data_9IVU # _entry.id 9IVU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9IVU pdb_00009ivu 10.2210/pdb9ivu/pdb WWPDB D_1300049763 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-07-02 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9IVU _pdbx_database_status.recvd_initial_deposition_date 2024-07-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 jianglg@fzu.edu.cn Longguang Jiang ? 'principal investigator/group leader' 0000-0002-4734-3778 3 hmd_lab@fzu.edu.cn Mingdong Huang ? 'principal investigator/group leader' 0000-0003-0085-9141 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, R.' 1 ? 'Huang, M.D.' 2 ? 'Jiang, L.G.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first eads1796 _citation.page_last eads1796 _citation.title 'Development of a recombinant Ang1 variant with enhanced Tie2 binding and its application to attenuate sepsis in mice.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.ads1796 _citation.pdbx_database_id_PubMed 39813336 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, R.' 1 0009-0007-0711-6080 primary 'Li, H.' 2 0009-0008-1050-0099 primary 'Xie, Z.' 3 ? primary 'Huang, M.' 4 0000-0002-2536-9600 primary 'Xu, P.' 5 0000-0003-3968-7279 primary 'Yuan, C.' 6 0000-0001-6122-0259 primary 'Li, J.' 7 0000-0002-8220-049X primary 'Flaumenhaft, R.' 8 0000-0001-8004-9688 primary 'Huang, M.' 9 0000-0003-0085-9141 primary 'Jiang, L.' 10 0000-0002-4734-3778 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Angiopoietin-1 26232.320 1 ? A451D ? ? 2 water nat water 18.015 68 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ANG-1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DYKDDDDKGGGGSFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFG NPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKD ADNDNCMCKCALMLTGGWWFDDCGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF ; _entity_poly.pdbx_seq_one_letter_code_can ;DYKDDDDKGGGGSFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFG NPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKD ADNDNCMCKCALMLTGGWWFDDCGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 TYR n 1 3 LYS n 1 4 ASP n 1 5 ASP n 1 6 ASP n 1 7 ASP n 1 8 LYS n 1 9 GLY n 1 10 GLY n 1 11 GLY n 1 12 GLY n 1 13 SER n 1 14 PHE n 1 15 ARG n 1 16 ASP n 1 17 CYS n 1 18 ALA n 1 19 ASP n 1 20 VAL n 1 21 TYR n 1 22 GLN n 1 23 ALA n 1 24 GLY n 1 25 PHE n 1 26 ASN n 1 27 LYS n 1 28 SER n 1 29 GLY n 1 30 ILE n 1 31 TYR n 1 32 THR n 1 33 ILE n 1 34 TYR n 1 35 ILE n 1 36 ASN n 1 37 ASN n 1 38 MET n 1 39 PRO n 1 40 GLU n 1 41 PRO n 1 42 LYS n 1 43 LYS n 1 44 VAL n 1 45 PHE n 1 46 CYS n 1 47 ASN n 1 48 MET n 1 49 ASP n 1 50 VAL n 1 51 ASN n 1 52 GLY n 1 53 GLY n 1 54 GLY n 1 55 TRP n 1 56 THR n 1 57 VAL n 1 58 ILE n 1 59 GLN n 1 60 HIS n 1 61 ARG n 1 62 GLU n 1 63 ASP n 1 64 GLY n 1 65 SER n 1 66 LEU n 1 67 ASP n 1 68 PHE n 1 69 GLN n 1 70 ARG n 1 71 GLY n 1 72 TRP n 1 73 LYS n 1 74 GLU n 1 75 TYR n 1 76 LYS n 1 77 MET n 1 78 GLY n 1 79 PHE n 1 80 GLY n 1 81 ASN n 1 82 PRO n 1 83 SER n 1 84 GLY n 1 85 GLU n 1 86 TYR n 1 87 TRP n 1 88 LEU n 1 89 GLY n 1 90 ASN n 1 91 GLU n 1 92 PHE n 1 93 ILE n 1 94 PHE n 1 95 ALA n 1 96 ILE n 1 97 THR n 1 98 SER n 1 99 GLN n 1 100 ARG n 1 101 GLN n 1 102 TYR n 1 103 MET n 1 104 LEU n 1 105 ARG n 1 106 ILE n 1 107 GLU n 1 108 LEU n 1 109 MET n 1 110 ASP n 1 111 TRP n 1 112 GLU n 1 113 GLY n 1 114 ASN n 1 115 ARG n 1 116 ALA n 1 117 TYR n 1 118 SER n 1 119 GLN n 1 120 TYR n 1 121 ASP n 1 122 ARG n 1 123 PHE n 1 124 HIS n 1 125 ILE n 1 126 GLY n 1 127 ASN n 1 128 GLU n 1 129 LYS n 1 130 GLN n 1 131 ASN n 1 132 TYR n 1 133 ARG n 1 134 LEU n 1 135 TYR n 1 136 LEU n 1 137 LYS n 1 138 GLY n 1 139 HIS n 1 140 THR n 1 141 GLY n 1 142 THR n 1 143 ALA n 1 144 GLY n 1 145 LYS n 1 146 GLN n 1 147 SER n 1 148 SER n 1 149 LEU n 1 150 ILE n 1 151 LEU n 1 152 HIS n 1 153 GLY n 1 154 ALA n 1 155 ASP n 1 156 PHE n 1 157 SER n 1 158 THR n 1 159 LYS n 1 160 ASP n 1 161 ALA n 1 162 ASP n 1 163 ASN n 1 164 ASP n 1 165 ASN n 1 166 CYS n 1 167 MET n 1 168 CYS n 1 169 LYS n 1 170 CYS n 1 171 ALA n 1 172 LEU n 1 173 MET n 1 174 LEU n 1 175 THR n 1 176 GLY n 1 177 GLY n 1 178 TRP n 1 179 TRP n 1 180 PHE n 1 181 ASP n 1 182 ASP n 1 183 CYS n 1 184 GLY n 1 185 PRO n 1 186 SER n 1 187 ASN n 1 188 LEU n 1 189 ASN n 1 190 GLY n 1 191 MET n 1 192 PHE n 1 193 TYR n 1 194 THR n 1 195 ALA n 1 196 GLY n 1 197 GLN n 1 198 ASN n 1 199 HIS n 1 200 GLY n 1 201 LYS n 1 202 LEU n 1 203 ASN n 1 204 GLY n 1 205 ILE n 1 206 LYS n 1 207 TRP n 1 208 HIS n 1 209 TYR n 1 210 PHE n 1 211 LYS n 1 212 GLY n 1 213 PRO n 1 214 SER n 1 215 TYR n 1 216 SER n 1 217 LEU n 1 218 ARG n 1 219 SER n 1 220 THR n 1 221 THR n 1 222 MET n 1 223 MET n 1 224 ILE n 1 225 ARG n 1 226 PRO n 1 227 LEU n 1 228 ASP n 1 229 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 229 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ANGPT1, KIAA0003' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name Mammalia _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 40674 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line HEK293 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 -13 ? ? ? A . n A 1 2 TYR 2 -12 ? ? ? A . n A 1 3 LYS 3 -11 ? ? ? A . n A 1 4 ASP 4 -10 ? ? ? A . n A 1 5 ASP 5 -9 ? ? ? A . n A 1 6 ASP 6 -8 ? ? ? A . n A 1 7 ASP 7 -7 ? ? ? A . n A 1 8 LYS 8 -6 ? ? ? A . n A 1 9 GLY 9 -5 ? ? ? A . n A 1 10 GLY 10 -4 ? ? ? A . n A 1 11 GLY 11 -3 ? ? ? A . n A 1 12 GLY 12 -2 -2 GLY GLY A . n A 1 13 SER 13 -1 -1 SER SER A . n A 1 14 PHE 14 283 283 PHE PHE A . n A 1 15 ARG 15 284 284 ARG ARG A . n A 1 16 ASP 16 285 285 ASP ASP A . n A 1 17 CYS 17 286 286 CYS CYS A . n A 1 18 ALA 18 287 287 ALA ALA A . n A 1 19 ASP 19 288 288 ASP ASP A . n A 1 20 VAL 20 289 289 VAL VAL A . n A 1 21 TYR 21 290 290 TYR TYR A . n A 1 22 GLN 22 291 291 GLN GLN A . n A 1 23 ALA 23 292 292 ALA ALA A . n A 1 24 GLY 24 293 293 GLY GLY A . n A 1 25 PHE 25 294 294 PHE PHE A . n A 1 26 ASN 26 295 295 ASN ASN A . n A 1 27 LYS 27 296 296 LYS LYS A . n A 1 28 SER 28 297 297 SER SER A . n A 1 29 GLY 29 298 298 GLY GLY A . n A 1 30 ILE 30 299 299 ILE ILE A . n A 1 31 TYR 31 300 300 TYR TYR A . n A 1 32 THR 32 301 301 THR THR A . n A 1 33 ILE 33 302 302 ILE ILE A . n A 1 34 TYR 34 303 303 TYR TYR A . n A 1 35 ILE 35 304 304 ILE ILE A . n A 1 36 ASN 36 305 305 ASN ASN A . n A 1 37 ASN 37 306 306 ASN ASN A . n A 1 38 MET 38 307 307 MET MET A . n A 1 39 PRO 39 308 308 PRO PRO A . n A 1 40 GLU 40 309 309 GLU GLU A . n A 1 41 PRO 41 310 310 PRO PRO A . n A 1 42 LYS 42 311 311 LYS LYS A . n A 1 43 LYS 43 312 312 LYS LYS A . n A 1 44 VAL 44 313 313 VAL VAL A . n A 1 45 PHE 45 314 314 PHE PHE A . n A 1 46 CYS 46 315 315 CYS CYS A . n A 1 47 ASN 47 316 316 ASN ASN A . n A 1 48 MET 48 317 317 MET MET A . n A 1 49 ASP 49 318 318 ASP ASP A . n A 1 50 VAL 50 319 319 VAL VAL A . n A 1 51 ASN 51 320 320 ASN ASN A . n A 1 52 GLY 52 321 321 GLY GLY A . n A 1 53 GLY 53 322 322 GLY GLY A . n A 1 54 GLY 54 323 323 GLY GLY A . n A 1 55 TRP 55 324 324 TRP TRP A . n A 1 56 THR 56 325 325 THR THR A . n A 1 57 VAL 57 326 326 VAL VAL A . n A 1 58 ILE 58 327 327 ILE ILE A . n A 1 59 GLN 59 328 328 GLN GLN A . n A 1 60 HIS 60 329 329 HIS HIS A . n A 1 61 ARG 61 330 330 ARG ARG A . n A 1 62 GLU 62 331 331 GLU GLU A . n A 1 63 ASP 63 332 332 ASP ASP A . n A 1 64 GLY 64 333 333 GLY GLY A . n A 1 65 SER 65 334 334 SER SER A . n A 1 66 LEU 66 335 335 LEU LEU A . n A 1 67 ASP 67 336 336 ASP ASP A . n A 1 68 PHE 68 337 337 PHE PHE A . n A 1 69 GLN 69 338 338 GLN GLN A . n A 1 70 ARG 70 339 339 ARG ARG A . n A 1 71 GLY 71 340 340 GLY GLY A . n A 1 72 TRP 72 341 341 TRP TRP A . n A 1 73 LYS 73 342 342 LYS LYS A . n A 1 74 GLU 74 343 343 GLU GLU A . n A 1 75 TYR 75 344 344 TYR TYR A . n A 1 76 LYS 76 345 345 LYS LYS A . n A 1 77 MET 77 346 346 MET MET A . n A 1 78 GLY 78 347 347 GLY GLY A . n A 1 79 PHE 79 348 348 PHE PHE A . n A 1 80 GLY 80 349 349 GLY GLY A . n A 1 81 ASN 81 350 350 ASN ASN A . n A 1 82 PRO 82 351 351 PRO PRO A . n A 1 83 SER 83 352 352 SER SER A . n A 1 84 GLY 84 353 353 GLY GLY A . n A 1 85 GLU 85 354 354 GLU GLU A . n A 1 86 TYR 86 355 355 TYR TYR A . n A 1 87 TRP 87 356 356 TRP TRP A . n A 1 88 LEU 88 357 357 LEU LEU A . n A 1 89 GLY 89 358 358 GLY GLY A . n A 1 90 ASN 90 359 359 ASN ASN A . n A 1 91 GLU 91 360 360 GLU GLU A . n A 1 92 PHE 92 361 361 PHE PHE A . n A 1 93 ILE 93 362 362 ILE ILE A . n A 1 94 PHE 94 363 363 PHE PHE A . n A 1 95 ALA 95 364 364 ALA ALA A . n A 1 96 ILE 96 365 365 ILE ILE A . n A 1 97 THR 97 366 366 THR THR A . n A 1 98 SER 98 367 367 SER SER A . n A 1 99 GLN 99 368 368 GLN GLN A . n A 1 100 ARG 100 369 369 ARG ARG A . n A 1 101 GLN 101 370 370 GLN GLN A . n A 1 102 TYR 102 371 371 TYR TYR A . n A 1 103 MET 103 372 372 MET MET A . n A 1 104 LEU 104 373 373 LEU LEU A . n A 1 105 ARG 105 374 374 ARG ARG A . n A 1 106 ILE 106 375 375 ILE ILE A . n A 1 107 GLU 107 376 376 GLU GLU A . n A 1 108 LEU 108 377 377 LEU LEU A . n A 1 109 MET 109 378 378 MET MET A . n A 1 110 ASP 110 379 379 ASP ASP A . n A 1 111 TRP 111 380 380 TRP TRP A . n A 1 112 GLU 112 381 381 GLU GLU A . n A 1 113 GLY 113 382 382 GLY GLY A . n A 1 114 ASN 114 383 383 ASN ASN A . n A 1 115 ARG 115 384 384 ARG ARG A . n A 1 116 ALA 116 385 385 ALA ALA A . n A 1 117 TYR 117 386 386 TYR TYR A . n A 1 118 SER 118 387 387 SER SER A . n A 1 119 GLN 119 388 388 GLN GLN A . n A 1 120 TYR 120 389 389 TYR TYR A . n A 1 121 ASP 121 390 390 ASP ASP A . n A 1 122 ARG 122 391 391 ARG ARG A . n A 1 123 PHE 123 392 392 PHE PHE A . n A 1 124 HIS 124 393 393 HIS HIS A . n A 1 125 ILE 125 394 394 ILE ILE A . n A 1 126 GLY 126 395 395 GLY GLY A . n A 1 127 ASN 127 396 396 ASN ASN A . n A 1 128 GLU 128 397 397 GLU GLU A . n A 1 129 LYS 129 398 398 LYS LYS A . n A 1 130 GLN 130 399 399 GLN GLN A . n A 1 131 ASN 131 400 400 ASN ASN A . n A 1 132 TYR 132 401 401 TYR TYR A . n A 1 133 ARG 133 402 402 ARG ARG A . n A 1 134 LEU 134 403 403 LEU LEU A . n A 1 135 TYR 135 404 404 TYR TYR A . n A 1 136 LEU 136 405 405 LEU LEU A . n A 1 137 LYS 137 406 406 LYS LYS A . n A 1 138 GLY 138 407 407 GLY GLY A . n A 1 139 HIS 139 408 408 HIS HIS A . n A 1 140 THR 140 409 409 THR THR A . n A 1 141 GLY 141 410 410 GLY GLY A . n A 1 142 THR 142 411 411 THR THR A . n A 1 143 ALA 143 412 412 ALA ALA A . n A 1 144 GLY 144 413 413 GLY GLY A . n A 1 145 LYS 145 414 414 LYS LYS A . n A 1 146 GLN 146 415 415 GLN GLN A . n A 1 147 SER 147 416 416 SER SER A . n A 1 148 SER 148 417 417 SER SER A . n A 1 149 LEU 149 418 418 LEU LEU A . n A 1 150 ILE 150 419 419 ILE ILE A . n A 1 151 LEU 151 420 420 LEU LEU A . n A 1 152 HIS 152 421 421 HIS HIS A . n A 1 153 GLY 153 422 422 GLY GLY A . n A 1 154 ALA 154 423 423 ALA ALA A . n A 1 155 ASP 155 424 424 ASP ASP A . n A 1 156 PHE 156 425 425 PHE PHE A . n A 1 157 SER 157 426 426 SER SER A . n A 1 158 THR 158 427 427 THR THR A . n A 1 159 LYS 159 428 428 LYS LYS A . n A 1 160 ASP 160 429 429 ASP ASP A . n A 1 161 ALA 161 430 430 ALA ALA A . n A 1 162 ASP 162 431 431 ASP ASP A . n A 1 163 ASN 163 432 432 ASN ASN A . n A 1 164 ASP 164 433 433 ASP ASP A . n A 1 165 ASN 165 434 434 ASN ASN A . n A 1 166 CYS 166 435 435 CYS CYS A . n A 1 167 MET 167 436 436 MET MET A . n A 1 168 CYS 168 437 437 CYS CYS A . n A 1 169 LYS 169 438 438 LYS LYS A . n A 1 170 CYS 170 439 439 CYS CYS A . n A 1 171 ALA 171 440 440 ALA ALA A . n A 1 172 LEU 172 441 441 LEU LEU A . n A 1 173 MET 173 442 442 MET MET A . n A 1 174 LEU 174 443 443 LEU LEU A . n A 1 175 THR 175 444 444 THR THR A . n A 1 176 GLY 176 445 445 GLY GLY A . n A 1 177 GLY 177 446 446 GLY GLY A . n A 1 178 TRP 178 447 447 TRP TRP A . n A 1 179 TRP 179 448 448 TRP TRP A . n A 1 180 PHE 180 449 449 PHE PHE A . n A 1 181 ASP 181 450 450 ASP ASP A . n A 1 182 ASP 182 451 451 ASP ASP A . n A 1 183 CYS 183 452 452 CYS CYS A . n A 1 184 GLY 184 453 453 GLY GLY A . n A 1 185 PRO 185 454 454 PRO PRO A . n A 1 186 SER 186 455 455 SER SER A . n A 1 187 ASN 187 456 456 ASN ASN A . n A 1 188 LEU 188 457 457 LEU LEU A . n A 1 189 ASN 189 458 458 ASN ASN A . n A 1 190 GLY 190 459 459 GLY GLY A . n A 1 191 MET 191 460 460 MET MET A . n A 1 192 PHE 192 461 461 PHE PHE A . n A 1 193 TYR 193 462 462 TYR TYR A . n A 1 194 THR 194 463 463 THR THR A . n A 1 195 ALA 195 464 464 ALA ALA A . n A 1 196 GLY 196 465 465 GLY GLY A . n A 1 197 GLN 197 466 466 GLN GLN A . n A 1 198 ASN 198 467 467 ASN ASN A . n A 1 199 HIS 199 468 468 HIS HIS A . n A 1 200 GLY 200 469 469 GLY GLY A . n A 1 201 LYS 201 470 470 LYS LYS A . n A 1 202 LEU 202 471 471 LEU LEU A . n A 1 203 ASN 203 472 472 ASN ASN A . n A 1 204 GLY 204 473 473 GLY GLY A . n A 1 205 ILE 205 474 474 ILE ILE A . n A 1 206 LYS 206 475 475 LYS LYS A . n A 1 207 TRP 207 476 476 TRP TRP A . n A 1 208 HIS 208 477 477 HIS HIS A . n A 1 209 TYR 209 478 478 TYR TYR A . n A 1 210 PHE 210 479 479 PHE PHE A . n A 1 211 LYS 211 480 480 LYS LYS A . n A 1 212 GLY 212 481 481 GLY GLY A . n A 1 213 PRO 213 482 482 PRO PRO A . n A 1 214 SER 214 483 483 SER SER A . n A 1 215 TYR 215 484 484 TYR TYR A . n A 1 216 SER 216 485 485 SER SER A . n A 1 217 LEU 217 486 486 LEU LEU A . n A 1 218 ARG 218 487 487 ARG ARG A . n A 1 219 SER 219 488 488 SER SER A . n A 1 220 THR 220 489 489 THR THR A . n A 1 221 THR 221 490 490 THR THR A . n A 1 222 MET 222 491 491 MET MET A . n A 1 223 MET 223 492 492 MET MET A . n A 1 224 ILE 224 493 493 ILE ILE A . n A 1 225 ARG 225 494 494 ARG ARG A . n A 1 226 PRO 226 495 495 PRO PRO A . n A 1 227 LEU 227 496 496 LEU LEU A . n A 1 228 ASP 228 497 497 ASP ASP A . n A 1 229 PHE 229 498 498 PHE PHE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 501 56 HOH HOH A . B 2 HOH 2 502 43 HOH HOH A . B 2 HOH 3 503 58 HOH HOH A . B 2 HOH 4 504 21 HOH HOH A . B 2 HOH 5 505 14 HOH HOH A . B 2 HOH 6 506 27 HOH HOH A . B 2 HOH 7 507 18 HOH HOH A . B 2 HOH 8 508 32 HOH HOH A . B 2 HOH 9 509 48 HOH HOH A . B 2 HOH 10 510 31 HOH HOH A . B 2 HOH 11 511 23 HOH HOH A . B 2 HOH 12 512 28 HOH HOH A . B 2 HOH 13 513 61 HOH HOH A . B 2 HOH 14 514 50 HOH HOH A . B 2 HOH 15 515 9 HOH HOH A . B 2 HOH 16 516 33 HOH HOH A . B 2 HOH 17 517 20 HOH HOH A . B 2 HOH 18 518 49 HOH HOH A . B 2 HOH 19 519 26 HOH HOH A . B 2 HOH 20 520 45 HOH HOH A . B 2 HOH 21 521 19 HOH HOH A . B 2 HOH 22 522 16 HOH HOH A . B 2 HOH 23 523 36 HOH HOH A . B 2 HOH 24 524 12 HOH HOH A . B 2 HOH 25 525 42 HOH HOH A . B 2 HOH 26 526 17 HOH HOH A . B 2 HOH 27 527 51 HOH HOH A . B 2 HOH 28 528 6 HOH HOH A . B 2 HOH 29 529 65 HOH HOH A . B 2 HOH 30 530 41 HOH HOH A . B 2 HOH 31 531 44 HOH HOH A . B 2 HOH 32 532 47 HOH HOH A . B 2 HOH 33 533 24 HOH HOH A . B 2 HOH 34 534 40 HOH HOH A . B 2 HOH 35 535 11 HOH HOH A . B 2 HOH 36 536 39 HOH HOH A . B 2 HOH 37 537 3 HOH HOH A . B 2 HOH 38 538 55 HOH HOH A . B 2 HOH 39 539 60 HOH HOH A . B 2 HOH 40 540 15 HOH HOH A . B 2 HOH 41 541 1 HOH HOH A . B 2 HOH 42 542 10 HOH HOH A . B 2 HOH 43 543 35 HOH HOH A . B 2 HOH 44 544 30 HOH HOH A . B 2 HOH 45 545 37 HOH HOH A . B 2 HOH 46 546 8 HOH HOH A . B 2 HOH 47 547 29 HOH HOH A . B 2 HOH 48 548 7 HOH HOH A . B 2 HOH 49 549 63 HOH HOH A . B 2 HOH 50 550 5 HOH HOH A . B 2 HOH 51 551 66 HOH HOH A . B 2 HOH 52 552 38 HOH HOH A . B 2 HOH 53 553 57 HOH HOH A . B 2 HOH 54 554 25 HOH HOH A . B 2 HOH 55 555 4 HOH HOH A . B 2 HOH 56 556 59 HOH HOH A . B 2 HOH 57 557 52 HOH HOH A . B 2 HOH 58 558 64 HOH HOH A . B 2 HOH 59 559 2 HOH HOH A . B 2 HOH 60 560 46 HOH HOH A . B 2 HOH 61 561 67 HOH HOH A . B 2 HOH 62 562 22 HOH HOH A . B 2 HOH 63 563 62 HOH HOH A . B 2 HOH 64 564 53 HOH HOH A . B 2 HOH 65 565 13 HOH HOH A . B 2 HOH 66 566 54 HOH HOH A . B 2 HOH 67 567 68 HOH HOH A . B 2 HOH 68 568 34 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0425 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9IVU _cell.details ? _cell.formula_units_Z ? _cell.length_a 80.550 _cell.length_a_esd ? _cell.length_b 80.550 _cell.length_b_esd ? _cell.length_c 186.690 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9IVU _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9IVU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '4.0 M Sodium formate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-01-01 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9791 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9791 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9IVU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.28 _reflns.d_resolution_low 27.38 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17164 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.115 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.28 _reflns_shell.d_res_low 2.32 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 832 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.765 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.239 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.61 _refine.aniso_B[1][2] 0.30 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.61 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -1.98 _refine.B_iso_max ? _refine.B_iso_mean 44.362 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.955 _refine.correlation_coeff_Fo_to_Fc_free 0.932 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9IVU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.28 _refine.ls_d_res_low 27.38 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16131 _refine.ls_number_reflns_R_free 979 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.83 _refine.ls_percent_reflns_R_free 5.7 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19909 _refine.ls_R_factor_R_free 0.24678 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19620 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.208 _refine.pdbx_overall_ESU_R_Free 0.193 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.647 _refine.overall_SU_ML 0.154 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.28 _refine_hist.d_res_low 27.38 _refine_hist.number_atoms_solvent 68 _refine_hist.number_atoms_total 1828 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1760 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.012 1811 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 1602 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.696 1.803 2439 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.640 1.776 3683 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.829 5.000 217 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 6.940 5.000 10 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.104 10.000 298 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.106 0.200 231 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 2216 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 482 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.401 4.315 871 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.398 4.316 871 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.418 7.749 1087 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.417 7.752 1088 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.990 4.771 940 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.986 4.772 941 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 9.024 8.487 1353 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 13.327 41.44 2030 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 13.331 41.45 2026 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.280 _refine_ls_shell.d_res_low 2.339 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 70 _refine_ls_shell.number_reflns_R_work 1156 _refine_ls_shell.percent_reflns_obs 99.84 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.319 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.433 # _struct.entry_id 9IVU _struct.title 'Crystal structure of Ang1-A451D receptor binding domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9IVU _struct_keywords.text 'Angiopoietin 1, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ANGP1_HUMAN _struct_ref.pdbx_db_accession Q15389 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;FRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFI FAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALM LTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF ; _struct_ref.pdbx_align_begin 283 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9IVU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 14 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 229 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15389 _struct_ref_seq.db_align_beg 283 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 498 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 283 _struct_ref_seq.pdbx_auth_seq_align_end 498 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9IVU ASP A 1 ? UNP Q15389 ? ? 'expression tag' -13 1 1 9IVU TYR A 2 ? UNP Q15389 ? ? 'expression tag' -12 2 1 9IVU LYS A 3 ? UNP Q15389 ? ? 'expression tag' -11 3 1 9IVU ASP A 4 ? UNP Q15389 ? ? 'expression tag' -10 4 1 9IVU ASP A 5 ? UNP Q15389 ? ? 'expression tag' -9 5 1 9IVU ASP A 6 ? UNP Q15389 ? ? 'expression tag' -8 6 1 9IVU ASP A 7 ? UNP Q15389 ? ? 'expression tag' -7 7 1 9IVU LYS A 8 ? UNP Q15389 ? ? 'expression tag' -6 8 1 9IVU GLY A 9 ? UNP Q15389 ? ? 'expression tag' -5 9 1 9IVU GLY A 10 ? UNP Q15389 ? ? 'expression tag' -4 10 1 9IVU GLY A 11 ? UNP Q15389 ? ? 'expression tag' -3 11 1 9IVU GLY A 12 ? UNP Q15389 ? ? 'expression tag' -2 12 1 9IVU SER A 13 ? UNP Q15389 ? ? 'expression tag' -1 13 1 9IVU ASP A 182 ? UNP Q15389 ALA 451 'engineered mutation' 451 14 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 5330 ? 2 MORE -23 ? 2 'SSA (A^2)' 32890 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1,2,3,4 A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 9_554 -x,-x+y,-z-1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -62.2300000000 4 'crystal symmetry operation' 12_554 x,x-y,-z-1/3 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -62.2300000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 16 ? ALA A 23 ? ASP A 285 ALA A 292 1 ? 8 HELX_P HELX_P2 AA2 ASP A 49 ? GLY A 53 ? ASP A 318 GLY A 322 5 ? 5 HELX_P HELX_P3 AA3 GLY A 71 ? GLY A 78 ? GLY A 340 GLY A 347 1 ? 8 HELX_P HELX_P4 AA4 GLY A 89 ? GLN A 99 ? GLY A 358 GLN A 368 1 ? 11 HELX_P HELX_P5 AA5 ASN A 127 ? ASN A 131 ? ASN A 396 ASN A 400 5 ? 5 HELX_P HELX_P6 AA6 LYS A 169 ? THR A 175 ? LYS A 438 THR A 444 1 ? 7 HELX_P HELX_P7 AA7 THR A 194 ? HIS A 199 ? THR A 463 HIS A 468 5 ? 6 HELX_P HELX_P8 AA8 HIS A 208 ? GLY A 212 ? HIS A 477 GLY A 481 1 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 286 A CYS 315 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 166 SG ? ? ? 1_555 A CYS 168 SG ? ? A CYS 435 A CYS 437 1_555 ? ? ? ? ? ? ? 2.265 ? ? disulf3 disulf ? ? A CYS 170 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 439 A CYS 452 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 17 ? CYS A 46 ? CYS A 286 ? 1_555 CYS A 315 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 166 ? CYS A 168 ? CYS A 435 ? 1_555 CYS A 437 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 170 ? CYS A 183 ? CYS A 439 ? 1_555 CYS A 452 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 7 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 29 ? ILE A 33 ? GLY A 298 ILE A 302 AA1 2 LYS A 42 ? ASN A 47 ? LYS A 311 ASN A 316 AA1 3 TRP A 55 ? ARG A 61 ? TRP A 324 ARG A 330 AA1 4 TYR A 86 ? TRP A 87 ? TYR A 355 TRP A 356 AA1 5 PHE A 79 ? GLY A 80 ? PHE A 348 GLY A 349 AA2 1 GLY A 29 ? ILE A 33 ? GLY A 298 ILE A 302 AA2 2 LYS A 42 ? ASN A 47 ? LYS A 311 ASN A 316 AA2 3 TRP A 55 ? ARG A 61 ? TRP A 324 ARG A 330 AA2 4 SER A 219 ? PRO A 226 ? SER A 488 PRO A 495 AA2 5 TYR A 102 ? MET A 109 ? TYR A 371 MET A 378 AA2 6 ARG A 115 ? ILE A 125 ? ARG A 384 ILE A 394 AA2 7 LEU A 134 ? GLY A 141 ? LEU A 403 GLY A 410 AA3 1 SER A 186 ? ASN A 187 ? SER A 455 ASN A 456 AA3 2 LYS A 206 ? TRP A 207 ? LYS A 475 TRP A 476 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 31 ? N TYR A 300 O VAL A 44 ? O VAL A 313 AA1 2 3 N PHE A 45 ? N PHE A 314 O VAL A 57 ? O VAL A 326 AA1 3 4 N HIS A 60 ? N HIS A 329 O TYR A 86 ? O TYR A 355 AA1 4 5 O TRP A 87 ? O TRP A 356 N PHE A 79 ? N PHE A 348 AA2 1 2 N TYR A 31 ? N TYR A 300 O VAL A 44 ? O VAL A 313 AA2 2 3 N PHE A 45 ? N PHE A 314 O VAL A 57 ? O VAL A 326 AA2 3 4 N ILE A 58 ? N ILE A 327 O MET A 222 ? O MET A 491 AA2 4 5 O THR A 221 ? O THR A 490 N GLU A 107 ? N GLU A 376 AA2 5 6 N LEU A 108 ? N LEU A 377 O ALA A 116 ? O ALA A 385 AA2 6 7 N HIS A 124 ? N HIS A 393 O TYR A 135 ? O TYR A 404 AA3 1 2 N ASN A 187 ? N ASN A 456 O LYS A 206 ? O LYS A 475 # _pdbx_entry_details.entry_id 9IVU _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OD2 A ASP 451 ? ? 1_555 ND1 A HIS 477 ? ? 4_555 1.78 2 1 OD2 A ASP 451 ? ? 1_555 CG A HIS 477 ? ? 4_555 1.96 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 452 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 452 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 452 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 131.32 _pdbx_validate_rmsd_angle.angle_target_value 111.50 _pdbx_validate_rmsd_angle.angle_deviation 19.82 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A -1 ? ? -9.16 86.37 2 1 PHE A 283 ? ? -58.92 74.20 3 1 PRO A 310 ? ? -58.74 171.25 4 1 GLU A 331 ? ? -165.38 -14.32 5 1 ASP A 332 ? ? -143.98 -11.34 6 1 ARG A 369 ? ? -171.62 -174.34 7 1 ALA A 412 ? ? -109.69 47.12 8 1 THR A 444 ? ? 84.53 151.99 9 1 ASP A 450 ? ? -105.63 -112.18 10 1 CYS A 452 ? ? 79.08 -51.20 11 1 ASN A 456 ? ? -165.05 97.00 12 1 ALA A 464 ? ? 40.12 -132.70 13 1 ASN A 467 ? ? -57.62 -9.47 14 1 PHE A 479 ? ? -102.26 -64.76 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 402 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.092 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP -13 ? A ASP 1 2 1 Y 1 A TYR -12 ? A TYR 2 3 1 Y 1 A LYS -11 ? A LYS 3 4 1 Y 1 A ASP -10 ? A ASP 4 5 1 Y 1 A ASP -9 ? A ASP 5 6 1 Y 1 A ASP -8 ? A ASP 6 7 1 Y 1 A ASP -7 ? A ASP 7 8 1 Y 1 A LYS -6 ? A LYS 8 9 1 Y 1 A GLY -5 ? A GLY 9 10 1 Y 1 A GLY -4 ? A GLY 10 11 1 Y 1 A GLY -3 ? A GLY 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 82070142 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4k0v _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9IVU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012415 _atom_sites.fract_transf_matrix[1][2] 0.007168 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014335 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005356 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #