data_9IUW # _entry.id 9IUW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9IUW pdb_00009iuw 10.2210/pdb9iuw/pdb WWPDB D_1300049669 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-07-30 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9IUW _pdbx_database_status.recvd_initial_deposition_date 2024-07-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email sankar@ccmb.res.in _pdbx_contact_author.name_first Rajan _pdbx_contact_author.name_last Sankaranarayanan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4524-9953 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pawar, K.I.' 1 0000-0002-1968-9851 'Gogoi, J.' 2 0000-0001-6791-6580 'Sankaranarayanan, R.' 3 0000-0003-4524-9953 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of AlaX-M trans-editing enzyme from Pyrococcus furiosus' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pawar, K.I.' 1 0000-0002-1968-9851 primary 'Gogoi, J.' 2 0000-0001-6791-6580 primary 'Sankaranarayanan, R.' 3 0000-0003-4524-9953 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Partial alanyl-tRNA synthetase matches COOH terminus' 25095.623 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 water nat water 18.015 103 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name AlaX-M # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTRLLYYEDAYLKEAKAKVLEVKDNALLLDQTIFYPTGGGQPHDRGWINGVEVLDVYKDEEGNVWHVVKELEKFKPGDEV ELKLDWEYRYKLMRIHSALHLLENVLDQILGKGNWEVVGSGMTHEKGRLDVGYPENLNAYKEKIIELFNRYVDEGGEIKI WWEGEKRYTQIRDFDPIPCGGTHVKDIREIGHIKKLKRSSIGRGKQRLEIWLED ; _entity_poly.pdbx_seq_one_letter_code_can ;MTRLLYYEDAYLKEAKAKVLEVKDNALLLDQTIFYPTGGGQPHDRGWINGVEVLDVYKDEEGNVWHVVKELEKFKPGDEV ELKLDWEYRYKLMRIHSALHLLENVLDQILGKGNWEVVGSGMTHEKGRLDVGYPENLNAYKEKIIELFNRYVDEGGEIKI WWEGEKRYTQIRDFDPIPCGGTHVKDIREIGHIKKLKRSSIGRGKQRLEIWLED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ARG n 1 4 LEU n 1 5 LEU n 1 6 TYR n 1 7 TYR n 1 8 GLU n 1 9 ASP n 1 10 ALA n 1 11 TYR n 1 12 LEU n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 LYS n 1 17 ALA n 1 18 LYS n 1 19 VAL n 1 20 LEU n 1 21 GLU n 1 22 VAL n 1 23 LYS n 1 24 ASP n 1 25 ASN n 1 26 ALA n 1 27 LEU n 1 28 LEU n 1 29 LEU n 1 30 ASP n 1 31 GLN n 1 32 THR n 1 33 ILE n 1 34 PHE n 1 35 TYR n 1 36 PRO n 1 37 THR n 1 38 GLY n 1 39 GLY n 1 40 GLY n 1 41 GLN n 1 42 PRO n 1 43 HIS n 1 44 ASP n 1 45 ARG n 1 46 GLY n 1 47 TRP n 1 48 ILE n 1 49 ASN n 1 50 GLY n 1 51 VAL n 1 52 GLU n 1 53 VAL n 1 54 LEU n 1 55 ASP n 1 56 VAL n 1 57 TYR n 1 58 LYS n 1 59 ASP n 1 60 GLU n 1 61 GLU n 1 62 GLY n 1 63 ASN n 1 64 VAL n 1 65 TRP n 1 66 HIS n 1 67 VAL n 1 68 VAL n 1 69 LYS n 1 70 GLU n 1 71 LEU n 1 72 GLU n 1 73 LYS n 1 74 PHE n 1 75 LYS n 1 76 PRO n 1 77 GLY n 1 78 ASP n 1 79 GLU n 1 80 VAL n 1 81 GLU n 1 82 LEU n 1 83 LYS n 1 84 LEU n 1 85 ASP n 1 86 TRP n 1 87 GLU n 1 88 TYR n 1 89 ARG n 1 90 TYR n 1 91 LYS n 1 92 LEU n 1 93 MET n 1 94 ARG n 1 95 ILE n 1 96 HIS n 1 97 SER n 1 98 ALA n 1 99 LEU n 1 100 HIS n 1 101 LEU n 1 102 LEU n 1 103 GLU n 1 104 ASN n 1 105 VAL n 1 106 LEU n 1 107 ASP n 1 108 GLN n 1 109 ILE n 1 110 LEU n 1 111 GLY n 1 112 LYS n 1 113 GLY n 1 114 ASN n 1 115 TRP n 1 116 GLU n 1 117 VAL n 1 118 VAL n 1 119 GLY n 1 120 SER n 1 121 GLY n 1 122 MET n 1 123 THR n 1 124 HIS n 1 125 GLU n 1 126 LYS n 1 127 GLY n 1 128 ARG n 1 129 LEU n 1 130 ASP n 1 131 VAL n 1 132 GLY n 1 133 TYR n 1 134 PRO n 1 135 GLU n 1 136 ASN n 1 137 LEU n 1 138 ASN n 1 139 ALA n 1 140 TYR n 1 141 LYS n 1 142 GLU n 1 143 LYS n 1 144 ILE n 1 145 ILE n 1 146 GLU n 1 147 LEU n 1 148 PHE n 1 149 ASN n 1 150 ARG n 1 151 TYR n 1 152 VAL n 1 153 ASP n 1 154 GLU n 1 155 GLY n 1 156 GLY n 1 157 GLU n 1 158 ILE n 1 159 LYS n 1 160 ILE n 1 161 TRP n 1 162 TRP n 1 163 GLU n 1 164 GLY n 1 165 GLU n 1 166 LYS n 1 167 ARG n 1 168 TYR n 1 169 THR n 1 170 GLN n 1 171 ILE n 1 172 ARG n 1 173 ASP n 1 174 PHE n 1 175 ASP n 1 176 PRO n 1 177 ILE n 1 178 PRO n 1 179 CYS n 1 180 GLY n 1 181 GLY n 1 182 THR n 1 183 HIS n 1 184 VAL n 1 185 LYS n 1 186 ASP n 1 187 ILE n 1 188 ARG n 1 189 GLU n 1 190 ILE n 1 191 GLY n 1 192 HIS n 1 193 ILE n 1 194 LYS n 1 195 LYS n 1 196 LEU n 1 197 LYS n 1 198 ARG n 1 199 SER n 1 200 SER n 1 201 ILE n 1 202 GLY n 1 203 ARG n 1 204 GLY n 1 205 LYS n 1 206 GLN n 1 207 ARG n 1 208 LEU n 1 209 GLU n 1 210 ILE n 1 211 TRP n 1 212 LEU n 1 213 GLU n 1 214 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 214 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PF0086 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 43587 / DSM 3638 / JCM 8422 / Vc1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 186497 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 TRP 65 65 65 TRP TRP A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 MET 122 122 122 MET MET A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 TYR 151 151 151 TYR TYR A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 TRP 161 161 161 TRP TRP A . n A 1 162 TRP 162 162 162 TRP TRP A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 GLU 165 165 165 GLU GLU A . n A 1 166 LYS 166 166 166 LYS LYS A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 TYR 168 168 168 TYR TYR A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 CYS 179 179 179 CYS CYS A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 THR 182 182 182 THR THR A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 GLU 189 189 189 GLU GLU A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 HIS 192 192 192 HIS HIS A . n A 1 193 ILE 193 193 193 ILE ILE A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 ARG 198 198 198 ARG ARG A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 SER 200 200 200 SER SER A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 LYS 205 205 205 LYS LYS A . n A 1 206 GLN 206 206 206 GLN GLN A . n A 1 207 ARG 207 207 207 ARG ARG A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 GLU 209 209 209 GLU GLU A . n A 1 210 ILE 210 210 210 ILE ILE A . n A 1 211 TRP 211 211 211 TRP TRP A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 ASP 214 214 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 1 ZN ZN A . C 2 ZN 1 302 2 ZN ZN A . D 3 HOH 1 401 3 HOH HOH A . D 3 HOH 2 402 106 HOH HOH A . D 3 HOH 3 403 38 HOH HOH A . D 3 HOH 4 404 104 HOH HOH A . D 3 HOH 5 405 28 HOH HOH A . D 3 HOH 6 406 209 HOH HOH A . D 3 HOH 7 407 17 HOH HOH A . D 3 HOH 8 408 29 HOH HOH A . D 3 HOH 9 409 213 HOH HOH A . D 3 HOH 10 410 56 HOH HOH A . D 3 HOH 11 411 53 HOH HOH A . D 3 HOH 12 412 179 HOH HOH A . D 3 HOH 13 413 66 HOH HOH A . D 3 HOH 14 414 199 HOH HOH A . D 3 HOH 15 415 30 HOH HOH A . D 3 HOH 16 416 151 HOH HOH A . D 3 HOH 17 417 21 HOH HOH A . D 3 HOH 18 418 14 HOH HOH A . D 3 HOH 19 419 150 HOH HOH A . D 3 HOH 20 420 55 HOH HOH A . D 3 HOH 21 421 5 HOH HOH A . D 3 HOH 22 422 27 HOH HOH A . D 3 HOH 23 423 210 HOH HOH A . D 3 HOH 24 424 62 HOH HOH A . D 3 HOH 25 425 82 HOH HOH A . D 3 HOH 26 426 23 HOH HOH A . D 3 HOH 27 427 7 HOH HOH A . D 3 HOH 28 428 67 HOH HOH A . D 3 HOH 29 429 60 HOH HOH A . D 3 HOH 30 430 32 HOH HOH A . D 3 HOH 31 431 4 HOH HOH A . D 3 HOH 32 432 33 HOH HOH A . D 3 HOH 33 433 37 HOH HOH A . D 3 HOH 34 434 11 HOH HOH A . D 3 HOH 35 435 48 HOH HOH A . D 3 HOH 36 436 16 HOH HOH A . D 3 HOH 37 437 49 HOH HOH A . D 3 HOH 38 438 111 HOH HOH A . D 3 HOH 39 439 88 HOH HOH A . D 3 HOH 40 440 40 HOH HOH A . D 3 HOH 41 441 15 HOH HOH A . D 3 HOH 42 442 42 HOH HOH A . D 3 HOH 43 443 72 HOH HOH A . D 3 HOH 44 444 25 HOH HOH A . D 3 HOH 45 445 69 HOH HOH A . D 3 HOH 46 446 47 HOH HOH A . D 3 HOH 47 447 22 HOH HOH A . D 3 HOH 48 448 191 HOH HOH A . D 3 HOH 49 449 9 HOH HOH A . D 3 HOH 50 450 206 HOH HOH A . D 3 HOH 51 451 63 HOH HOH A . D 3 HOH 52 452 12 HOH HOH A . D 3 HOH 53 453 186 HOH HOH A . D 3 HOH 54 454 120 HOH HOH A . D 3 HOH 55 455 39 HOH HOH A . D 3 HOH 56 456 74 HOH HOH A . D 3 HOH 57 457 59 HOH HOH A . D 3 HOH 58 458 20 HOH HOH A . D 3 HOH 59 459 54 HOH HOH A . D 3 HOH 60 460 46 HOH HOH A . D 3 HOH 61 461 65 HOH HOH A . D 3 HOH 62 462 52 HOH HOH A . D 3 HOH 63 463 61 HOH HOH A . D 3 HOH 64 464 36 HOH HOH A . D 3 HOH 65 465 211 HOH HOH A . D 3 HOH 66 466 50 HOH HOH A . D 3 HOH 67 467 94 HOH HOH A . D 3 HOH 68 468 31 HOH HOH A . D 3 HOH 69 469 114 HOH HOH A . D 3 HOH 70 470 41 HOH HOH A . D 3 HOH 71 471 57 HOH HOH A . D 3 HOH 72 472 6 HOH HOH A . D 3 HOH 73 473 87 HOH HOH A . D 3 HOH 74 474 204 HOH HOH A . D 3 HOH 75 475 64 HOH HOH A . D 3 HOH 76 476 26 HOH HOH A . D 3 HOH 77 477 35 HOH HOH A . D 3 HOH 78 478 45 HOH HOH A . D 3 HOH 79 479 215 HOH HOH A . D 3 HOH 80 480 109 HOH HOH A . D 3 HOH 81 481 8 HOH HOH A . D 3 HOH 82 482 76 HOH HOH A . D 3 HOH 83 483 24 HOH HOH A . D 3 HOH 84 484 13 HOH HOH A . D 3 HOH 85 485 84 HOH HOH A . D 3 HOH 86 486 208 HOH HOH A . D 3 HOH 87 487 83 HOH HOH A . D 3 HOH 88 488 10 HOH HOH A . D 3 HOH 89 489 214 HOH HOH A . D 3 HOH 90 490 207 HOH HOH A . D 3 HOH 91 491 91 HOH HOH A . D 3 HOH 92 492 2 HOH HOH A . D 3 HOH 93 493 201 HOH HOH A . D 3 HOH 94 494 183 HOH HOH A . D 3 HOH 95 495 178 HOH HOH A . D 3 HOH 96 496 110 HOH HOH A . D 3 HOH 97 497 189 HOH HOH A . D 3 HOH 98 498 202 HOH HOH A . D 3 HOH 99 499 181 HOH HOH A . D 3 HOH 100 500 200 HOH HOH A . D 3 HOH 101 501 187 HOH HOH A . D 3 HOH 102 502 198 HOH HOH A . D 3 HOH 103 503 182 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 13 ? CE ? A LYS 13 CE 2 1 Y 1 A LYS 13 ? NZ ? A LYS 13 NZ 3 1 Y 1 A LYS 16 ? CG ? A LYS 16 CG 4 1 Y 1 A LYS 16 ? CD ? A LYS 16 CD 5 1 Y 1 A LYS 16 ? CE ? A LYS 16 CE 6 1 Y 1 A LYS 16 ? NZ ? A LYS 16 NZ 7 1 Y 1 A LYS 18 ? CG ? A LYS 18 CG 8 1 Y 1 A LYS 18 ? CD ? A LYS 18 CD 9 1 Y 1 A LYS 18 ? CE ? A LYS 18 CE 10 1 Y 1 A LYS 18 ? NZ ? A LYS 18 NZ 11 1 Y 1 A LYS 23 ? CG ? A LYS 23 CG 12 1 Y 1 A LYS 23 ? CD ? A LYS 23 CD 13 1 Y 1 A LYS 23 ? CE ? A LYS 23 CE 14 1 Y 1 A LYS 23 ? NZ ? A LYS 23 NZ 15 1 Y 1 A ASP 24 ? CG ? A ASP 24 CG 16 1 Y 1 A ASP 24 ? OD1 ? A ASP 24 OD1 17 1 Y 1 A ASP 24 ? OD2 ? A ASP 24 OD2 18 1 Y 1 A GLU 60 ? CG ? A GLU 60 CG 19 1 Y 1 A GLU 60 ? CD ? A GLU 60 CD 20 1 Y 1 A GLU 60 ? OE1 ? A GLU 60 OE1 21 1 Y 1 A GLU 60 ? OE2 ? A GLU 60 OE2 22 1 Y 1 A GLU 61 ? CG ? A GLU 61 CG 23 1 Y 1 A GLU 61 ? CD ? A GLU 61 CD 24 1 Y 1 A GLU 61 ? OE1 ? A GLU 61 OE1 25 1 Y 1 A GLU 61 ? OE2 ? A GLU 61 OE2 26 1 Y 1 A GLU 72 ? CG ? A GLU 72 CG 27 1 Y 1 A GLU 72 ? CD ? A GLU 72 CD 28 1 Y 1 A GLU 72 ? OE1 ? A GLU 72 OE1 29 1 Y 1 A GLU 72 ? OE2 ? A GLU 72 OE2 30 1 Y 1 A LYS 73 ? CG ? A LYS 73 CG 31 1 Y 1 A LYS 73 ? CD ? A LYS 73 CD 32 1 Y 1 A LYS 73 ? CE ? A LYS 73 CE 33 1 Y 1 A LYS 73 ? NZ ? A LYS 73 NZ 34 1 Y 1 A LYS 75 ? CG ? A LYS 75 CG 35 1 Y 1 A LYS 75 ? CD ? A LYS 75 CD 36 1 Y 1 A LYS 75 ? CE ? A LYS 75 CE 37 1 Y 1 A LYS 75 ? NZ ? A LYS 75 NZ 38 1 Y 1 A GLU 79 ? CG ? A GLU 79 CG 39 1 Y 1 A GLU 79 ? CD ? A GLU 79 CD 40 1 Y 1 A GLU 79 ? OE1 ? A GLU 79 OE1 41 1 Y 1 A GLU 79 ? OE2 ? A GLU 79 OE2 42 1 Y 1 A GLU 81 ? CG ? A GLU 81 CG 43 1 Y 1 A GLU 81 ? CD ? A GLU 81 CD 44 1 Y 1 A GLU 81 ? OE1 ? A GLU 81 OE1 45 1 Y 1 A GLU 81 ? OE2 ? A GLU 81 OE2 46 1 Y 1 A GLU 87 ? CG ? A GLU 87 CG 47 1 Y 1 A GLU 87 ? CD ? A GLU 87 CD 48 1 Y 1 A GLU 87 ? OE1 ? A GLU 87 OE1 49 1 Y 1 A GLU 87 ? OE2 ? A GLU 87 OE2 50 1 Y 1 A LYS 91 ? CE ? A LYS 91 CE 51 1 Y 1 A LYS 91 ? NZ ? A LYS 91 NZ 52 1 Y 1 A GLN 108 ? CG ? A GLN 108 CG 53 1 Y 1 A GLN 108 ? CD ? A GLN 108 CD 54 1 Y 1 A GLN 108 ? OE1 ? A GLN 108 OE1 55 1 Y 1 A GLN 108 ? NE2 ? A GLN 108 NE2 56 1 Y 1 A LYS 112 ? CG ? A LYS 112 CG 57 1 Y 1 A LYS 112 ? CD ? A LYS 112 CD 58 1 Y 1 A LYS 112 ? CE ? A LYS 112 CE 59 1 Y 1 A LYS 112 ? NZ ? A LYS 112 NZ 60 1 Y 1 A GLU 116 ? CD ? A GLU 116 CD 61 1 Y 1 A GLU 116 ? OE1 ? A GLU 116 OE1 62 1 Y 1 A GLU 116 ? OE2 ? A GLU 116 OE2 63 1 Y 1 A GLU 142 ? CG ? A GLU 142 CG 64 1 Y 1 A GLU 142 ? CD ? A GLU 142 CD 65 1 Y 1 A GLU 142 ? OE1 ? A GLU 142 OE1 66 1 Y 1 A GLU 142 ? OE2 ? A GLU 142 OE2 67 1 Y 1 A LYS 143 ? CG ? A LYS 143 CG 68 1 Y 1 A LYS 143 ? CD ? A LYS 143 CD 69 1 Y 1 A LYS 143 ? CE ? A LYS 143 CE 70 1 Y 1 A LYS 143 ? NZ ? A LYS 143 NZ 71 1 Y 1 A GLU 157 ? CG ? A GLU 157 CG 72 1 Y 1 A GLU 157 ? CD ? A GLU 157 CD 73 1 Y 1 A GLU 157 ? OE1 ? A GLU 157 OE1 74 1 Y 1 A GLU 157 ? OE2 ? A GLU 157 OE2 75 1 Y 1 A LYS 159 ? CG ? A LYS 159 CG 76 1 Y 1 A LYS 159 ? CD ? A LYS 159 CD 77 1 Y 1 A LYS 159 ? CE ? A LYS 159 CE 78 1 Y 1 A LYS 159 ? NZ ? A LYS 159 NZ 79 1 Y 1 A GLU 165 ? CG ? A GLU 165 CG 80 1 Y 1 A GLU 165 ? CD ? A GLU 165 CD 81 1 Y 1 A GLU 165 ? OE1 ? A GLU 165 OE1 82 1 Y 1 A GLU 165 ? OE2 ? A GLU 165 OE2 83 1 Y 1 A LYS 166 ? CG ? A LYS 166 CG 84 1 Y 1 A LYS 166 ? CD ? A LYS 166 CD 85 1 Y 1 A LYS 166 ? CE ? A LYS 166 CE 86 1 Y 1 A LYS 166 ? NZ ? A LYS 166 NZ 87 1 Y 1 A ASP 175 ? CG ? A ASP 175 CG 88 1 Y 1 A ASP 175 ? OD1 ? A ASP 175 OD1 89 1 Y 1 A ASP 175 ? OD2 ? A ASP 175 OD2 90 1 Y 1 A LYS 185 ? CG ? A LYS 185 CG 91 1 Y 1 A LYS 185 ? CD ? A LYS 185 CD 92 1 Y 1 A LYS 185 ? CE ? A LYS 185 CE 93 1 Y 1 A LYS 185 ? NZ ? A LYS 185 NZ 94 1 Y 1 A ARG 188 ? CG ? A ARG 188 CG 95 1 Y 1 A ARG 188 ? CD ? A ARG 188 CD 96 1 Y 1 A ARG 188 ? NE ? A ARG 188 NE 97 1 Y 1 A ARG 188 ? CZ ? A ARG 188 CZ 98 1 Y 1 A ARG 188 ? NH1 ? A ARG 188 NH1 99 1 Y 1 A ARG 188 ? NH2 ? A ARG 188 NH2 100 1 Y 1 A LYS 205 ? CE ? A LYS 205 CE 101 1 Y 1 A LYS 205 ? NZ ? A LYS 205 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 103.56 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9IUW _cell.details ? _cell.formula_units_Z ? _cell.length_a 113.230 _cell.length_a_esd ? _cell.length_b 37.080 _cell.length_b_esd ? _cell.length_c 59.070 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9IUW _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9IUW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.79 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Sodium acetate trihydrate, 0.1 M Sodium cacodylate trihydrate pH 6.5, 30% w/v Polyethylene glycol 8,000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 277.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'VariMax HF optic' _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-01-27 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-E+ SUPERBRIGHT' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 16.06 _reflns.entry_id 9IUW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.78 _reflns.d_resolution_low 35.77 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23027 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.26 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.78 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.06 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star 0.99 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.048 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.78 _reflns_shell.d_res_low 1.84 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.88 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 5127 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.2 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.23 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.93 _reflns_shell.pdbx_CC_star 0.98 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.04 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.18 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 16.87 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9IUW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.78 _refine.ls_d_res_low 35.77 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23026 _refine.ls_number_reflns_R_free 3333 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 86.05 _refine.ls_percent_reflns_R_free 8.58 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1913 _refine.ls_R_factor_R_free 0.2166 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1889 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.01 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.18 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1655 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 103 _refine_hist.number_atoms_total 1760 _refine_hist.d_res_high 1.78 _refine_hist.d_res_low 35.77 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1694 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.868 ? 2303 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 6.072 ? 232 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.056 ? 249 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 ? 295 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.78 1.80 . . 133 1327 78.00 . . . . 0.2078 . . . . . . . . . . . 0.2508 'X-RAY DIFFRACTION' 1.80 1.83 . . 136 1408 83.00 . . . . 0.1875 . . . . . . . . . . . 0.2149 'X-RAY DIFFRACTION' 1.83 1.86 . . 136 1456 83.00 . . . . 0.2006 . . . . . . . . . . . 0.2677 'X-RAY DIFFRACTION' 1.86 1.89 . . 136 1430 85.00 . . . . 0.2022 . . . . . . . . . . . 0.2496 'X-RAY DIFFRACTION' 1.89 1.92 . . 130 1393 83.00 . . . . 0.2059 . . . . . . . . . . . 0.2501 'X-RAY DIFFRACTION' 1.92 1.95 . . 134 1484 84.00 . . . . 0.2011 . . . . . . . . . . . 0.2152 'X-RAY DIFFRACTION' 1.95 1.99 . . 136 1461 85.00 . . . . 0.1939 . . . . . . . . . . . 0.2563 'X-RAY DIFFRACTION' 1.99 2.03 . . 136 1429 84.00 . . . . 0.1878 . . . . . . . . . . . 0.2844 'X-RAY DIFFRACTION' 2.03 2.08 . . 137 1457 85.00 . . . . 0.1892 . . . . . . . . . . . 0.2313 'X-RAY DIFFRACTION' 2.08 2.12 . . 144 1465 85.00 . . . . 0.1870 . . . . . . . . . . . 0.2419 'X-RAY DIFFRACTION' 2.12 2.18 . . 139 1491 85.00 . . . . 0.1914 . . . . . . . . . . . 0.2128 'X-RAY DIFFRACTION' 2.18 2.24 . . 134 1445 87.00 . . . . 0.1889 . . . . . . . . . . . 0.2169 'X-RAY DIFFRACTION' 2.24 2.30 . . 135 1501 86.00 . . . . 0.1840 . . . . . . . . . . . 0.2180 'X-RAY DIFFRACTION' 2.30 2.38 . . 144 1509 87.00 . . . . 0.1926 . . . . . . . . . . . 0.2274 'X-RAY DIFFRACTION' 2.38 2.46 . . 138 1509 87.00 . . . . 0.1941 . . . . . . . . . . . 0.2179 'X-RAY DIFFRACTION' 2.46 2.56 . . 139 1479 88.00 . . . . 0.2019 . . . . . . . . . . . 0.2460 'X-RAY DIFFRACTION' 2.56 2.68 . . 140 1524 87.00 . . . . 0.2057 . . . . . . . . . . . 0.2160 'X-RAY DIFFRACTION' 2.68 2.82 . . 146 1497 88.00 . . . . 0.2098 . . . . . . . . . . . 0.2658 'X-RAY DIFFRACTION' 2.82 2.99 . . 145 1511 88.00 . . . . 0.2130 . . . . . . . . . . . 0.2252 'X-RAY DIFFRACTION' 2.99 3.22 . . 141 1537 89.00 . . . . 0.2135 . . . . . . . . . . . 0.2387 'X-RAY DIFFRACTION' 3.22 3.55 . . 139 1540 89.00 . . . . 0.1911 . . . . . . . . . . . 0.2143 'X-RAY DIFFRACTION' 3.55 4.06 . . 146 1538 89.00 . . . . 0.1635 . . . . . . . . . . . 0.1668 'X-RAY DIFFRACTION' 4.06 5.11 . . 138 1542 90.00 . . . . 0.1485 . . . . . . . . . . . 0.1747 'X-RAY DIFFRACTION' 5.12 35.77 . . 151 1573 91.00 . . . . 0.1787 . . . . . . . . . . . 0.1783 # _struct.entry_id 9IUW _struct.title 'Structure of AlaX-M trans-editing enzyme from Pyrococcus furiosus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9IUW _struct_keywords.text 'Esterase, aminoacyl-tRNA hydrolase, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8U4J9_PYRFU _struct_ref.pdbx_db_accession Q8U4J9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTRLLYYEDAYLKEAKAKVLEVKDNALLLDQTIFYPTGGGQPHDRGWINGVEVLDVYKDEEGNVWHVVKELEKFKPGDEV ELKLDWEYRYKLMRIHSALHLLENVLDQILGKGNWEVVGSGMTHEKGRLDVGYPENLNAYKEKIIELFNRYVDEGGEIKI WWEGEKRYTQIRDFDPIPCGGTHVKDIREIGHIKKLKRSSIGRGKQRLEIWLED ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9IUW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 214 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8U4J9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 214 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 214 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 100 ? 1 MORE -35 ? 1 'SSA (A^2)' 9700 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 5 ? ASP A 9 ? LEU A 5 ASP A 9 1 ? 5 HELX_P HELX_P2 AA2 ASP A 85 ? GLY A 111 ? ASP A 85 GLY A 111 1 ? 27 HELX_P HELX_P3 AA3 ASN A 136 ? ALA A 139 ? ASN A 136 ALA A 139 5 ? 4 HELX_P HELX_P4 AA4 TYR A 140 ? GLY A 155 ? TYR A 140 GLY A 155 1 ? 16 HELX_P HELX_P5 AA5 ASP A 186 ? ILE A 190 ? ASP A 186 ILE A 190 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 52 OE2 ? ? ? 1_555 C ZN . ZN ? ? A GLU 52 A ZN 302 4_554 ? ? ? ? ? ? ? 1.960 ? ? metalc2 metalc ? ? A HIS 96 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 96 A ZN 301 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc3 metalc ? ? A HIS 100 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 100 A ZN 301 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc4 metalc ? ? A CYS 179 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 179 A ZN 301 1_555 ? ? ? ? ? ? ? 2.340 ? ? metalc5 metalc ? ? A HIS 192 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 192 A ZN 302 1_555 ? ? ? ? ? ? ? 2.226 ? ? metalc6 metalc ? ? A GLU 213 OE1 ? ? ? 1_555 C ZN . ZN ? ? A GLU 213 A ZN 302 1_555 ? ? ? ? ? ? ? 2.068 ? ? metalc7 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 301 A HOH 450 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc8 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 301 A HOH 493 1_555 ? ? ? ? ? ? ? 2.189 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 52 ? A GLU 52 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 4_554 ND1 ? A HIS 192 ? A HIS 192 ? 1_555 91.3 ? 2 OE2 ? A GLU 52 ? A GLU 52 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 4_554 OE1 ? A GLU 213 ? A GLU 213 ? 1_555 94.1 ? 3 ND1 ? A HIS 192 ? A HIS 192 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 4_554 OE1 ? A GLU 213 ? A GLU 213 ? 1_555 4.0 ? 4 NE2 ? A HIS 96 ? A HIS 96 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 100 ? A HIS 100 ? 1_555 107.2 ? 5 NE2 ? A HIS 96 ? A HIS 96 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 179 ? A CYS 179 ? 1_555 104.9 ? 6 NE2 ? A HIS 100 ? A HIS 100 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 179 ? A CYS 179 ? 1_555 93.9 ? 7 NE2 ? A HIS 96 ? A HIS 96 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 450 ? 1_555 84.4 ? 8 NE2 ? A HIS 100 ? A HIS 100 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 450 ? 1_555 165.6 ? 9 SG ? A CYS 179 ? A CYS 179 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 450 ? 1_555 74.6 ? 10 NE2 ? A HIS 96 ? A HIS 96 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 493 ? 1_555 93.4 ? 11 NE2 ? A HIS 100 ? A HIS 100 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 493 ? 1_555 95.7 ? 12 SG ? A CYS 179 ? A CYS 179 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 493 ? 1_555 155.8 ? 13 O ? D HOH . ? A HOH 450 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O ? D HOH . ? A HOH 493 ? 1_555 91.9 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 7 ? AA3 ? 4 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 3 ? LEU A 4 ? ARG A 3 LEU A 4 AA1 2 GLN A 31 ? THR A 32 ? GLN A 31 THR A 32 AA2 1 GLU A 14 ? VAL A 22 ? GLU A 14 VAL A 22 AA2 2 ALA A 26 ? LEU A 29 ? ALA A 26 LEU A 29 AA2 3 VAL A 64 ? VAL A 68 ? VAL A 64 VAL A 68 AA2 4 VAL A 51 ? LYS A 58 ? VAL A 51 LYS A 58 AA2 5 GLY A 46 ? ILE A 48 ? GLY A 46 ILE A 48 AA2 6 GLU A 79 ? LEU A 84 ? GLU A 79 LEU A 84 AA2 7 GLU A 14 ? VAL A 22 ? GLU A 14 VAL A 22 AA3 1 GLU A 116 ? MET A 122 ? GLU A 116 MET A 122 AA3 2 GLY A 127 ? GLY A 132 ? GLY A 127 GLY A 132 AA3 3 LYS A 205 ? LEU A 212 ? LYS A 205 LEU A 212 AA3 4 ILE A 193 ? GLY A 202 ? ILE A 193 GLY A 202 AA4 1 ILE A 158 ? GLU A 163 ? ILE A 158 GLU A 163 AA4 2 LYS A 166 ? ILE A 171 ? LYS A 166 ILE A 171 AA4 3 ILE A 177 ? PRO A 178 ? ILE A 177 PRO A 178 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 3 ? N ARG A 3 O THR A 32 ? O THR A 32 AA2 1 2 N LEU A 20 ? N LEU A 20 O LEU A 28 ? O LEU A 28 AA2 2 3 N LEU A 27 ? N LEU A 27 O HIS A 66 ? O HIS A 66 AA2 3 4 O VAL A 67 ? O VAL A 67 N LEU A 54 ? N LEU A 54 AA2 4 5 O VAL A 53 ? O VAL A 53 N GLY A 46 ? N GLY A 46 AA2 5 6 N TRP A 47 ? N TRP A 47 O LYS A 83 ? O LYS A 83 AA2 6 7 O LEU A 82 ? O LEU A 82 N ALA A 15 ? N ALA A 15 AA3 1 2 N VAL A 118 ? N VAL A 118 O ASP A 130 ? O ASP A 130 AA3 2 3 N VAL A 131 ? N VAL A 131 O GLN A 206 ? O GLN A 206 AA3 3 4 O ARG A 207 ? O ARG A 207 N SER A 199 ? N SER A 199 AA4 1 2 N TRP A 161 ? N TRP A 161 O TYR A 168 ? O TYR A 168 AA4 2 3 N THR A 169 ? N THR A 169 O ILE A 177 ? O ILE A 177 # _pdbx_entry_details.entry_id 9IUW _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 25 ? ? 57.05 14.68 2 1 LYS A 73 ? ? -98.91 30.01 3 1 ASP A 85 ? ? -69.33 95.25 4 1 ARG A 172 ? ? 51.55 -123.63 5 1 CYS A 179 ? ? 177.50 156.93 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 487 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASP 214 ? A ASP 214 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZN ZN ZN N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'Council of Scientific & Industrial Research (CSIR)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number MLP-0162 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2e1b _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9IUW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.008832 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002130 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026969 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017414 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ #