202 200 200 ALA ALA A . n A 1 203 SER 203 201 201 SER SER A . n A 1 204 VAL 204 202 202 VAL VAL A . n A 1 205 PRO 205 203 203 PRO PRO A . n A 1 206 ALA 206 204 204 ALA ALA A . n A 1 207 ASP 207 205 205 ASP ASP A . n A 1 208 TRP 208 206 206 TRP TRP A . n A 1 209 VAL 209 207 207 VAL VAL A . n A 1 210 VAL 210 208 208 VAL VAL A . n A 1 211 GLY 211 209 209 GLY GLY A . n A 1 212 ASP 212 210 210 ASP ASP A . n A 1 213 LYS 213 211 211 LYS LYS A . n A 1 214 THR 214 212 212 THR THR A . n A 1 215 GLY 215 213 213 GLY GLY A . n A 1 216 SER 216 214 214 SER SER A . n A 1 217 CYS 217 215 215 CYS CYS A . n A 1 218 GLY 218 216 216 GLY GLY A . n A 1 219 ALA 219 217 217 ALA ALA A . n A 1 220 TYR 220 218 218 TYR TYR A . n A 1 221 GLY 221 219 219 GLY GLY A . n A 1 222 THR 222 220 220 THR THR A . n A 1 223 ALA 223 221 221 ALA ALA A . n A 1 224 ASN 224 222 222 ASN ASN A . n A 1 225 ASP 225 223 223 ASP ASP A . n A 1 226 TYR 226 224 224 TYR TYR A . n A 1 227 ALA 227 225 225 ALA ALA A . n A 1 228 VAL 228 226 226 VAL VAL A . n A 1 229 ILE 229 227 227 ILE ILE A . n A 1 230 TRP 230 228 228 TRP TRP A . n A 1 231 PRO 231 229 229 PRO PRO A . n A 1 232 LYS 232 230 230 LYS LYS A . n A 1 233 ASN 233 231 231 ASN ASN A . n A 1 234 ARG 234 232 232 ARG ARG A . n A 1 235 ALA 235 233 233 ALA ALA A . n A 1 236 PRO 236 234 234 PRO PRO A . n A 1 237 LEU 237 235 235 LEU LEU A . n A 1 238 ILE 238 236 236 ILE ILE A . n A 1 239 VAL 239 237 237 VAL VAL A . n A 1 240 SER 240 238 238 SER SER A . n A 1 241 ILE 241 239 239 ILE ILE A . n A 1 242 TYR 242 240 240 TYR TYR A . n A 1 243 THR 243 241 241 THR THR A . n A 1 244 THR 244 242 242 THR THR A . n A 1 245 ARG 245 243 243 ARG ARG A . n A 1 246 LYS 246 244 244 LYS LYS A . n A 1 247 SER 247 245 245 SER SER A . n A 1 248 LYS 248 246 246 LYS LYS A . n A 1 249 ASP 249 247 247 ASP ASP A . n A 1 250 ASP 250 248 248 ASP ASP A . n A 1 251 LYS 251 249 249 LYS LYS A . n A 1 252 HIS 252 250 250 HIS HIS A . n A 1 253 SER 253 251 251 SER SER A . n A 1 254 ASP 254 252 252 ASP ASP A . n A 1 255 LYS 255 253 253 LYS LYS A . n A 1 256 THR 256 254 254 THR THR A . n A 1 257 ILE 257 255 255 ILE ILE A . n A 1 258 ALA 258 256 256 ALA ALA A . n A 1 259 GLU 259 257 257 GLU GLU A . n A 1 260 ALA 260 258 258 ALA ALA A . n A 1 261 SER 261 259 259 SER SER A . n A 1 262 ARG 262 260 260 ARG ARG A . n A 1 263 ILE 263 261 261 ILE ILE A . n A 1 264 ALA 264 262 262 ALA ALA A . n A 1 265 ILE 265 263 263 ILE ILE A . n A 1 266 GLN 266 264 264 GLN GLN A . n A 1 267 ALA 267 265 265 ALA ALA A . n A 1 268 ILE 268 266 266 ILE ILE A . n A 1 269 ASP 269 267 267 ASP ASP A . n A 1 270 HIS 270 268 ? ? ? A . n A 1 271 HIS 271 269 ? ? ? A . n A 1 272 HIS 272 270 ? ? ? A . n A 1 273 HIS 273 271 ? ? ? A . n A 1 274 HIS 274 272 ? ? ? A . n A 1 275 HIS 275 273 ? ? ? A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 CL ? ? CL ? ? 'SUBJECT OF INVESTIGATION' ? 2 EDO ? ? EDO ? ? 'SUBJECT OF INVESTIGATION' ? 3 MK7 ? ? MK7 ? ? 'SUBJECT OF INVESTIGATION' ? 4 PEG ? ? PEG ? ? 'SUBJECT OF INVESTIGATION' ? 5 PG4 ? ? PG4 ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MK7 1 301 301 MK7 MK7 A . C 3 PEG 1 302 303 PEG PEG A . D 4 PG4 1 303 304 PG4 PG4 A . E 3 PEG 1 304 305 PEG PEG A . F 5 EDO 1 305 306 EDO EDO A . G 6 CL 1 306 2 CL CL A . H 7 HOH 1 401 26 HOH HOH A . H 7 HOH 2 402 35 HOH HOH A . H 7 HOH 3 403 42 HOH HOH A . H 7 HOH 4 404 8 HOH HOH A . H 7 HOH 5 405 37 HOH HOH A . H 7 HOH 6 406 25 HOH HOH A . H 7 HOH 7 407 13 HOH HOH A . H 7 HOH 8 408 30 HOH HOH A . H 7 HOH 9 409 14 HOH HOH A . H 7 HOH 10 410 39 HOH HOH A . H 7 HOH 11 411 16 HOH HOH A . H 7 HOH 12 412 6 HOH HOH A . H 7 HOH 13 413 22 HOH HOH A . H 7 HOH 14 414 33 HOH HOH A . H 7 HOH 15 415 46 HOH HOH A . H 7 HOH 16 416 40 HOH HOH A . H 7 HOH 17 417 17 HOH HOH A . H 7 HOH 18 418 18 HOH HOH A . H 7 HOH 19 419 36 HOH HOH A . H 7 HOH 20 420 31 HOH HOH A . H 7 HOH 21 421 41 HOH HOH A . H 7 HOH 22 422 20 HOH HOH A . H 7 HOH 23 423 21 HOH HOH A . H 7 HOH 24 424 45 HOH HOH A . H 7 HOH 25 425 10 HOH HOH A . H 7 HOH 26 426 3 HOH HOH A . H 7 HOH 27 427 28 HOH HOH A . H 7 HOH 28 428 7 HOH HOH A . H 7 HOH 29 429 24 HOH HOH A . H 7 HOH 30 430 27 HOH HOH A . H 7 HOH 31 431 23 HOH HOH A . H 7 HOH 32 432 9 HOH HOH A . H 7 HOH 33 433 34 HOH HOH A . H 7 HOH 34 434 15 HOH HOH A . H 7 HOH 35 435 12 HOH HOH A . H 7 HOH 36 436 19 HOH HOH A . H 7 HOH 37 437 2 HOH HOH A . H 7 HOH 38 438 47 HOH HOH A . H 7 HOH 39 439 4 HOH HOH A . H 7 HOH 40 440 48 HOH HOH A . H 7 HOH 41 441 49 HOH HOH A . H 7 HOH 42 442 32 HOH HOH A . H 7 HOH 43 443 43 HOH HOH A . H 7 HOH 44 444 1 HOH HOH A . H 7 HOH 45 445 51 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 1 ? CG ? A ASN 3 CG 2 1 Y 1 A ASN 1 ? OD1 ? A ASN 3 OD1 3 1 Y 1 A ASN 1 ? ND2 ? A ASN 3 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0425 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 99.866 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 9ILE _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.852 _cell.length_a_esd ? _cell.length_b 50.44 _cell.length_b_esd ? _cell.length_c 60.62 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9ILE _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9ILE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.78 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 31.28 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG4000, 0.2M Lithium Chloride' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU HyPix-6000HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-06-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9ILE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.20 _reflns.d_resolution_low 25.22 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10649 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.124 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.20 _reflns_shell.d_res_low 2.27 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 915 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.846 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.449 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 1.046 _refine.aniso_B[2][2] -2.388 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 1.486 _refine.B_iso_max ? _refine.B_iso_mean 26.793 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.949 _refine.correlation_coeff_Fo_to_Fc_free 0.893 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9ILE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.380 _refine.ls_d_res_low 24.740 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8422 _refine.ls_number_reflns_R_free 421 _refine.ls_number_reflns_R_work 8001 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.799 _refine.ls_percent_reflns_R_free 4.999 _refine.ls_R_factor_all 0.170 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2555 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1652 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.322 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 19.972 _refine.overall_SU_ML 0.226 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2062 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 55 _refine_hist.number_atoms_solvent 45 _refine_hist.number_atoms_total 2162 _refine_hist.d_res_high 2.380 _refine_hist.d_res_low 24.740 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.012 2155 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 2.709 1.818 2888 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 8.714 5.000 266 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 12.480 5.000 17 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.829 10.000 375 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 14.238 10.000 93 ? r_dihedral_angle_6_deg ? ? 'X-RAY DIFFRACTION' ? 0.171 0.200 314 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 0.020 1595 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.248 0.200 1082 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.319 0.200 1453 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.240 0.200 114 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.366 0.200 74 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.164 0.200 11 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 1.840 1.704 1067 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.771 3.059 1332 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.846 1.900 1088 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.179 3.382 1556 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 6.287 22.888 3404 ? r_lrange_it ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.380 2.441 610 . 35 575 100.0000 . 0.171 . . 0.161 . . . . . 0.146 . 20 . 0.981 0.911 0.349 'X-RAY DIFFRACTION' 2.441 2.508 603 . 25 577 99.8342 . 0.173 . . 0.166 . . . . . 0.150 . 20 . 0.981 0.928 0.349 'X-RAY DIFFRACTION' 2.508 2.580 564 . 36 528 100.0000 . 0.185 . . 0.178 . . . . . 0.158 . 20 . 0.978 0.955 0.275 'X-RAY DIFFRACTION' 2.580 2.658 587 . 23 564 100.0000 . 0.167 . . 0.162 . . . . . 0.144 . 20 . 0.982 0.966 0.272 'X-RAY DIFFRACTION' 2.658 2.744 533 . 23 510 100.0000 . 0.155 . . 0.149 . . . . . 0.130 . 20 . 0.985 0.945 0.283 'X-RAY DIFFRACTION' 2.744 2.839 533 . 33 500 100.0000 . 0.176 . . 0.167 . . . . . 0.148 . 20 . 0.981 0.926 0.334 'X-RAY DIFFRACTION' 2.839 2.945 514 . 34 480 100.0000 . 0.181 . . 0.169 . . . . . 0.151 . 20 . 0.980 0.929 0.349 'X-RAY DIFFRACTION' 2.945 3.063 492 . 26 466 100.0000 . 0.188 . . 0.186 . . . . . 0.169 . 20 . 0.976 0.964 0.232 'X-RAY DIFFRACTION' 3.063 3.197 480 . 20 460 100.0000 . 0.181 . . 0.177 . . . . . 0.158 . 20 . 0.977 0.941 0.283 'X-RAY DIFFRACTION' 3.197 3.351 450 . 19 431 100.0000 . 0.169 . . 0.163 . . . . . 0.150 . 20 . 0.982 0.919 0.338 'X-RAY DIFFRACTION' 3.351 3.528 437 . 20 416 99.7712 . 0.164 . . 0.161 . . . . . 0.146 . 20 . 0.984 0.967 0.228 'X-RAY DIFFRACTION' 3.528 3.738 413 . 29 384 100.0000 . 0.163 . . 0.160 . . . . . 0.150 . 20 . 0.983 0.975 0.197 'X-RAY DIFFRACTION' 3.738 3.989 384 . 26 356 99.4792 . 0.152 . . 0.145 . . . . . 0.137 . 20 . 0.987 0.963 0.245 'X-RAY DIFFRACTION' 3.989 4.299 376 . 17 359 100.0000 . 0.171 . . 0.170 . . . . . 0.156 . 20 . 0.982 0.972 0.189 'X-RAY DIFFRACTION' 4.299 4.696 330 . 9 319 99.3939 . 0.166 . . 0.165 . . . . . 0.162 . 20 . 0.983 0.981 0.185 'X-RAY DIFFRACTION' 4.696 5.226 298 . 13 285 100.0000 . 0.157 . . 0.154 . . . . . 0.150 . 20 . 0.984 0.967 0.210 'X-RAY DIFFRACTION' 5.226 5.991 277 . 17 260 100.0000 . 0.180 . . 0.177 . . . . . 0.171 . 20 . 0.978 0.976 0.220 'X-RAY DIFFRACTION' 5.991 7.232 236 . 6 230 100.0000 . 0.185 . . 0.182 . . . . . 0.169 . 20 . 0.980 0.965 0.359 'X-RAY DIFFRACTION' 7.232 9.816 187 . 5 182 100.0000 . 0.139 . . 0.139 . . . . . 0.139 . 20 . 0.988 0.984 0.138 'X-RAY DIFFRACTION' 9.816 24.740 125 . 5 118 98.4000 . 0.212 . . 0.210 . . . . . 0.205 . 20 . 0.972 0.919 0.269 # _struct.entry_id 9ILE _struct.title 'Crystal Structure of SME-1 Carbapenemase in Complex with Relebactam' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9ILE _struct_keywords.text 'DBOs, Complex, Carbapenemase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 3 ? F N N 5 ? G N N 6 ? H N N 7 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q54488_SERMA _struct_ref.pdbx_db_accession Q54488 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NKSDAAAKQIKKLEEDFDGRIGVFAIDTGSGNTFGYRSDERFPLCSSFKGFLAAAVLERVQQKKLDINQKVKYESRDLEY HSPITTKYKGSGMTLGDMASAALQYSDNGATNIIMERFLGGPEGMTKFMRSIGDNEFRLDRWELELNTAIPGDKRDTSTP KAVANSLNKLALGNVLNAKVKAIYQNWLKGNTTGDARIRASVPADWVVGDKTGSCGAYGTANDYAVIWPKNRAPLIVSIY TTRKSKDDKHSDKTIAEASRIAIQAID ; _struct_ref.pdbx_align_begin 28 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9ILE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 269 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q54488 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 294 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 267 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9ILE MET A 1 ? UNP Q54488 ? ? 'initiating methionine' -1 1 1 9ILE GLY A 2 ? UNP Q54488 ? ? 'expression tag' 0 2 1 9ILE HIS A 270 ? UNP Q54488 ? ? 'expression tag' 268 3 1 9ILE HIS A 271 ? UNP Q54488 ? ? 'expression tag' 269 4 1 9ILE HIS A 272 ? UNP Q54488 ? ? 'expression tag' 270 5 1 9ILE HIS A 273 ? UNP Q54488 ? ? 'expression tag' 271 6 1 9ILE HIS A 274 ? UNP Q54488 ? ? 'expression tag' 272 7 1 9ILE HIS A 275 ? UNP Q54488 ? ? 'expression tag' 273 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 80 ? 1 MORE -5 ? 1 'SSA (A^2)' 10860 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 3 ? PHE A 19 ? ASN A 1 PHE A 17 1 ? 17 HELX_P HELX_P2 AA2 CYS A 47 ? SER A 49 ? CYS A 45 SER A 47 5 ? 3 HELX_P HELX_P3 AA3 PHE A 50 ? GLN A 64 ? PHE A 48 GLN A 62 1 ? 15 HELX_P HELX_P4 AA4 ILE A 86 ? LYS A 91 ? ILE A 84 LYS A 89 5 ? 6 HELX_P HELX_P5 AA5 LEU A 97 ? SER A 108 ? LEU A 95 SER A 106 1 ? 12 HELX_P HELX_P6 AA6 ASP A 109 ? PHE A 120 ? ASP A 107 PHE A 118 1 ? 12 HELX_P HELX_P7 AA7 GLY A 122 ? SER A 133 ? GLY A 120 SER A 131 1 ? 12 HELX_P HELX_P8 AA8 LEU A 146 ? THR A 150 ? LEU A 144 THR A 148 5 ? 5 HELX_P HELX_P9 AA9 THR A 161 ? GLY A 175 ? THR A 159 GLY A 173 1 ? 15 HELX_P HELX_P10 AB1 ASN A 179 ? GLY A 192 ? ASN A 177 GLY A 190 1 ? 14 HELX_P HELX_P11 AB2 ILE A 200 ? VAL A 204 ? ILE A 198 VAL A 202 5 ? 5 HELX_P HELX_P12 AB3 SER A 253 ? ASP A 269 ? SER A 251 ASP A 267 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 47 SG ? ? ? 1_555 A CYS 217 SG ? ? A CYS 45 A CYS 215 1_555 ? ? ? ? ? ? ? 2.332 ? ? covale1 covale one ? A SER 48 OG ? ? ? 1_555 B MK7 . C8 ? ? A SER 46 A MK7 301 1_555 ? ? ? ? ? ? ? 1.307 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MK7 B . ? SER A 48 ? MK7 A 301 ? 1_555 SER A 46 ? 1_555 C8 OG SER 1 MK7 None 'Covalent chemical modification' 2 CYS A 47 ? CYS A 217 ? CYS A 45 ? 1_555 CYS A 215 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 145 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 143 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 LEU _struct_mon_prot_cis.pdbx_label_seq_id_2 146 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 LEU _struct_mon_prot_cis.pdbx_auth_seq_id_2 144 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.82 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 35 ? TYR A 38 ? THR A 33 TYR A 36 AA1 2 GLY A 21 ? ASP A 29 ? GLY A 19 ASP A 27 AA1 3 LEU A 237 ? ARG A 245 ? LEU A 235 ARG A 243 AA1 4 ALA A 223 ? TRP A 230 ? ALA A 221 TRP A 228 AA1 5 VAL A 209 ? SER A 216 ? VAL A 207 SER A 214 AA2 1 PHE A 44 ? PRO A 45 ? PHE A 42 PRO A 43 AA2 2 THR A 159 ? SER A 160 ? THR A 157 SER A 158 AA3 1 LYS A 72 ? VAL A 73 ? LYS A 70 VAL A 71 AA3 2 MET A 95 ? THR A 96 ? MET A 93 THR A 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 38 ? O TYR A 36 N VAL A 25 ? N VAL A 23 AA1 2 3 N GLY A 24 ? N GLY A 22 O TYR A 242 ? O TYR A 240 AA1 3 4 O VAL A 239 ? O VAL A 237 N ALA A 227 ? N ALA A 225 AA1 4 5 O TRP A 230 ? O TRP A 228 N VAL A 209 ? N VAL A 207 AA2 1 2 N PHE A 44 ? N PHE A 42 O SER A 160 ? O SER A 158 AA3 1 2 N VAL A 73 ? N VAL A 71 O MET A 95 ? O MET A 93 # _pdbx_entry_details.entry_id 9ILE _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O4 A PG4 303 ? ? O4 A PEG 304 ? B 2.05 2 1 OG A SER 46 ? ? O18 A MK7 301 ? ? 2.07 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A LYS 2 ? ? CA A LYS 2 ? ? C A LYS 2 ? ? 124.14 110.40 13.74 2.00 N 2 1 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH2 A ARG 41 ? ? 116.92 120.30 -3.38 0.50 N 3 1 CD A ARG 59 ? ? NE A ARG 59 ? ? CZ A ARG 59 ? ? 132.84 123.60 9.24 1.40 N 4 1 CG A ARG 76 ? ? CD A ARG 76 ? ? NE A ARG 76 ? ? 124.96 111.80 13.16 2.10 N 5 1 OG1 A THR 86 ? ? CB A THR 86 ? ? CG2 A THR 86 ? ? 93.28 110.00 -16.72 2.30 N 6 1 CD A LYS 154 ? ? CE A LYS 154 ? ? NZ A LYS 154 ? ? 130.39 111.70 18.69 2.30 N 7 1 CB A LYS 189 ? ? CG A LYS 189 ? ? CD A LYS 189 ? ? 94.20 111.60 -17.40 2.60 N 8 1 CD A LYS 253 ? ? CE A LYS 253 ? ? NZ A LYS 253 ? ? 93.15 111.70 -18.55 2.30 N 9 1 CD A ARG 260 ? ? NE A ARG 260 ? ? CZ A ARG 260 ? ? 135.36 123.60 11.76 1.40 N 10 1 NE A ARG 260 ? ? CZ A ARG 260 ? ? NH1 A ARG 260 ? ? 123.65 120.30 3.35 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 45 ? ? 48.49 -145.56 2 1 GLN A 62 ? ? -46.57 -19.13 3 1 LYS A 63 ? ? 72.90 31.53 4 1 TYR A 73 ? ? -166.66 38.56 5 1 TYR A 80 ? ? -34.54 137.44 6 1 SER A 82 ? ? -119.36 61.42 7 1 ASN A 177 ? ? -61.84 -179.43 8 1 ARG A 197 ? ? -102.70 -111.75 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 20 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.164 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 14.3795 _pdbx_refine_tls.origin_y -0.3547 _pdbx_refine_tls.origin_z 14.7711 _pdbx_refine_tls.T[1][1] 0.0150 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0101 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0081 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0196 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0109 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0068 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.6479 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.4047 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.2270 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.8508 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.6065 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.2151 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0025 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0076 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0122 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.1006 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0088 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0182 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0704 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0360 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0063 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 267 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ALL _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -1 ? A MET 1 2 1 Y 1 A GLY 0 ? A GLY 2 3 1 Y 1 A HIS 268 ? A HIS 270 4 1 Y 1 A HIS 269 ? A HIS 271 5 1 Y 1 A HIS 270 ? A HIS 272 6 1 Y 1 A HIS 271 ? A HIS 273 7 1 Y 1 A HIS 272 ? A HIS 274 8 1 Y 1 A HIS 273 ? A HIS 275 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 EDO C1 C N N 89 EDO O1 O N N 90 EDO C2 C N N 91 EDO O2 O N N 92 EDO H11 H N N 93 EDO H12 H N N 94 EDO HO1 H N N 95 EDO H21 H N N 96 EDO H22 H N N 97 EDO HO2 H N N 98 GLN N N N N 99 GLN CA C N S 100 GLN C C N N 101 GLN O O N N 102 GLN CB C N N 103 GLN CG C N N 104 GLN CD C N N 105 GLN OE1 O N N 106 GLN NE2 N N N 107 GLN OXT O N N 108 GLN H H N N 109 GLN H2 H N N 110 GLN HA H N N 111 GLN HB2 H N N 112 GLN HB3 H N N 113 GLN HG2 H N N 114 GLN HG3 H N N 115 GLN HE21 H N N 116 GLN HE22 H N N 117 GLN HXT H N N 118 GLU N N N N 119 GLU CA C N S 120 GLU C C N N 121 GLU O O N N 122 GLU CB C N N 123 GLU CG C N N 124 GLU CD C N N 125 GLU OE1 O N N 126 GLU OE2 O N N 127 GLU OXT O N N 128 GLU H H N N 129 GLU H2 H N N 130 GLU HA H N N 131 GLU HB2 H N N 132 GLU HB3 H N N 133 GLU HG2 H N N 134 GLU HG3 H N N 135 GLU HE2 H N N 136 GLU HXT H N N 137 GLY N N N N 138 GLY CA C N N 139 GLY C C N N 140 GLY O O N N 141 GLY OXT O N N 142 GLY H H N N 143 GLY H2 H N N 144 GLY HA2 H N N 145 GLY HA3 H N N 146 GLY HXT H N N 147 HIS N N N N 148 HIS CA C N S 149 HIS C C N N 150 HIS O O N N 151 HIS CB C N N 152 HIS CG C Y N 153 HIS ND1 N Y N 154 HIS CD2 C Y N 155 HIS CE1 C Y N 156 HIS NE2 N Y N 157 HIS OXT O N N 158 HIS H H N N 159 HIS H2 H N N 160 HIS HA H N N 161 HIS HB2 H N N 162 HIS HB3 H N N 163 HIS HD1 H N N 164 HIS HD2 H N N 165 HIS HE1 H N N 166 HIS HE2 H N N 167 HIS HXT H N N 168 HOH O O N N 169 HOH H1 H N N 170 HOH H2 H N N 171 ILE N N N N 172 ILE CA C N S 173 ILE C C N N 174 ILE O O N N 175 ILE CB C N S 176 ILE CG1 C N N 177 ILE CG2 C N N 178 ILE CD1 C N N 179 ILE OXT O N N 180 ILE H H N N 181 ILE H2 H N N 182 ILE HA H N N 183 ILE HB H N N 184 ILE HG12 H N N 185 ILE HG13 H N N 186 ILE HG21 H N N 187 ILE HG22 H N N 188 ILE HG23 H N N 189 ILE HD11 H N N 190 ILE HD12 H N N 191 ILE HD13 H N N 192 ILE HXT H N N 193 LEU N N N N 194 LEU CA C N S 195 LEU C C N N 196 LEU O O N N 197 LEU CB C N N 198 LEU CG C N N 199 LEU CD1 C N N 200 LEU CD2 C N N 201 LEU OXT O N N 202 LEU H H N N 203 LEU H2 H N N 204 LEU HA H N N 205 LEU HB2 H N N 206 LEU HB3 H N N 207 LEU HG H N N 208 LEU HD11 H N N 209 LEU HD12 H N N 210 LEU HD13 H N N 211 LEU HD21 H N N 212 LEU HD22 H N N 213 LEU HD23 H N N 214 LEU HXT H N N 215 LYS N N N N 216 LYS CA C N S 217 LYS C C N N 218 LYS O O N N 219 LYS CB C N N 220 LYS CG C N N 221 LYS CD C N N 222 LYS CE C N N 223 LYS NZ N N N 224 LYS OXT O N N 225 LYS H H N N 226 LYS H2 H N N 227 LYS HA H N N 228 LYS HB2 H N N 229 LYS HB3 H N N 230 LYS HG2 H N N 231 LYS HG3 H N N 232 LYS HD2 H N N 233 LYS HD3 H N N 234 LYS HE2 H N N 235 LYS HE3 H N N 236 LYS HZ1 H N N 237 LYS HZ2 H N N 238 LYS HZ3 H N N 239 LYS HXT H N N 240 MET N N N N 241 MET CA C N S 242 MET C C N N 243 MET O O N N 244 MET CB C N N 245 MET CG C N N 246 MET SD S N N 247 MET CE C N N 248 MET OXT O N N 249 MET H H N N 250 MET H2 H N N 251 MET HA H N N 252 MET HB2 H N N 253 MET HB3 H N N 254 MET HG2 H N N 255 MET HG3 H N N 256 MET HE1 H N N 257 MET HE2 H N N 258 MET HE3 H N N 259 MET HXT H N N 260 MK7 C4 C N N 261 MK7 C5 C N N 262 MK7 C6 C N N 263 MK7 C7 C N N 264 MK7 C8 C N N 265 MK7 C10 C N S 266 MK7 C1 C N N 267 MK7 C2 C N N 268 MK7 C3 C N N 269 MK7 C9 C N N 270 MK7 C11 C N N 271 MK7 C12 C N R 272 MK7 N13 N N N 273 MK7 N14 N N N 274 MK7 N15 N N N 275 MK7 N16 N N N 276 MK7 O17 O N N 277 MK7 O18 O N N 278 MK7 O19 O N N 279 MK7 O20 O N N 280 MK7 O21 O N N 281 MK7 O22 O N N 282 MK7 S23 S N N 283 MK7 H1 H N N 284 MK7 H2 H N N 285 MK7 H3 H N N 286 MK7 H4 H N N 287 MK7 H5 H N N 288 MK7 H6 H N N 289 MK7 H7 H N N 290 MK7 H8 H N N 291 MK7 H9 H N N 292 MK7 H10 H N N 293 MK7 H11 H N N 294 MK7 H12 H N N 295 MK7 H13 H N N 296 MK7 H14 H N N 297 MK7 H15 H N N 298 MK7 H16 H N N 299 MK7 H17 H N N 300 MK7 H18 H N N 301 MK7 H19 H N N 302 MK7 H21 H N N 303 MK7 H22 H N N 304 MK7 H20 H N N 305 PEG C1 C N N 306 PEG O1 O N N 307 PEG C2 C N N 308 PEG O2 O N N 309 PEG C3 C N N 310 PEG C4 C N N 311 PEG O4 O N N 312 PEG H11 H N N 313 PEG H12 H N N 314 PEG HO1 H N N 315 PEG H21 H N N 316 PEG H22 H N N 317 PEG H31 H N N 318 PEG H32 H N N 319 PEG H41 H N N 320 PEG H42 H N N 321 PEG HO4 H N N 322 PG4 O1 O N N 323 PG4 C1 C N N 324 PG4 C2 C N N 325 PG4 O2 O N N 326 PG4 C3 C N N 327 PG4 C4 C N N 328 PG4 O3 O N N 329 PG4 C5 C N N 330 PG4 C6 C N N 331 PG4 O4 O N N 332 PG4 C7 C N N 333 PG4 C8 C N N 334 PG4 O5 O N N 335 PG4 HO1 H N N 336 PG4 H11 H N N 337 PG4 H12 H N N 338 PG4 H21 H N N 339 PG4 H22 H N N 340 PG4 H31 H N N 341 PG4 H32 H N N 342 PG4 H41 H N N 343 PG4 H42 H N N 344 PG4 H51 H N N 345 PG4 H52 H N N 346 PG4 H61 H N N 347 PG4 H62 H N N 348 PG4 H71 H N N 349 PG4 H72 H N N 350 PG4 H81 H N N 351 PG4 H82 H N N 352 PG4 HO5 H N N 353 PHE N N N N 354 PHE CA C N S 355 PHE C C N N 356 PHE O O N N 357 PHE CB C N N 358 PHE CG C Y N 359 PHE CD1 C Y N 360 PHE CD2 C Y N 361 PHE CE1 C Y N 362 PHE CE2 C Y N 363 PHE CZ C Y N 364 PHE OXT O N N 365 PHE H H N N 366 PHE H2 H N N 367 PHE HA H N N 368 PHE HB2 H N N 369 PHE HB3 H N N 370 PHE HD1 H N N 371 PHE HD2 H N N 372 PHE HE1 H N N 373 PHE HE2 H N N 374 PHE HZ H N N 375 PHE HXT H N N 376 PRO N N N N 377 PRO CA C N S 378 PRO C C N N 379 PRO O O N N 380 PRO CB C N N 381 PRO CG C N N 382 PRO CD C N N 383 PRO OXT O N N 384 PRO H H N N 385 PRO HA H N N 386 PRO HB2 H N N 387 PRO HB3 H N N 388 PRO HG2 H N N 389 PRO HG3 H N N 390 PRO HD2 H N N 391 PRO HD3 H N N 392 PRO HXT H N N 393 SER N N N N 394 SER CA C N S 395 SER C C N N 396 SER O O N N 397 SER CB C N N 398 SER OG O N N 399 SER OXT O N N 400 SER H H N N 401 SER H2 H N N 402 SER HA H N N 403 SER HB2 H N N 404 SER HB3 H N N 405 SER HG H N N 406 SER HXT H N N 407 THR N N N N 408 THR CA C N S 409 THR C C N N 410 THR O O N N 411 THR CB C N R 412 THR OG1 O N N 413 THR CG2 C N N 414 THR OXT O N N 415 THR H H N N 416 THR H2 H N N 417 THR HA H N N 418 THR HB H N N 419 THR HG1 H N N 420 THR HG21 H N N 421 THR HG22 H N N 422 THR HG23 H N N 423 THR HXT H N N 424 TRP N N N N 425 TRP CA C N S 426 TRP C C N N 427 TRP O O N N 428 TRP CB C N N 429 TRP CG C Y N 430 TRP CD1 C Y N 431 TRP CD2 C Y N 432 TRP NE1 N Y N 433 TRP CE2 C Y N 434 TRP CE3 C Y N 435 TRP CZ2 C Y N 436 TRP CZ3 C Y N 437 TRP CH2 C Y N 438 TRP OXT O N N 439 TRP H H N N 440 TRP H2 H N N 441 TRP HA H N N 442 TRP HB2 H N N 443 TRP HB3 H N N 444 TRP HD1 H N N 445 TRP HE1 H N N 446 TRP HE3 H N N 447 TRP HZ2 H N N 448 TRP HZ3 H N N 449 TRP HH2 H N N 450 TRP HXT H N N 451 TYR N N N N 452 TYR CA C N S 453 TYR C C N N 454 TYR O O N N 455 TYR CB C N N 456 TYR CG C Y N 457 TYR CD1 C Y N 458 TYR CD2 C Y N 459 TYR CE1 C Y N 460 TYR CE2 C Y N 461 TYR CZ C Y N 462 TYR OH O N N 463 TYR OXT O N N 464 TYR H H N N 465 TYR H2 H N N 466 TYR HA H N N 467 TYR HB2 H N N 468 TYR HB3 H N N 469 TYR HD1 H N N 470 TYR HD2 H N N 471 TYR HE1 H N N 472 TYR HE2 H N N 473 TYR HH H N N 474 TYR HXT H N N 475 VAL N N N N 476 VAL CA C N S 477 VAL C C N N 478 VAL O O N N 479 VAL CB C N N 480 VAL CG1 C N N 481 VAL CG2 C N N 482 VAL OXT O N N 483 VAL H H N N 484 VAL H2 H N N 485 VAL HA H N N 486 VAL HB H N N 487 VAL HG11 H N N 488 VAL HG12 H N N 489 VAL HG13 H N N 490 VAL HG21 H N N 491 VAL HG22 H N N 492 VAL HG23 H N N 493 VAL HXT H N N 494 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 MK7 O21 S23 doub N N 246 MK7 O18 C8 doub N N 247 MK7 C2 C5 sing N N 248 MK7 C2 C9 sing N N 249 MK7 N13 C5 sing N N 250 MK7 N13 C6 sing N N 251 MK7 C3 C9 sing N N 252 MK7 C3 C6 sing N N 253 MK7 N14 C9 sing N N 254 MK7 N14 C11 sing N N 255 MK7 O17 S23 doub N N 256 MK7 C10 C1 sing N N 257 MK7 C10 C11 sing N N 258 MK7 C10 N16 sing N N 259 MK7 S23 O20 sing N N 260 MK7 S23 O22 sing N N 261 MK7 C1 C4 sing N N 262 MK7 C8 N16 sing N N 263 MK7 C11 O19 doub N N 264 MK7 N16 C7 sing N N 265 MK7 O22 N15 sing N N 266 MK7 N15 C12 sing N N 267 MK7 C4 C12 sing N N 268 MK7 C12 C7 sing N N 269 MK7 C4 H1 sing N N 270 MK7 C4 H2 sing N N 271 MK7 C5 H3 sing N N 272 MK7 C5 H4 sing N N 273 MK7 C6 H5 sing N N 274 MK7 C6 H6 sing N N 275 MK7 C7 H7 sing N N 276 MK7 C7 H8 sing N N 277 MK7 C8 H9 sing N N 278 MK7 C10 H10 sing N N 279 MK7 C1 H11 sing N N 280 MK7 C1 H12 sing N N 281 MK7 C2 H13 sing N N 282 MK7 C2 H14 sing N N 283 MK7 C3 H15 sing N N 284 MK7 C3 H16 sing N N 285 MK7 C9 H17 sing N N 286 MK7 C12 H18 sing N N 287 MK7 N13 H19 sing N N 288 MK7 N14 H21 sing N N 289 MK7 N15 H22 sing N N 290 MK7 O20 H20 sing N N 291 PEG C1 O1 sing N N 292 PEG C1 C2 sing N N 293 PEG C1 H11 sing N N 294 PEG C1 H12 sing N N 295 PEG O1 HO1 sing N N 296 PEG C2 O2 sing N N 297 PEG C2 H21 sing N N 298 PEG C2 H22 sing N N 299 PEG O2 C3 sing N N 300 PEG C3 C4 sing N N 301 PEG C3 H31 sing N N 302 PEG C3 H32 sing N N 303 PEG C4 O4 sing N N 304 PEG C4 H41 sing N N 305 PEG C4 H42 sing N N 306 PEG O4 HO4 sing N N 307 PG4 O1 C1 sing N N 308 PG4 O1 HO1 sing N N 309 PG4 C1 C2 sing N N 310 PG4 C1 H11 sing N N 311 PG4 C1 H12 sing N N 312 PG4 C2 O2 sing N N 313 PG4 C2 H21 sing N N 314 PG4 C2 H22 sing N N 315 PG4 O2 C3 sing N N 316 PG4 C3 C4 sing N N 317 PG4 C3 H31 sing N N 318 PG4 C3 H32 sing N N 319 PG4 C4 O3 sing N N 320 PG4 C4 H41 sing N N 321 PG4 C4 H42 sing N N 322 PG4 O3 C5 sing N N 323 PG4 C5 C6 sing N N 324 PG4 C5 H51 sing N N 325 PG4 C5 H52 sing N N 326 PG4 C6 O4 sing N N 327 PG4 C6 H61 sing N N 328 PG4 C6 H62 sing N N 329 PG4 O4 C7 sing N N 330 PG4 C7 C8 sing N N 331 PG4 C7 H71 sing N N 332 PG4 C7 H72 sing N N 333 PG4 C8 O5 sing N N 334 PG4 C8 H81 sing N N 335 PG4 C8 H82 sing N N 336 PG4 O5 HO5 sing N N 337 PHE N CA sing N N 338 PHE N H sing N N 339 PHE N H2 sing N N 340 PHE CA C sing N N 341 PHE CA CB sing N N 342 PHE CA HA sing N N 343 PHE C O doub N N 344 PHE C OXT sing N N 345 PHE CB CG sing N N 346 PHE CB HB2 sing N N 347 PHE CB HB3 sing N N 348 PHE CG CD1 doub Y N 349 PHE CG CD2 sing Y N 350 PHE CD1 CE1 sing Y N 351 PHE CD1 HD1 sing N N 352 PHE CD2 CE2 doub Y N 353 PHE CD2 HD2 sing N N 354 PHE CE1 CZ doub Y N 355 PHE CE1 HE1 sing N N 356 PHE CE2 CZ sing Y N 357 PHE CE2 HE2 sing N N 358 PHE CZ HZ sing N N 359 PHE OXT HXT sing N N 360 PRO N CA sing N N 361 PRO N CD sing N N 362 PRO N H sing N N 363 PRO CA C sing N N 364 PRO CA CB sing N N 365 PRO CA HA sing N N 366 PRO C O doub N N 367 PRO C OXT sing N N 368 PRO CB CG sing N N 369 PRO CB HB2 sing N N 370 PRO CB HB3 sing N N 371 PRO CG CD sing N N 372 PRO CG HG2 sing N N 373 PRO CG HG3 sing N N 374 PRO CD HD2 sing N N 375 PRO CD HD3 sing N N 376 PRO OXT HXT sing N N 377 SER N CA sing N N 378 SER N H sing N N 379 SER N H2 sing N N 380 SER CA C sing N N 381 SER CA CB sing N N 382 SER CA HA sing N N 383 SER C O doub N N 384 SER C OXT sing N N 385 SER CB OG sing N N 386 SER CB HB2 sing N N 387 SER CB HB3 sing N N 388 SER OG HG sing N N 389 SER OXT HXT sing N N 390 THR N CA sing N N 391 THR N H sing N N 392 THR N H2 sing N N 393 THR CA C sing N N 394 THR CA CB sing N N 395 THR CA HA sing N N 396 THR C O doub N N 397 THR C OXT sing N N 398 THR CB OG1 sing N N 399 THR CB CG2 sing N N 400 THR CB HB sing N N 401 THR OG1 HG1 sing N N 402 THR CG2 HG21 sing N N 403 THR CG2 HG22 sing N N 404 THR CG2 HG23 sing N N 405 THR OXT HXT sing N N 406 TRP N CA sing N N 407 TRP N H sing N N 408 TRP N H2 sing N N 409 TRP CA C sing N N 410 TRP CA CB sing N N 411 TRP CA HA sing N N 412 TRP C O doub N N 413 TRP C OXT sing N N 414 TRP CB CG sing N N 415 TRP CB HB2 sing N N 416 TRP CB HB3 sing N N 417 TRP CG CD1 doub Y N 418 TRP CG CD2 sing Y N 419 TRP CD1 NE1 sing Y N 420 TRP CD1 HD1 sing N N 421 TRP CD2 CE2 doub Y N 422 TRP CD2 CE3 sing Y N 423 TRP NE1 CE2 sing Y N 424 TRP NE1 HE1 sing N N 425 TRP CE2 CZ2 sing Y N 426 TRP CE3 CZ3 doub Y N 427 TRP CE3 HE3 sing N N 428 TRP CZ2 CH2 doub Y N 429 TRP CZ2 HZ2 sing N N 430 TRP CZ3 CH2 sing Y N 431 TRP CZ3 HZ3 sing N N 432 TRP CH2 HH2 sing N N 433 TRP OXT HXT sing N N 434 TYR N CA sing N N 435 TYR N H sing N N 436 TYR N H2 sing N N 437 TYR CA C sing N N 438 TYR CA CB sing N N 439 TYR CA HA sing N N 440 TYR C O doub N N 441 TYR C OXT sing N N 442 TYR CB CG sing N N 443 TYR CB HB2 sing N N 444 TYR CB HB3 sing N N 445 TYR CG CD1 doub Y N 446 TYR CG CD2 sing Y N 447 TYR CD1 CE1 sing Y N 448 TYR CD1 HD1 sing N N 449 TYR CD2 CE2 doub Y N 450 TYR CD2 HD2 sing N N 451 TYR CE1 CZ doub Y N 452 TYR CE1 HE1 sing N N 453 TYR CE2 CZ sing Y N 454 TYR CE2 HE2 sing N N 455 TYR CZ OH sing N N 456 TYR OH HH sing N N 457 TYR OXT HXT sing N N 458 VAL N CA sing N N 459 VAL N H sing N N 460 VAL N H2 sing N N 461 VAL CA C sing N N 462 VAL CA CB sing N N 463 VAL CA HA sing N N 464 VAL C O doub N N 465 VAL C OXT sing N N 466 VAL CB CG1 sing N N 467 VAL CB CG2 sing N N 468 VAL CB HB sing N N 469 VAL CG1 HG11 sing N N 470 VAL CG1 HG12 sing N N 471 VAL CG1 HG13 sing N N 472 VAL CG2 HG21 sing N N 473 VAL CG2 HG22 sing N N 474 VAL CG2 HG23 sing N N 475 VAL OXT HXT sing N N 476 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Indian Council of Medical Research' India EM/Dev/IG/20/0773/2023 1 'Board of Research in Nuclear Sciences (BRNS)' India 54/14/03/2023-BRNS 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1dy6 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9ILE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.028693 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004990 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019826 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016744 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.3103 20.8439 1.0201 10.2075 1.5888 0.5687 0.8651 51.6512 0.2156 CL 17 17 11.4601 0.0104 7.1962 1.1662 6.2554 18.5194 1.6455 47.7784 -9.2115 N 7 7 12.2220 0.0057 3.1346 9.8933 2.0141 28.9975 1.1672 0.5826 -11.5379 O 8 8 3.0487 13.2771 2.2870 5.7011 1.5464 0.3239 0.8671 32.9089 0.2508 S 16 16 6.9054 1.4679 5.2035 22.2151 1.4379 0.2536 1.5863 56.1720 1.1843 # loop_ # loop_ #