data_9J5H # _entry.id 9J5H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9J5H pdb_00009j5h 10.2210/pdb9j5h/pdb WWPDB D_1300050379 ? ? BMRB 36689 ? 10.13018/BMR36689 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-02-19 ? 2 'Structure model' 1 1 2025-02-26 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' 5 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9J5H _pdbx_database_status.recvd_initial_deposition_date 2024-08-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'solution structure of disulfide-directed multicyclic peptides with affinity to pdl1' _pdbx_database_related.db_id 36689 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email chlwu@xmu.edu.cn _pdbx_contact_author.name_first wu _pdbx_contact_author.name_last chuanliu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2946-7299 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fan, S.H.' 1 ? 'Wu, C.L.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 147 _citation.language ? _citation.page_first 4821 _citation.page_last 4832 _citation.title ;Disulfide-Directed Multicyclic Peptides with N-Terminally Extendable alpha-Helices for Recognition and Activation of G Protein-Coupled Receptors. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.4c12808 _citation.pdbx_database_id_PubMed 39688263 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fan, S.' 1 ? primary 'Li, J.' 2 ? primary 'Zhuang, J.' 3 ? primary 'Zhou, Q.' 4 ? primary 'Mai, Y.' 5 ? primary 'Lin, B.' 6 ? primary 'Wang, M.W.' 7 ? primary 'Wu, C.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description p1 _entity.formula_weight 3965.687 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SDEMWFCETLRRLLCPKSCSIEGGCPEVCSHMCPL _entity_poly.pdbx_seq_one_letter_code_can SDEMWFCETLRRLLCPKSCSIEGGCPEVCSHMCPL _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 GLU n 1 4 MET n 1 5 TRP n 1 6 PHE n 1 7 CYS n 1 8 GLU n 1 9 THR n 1 10 LEU n 1 11 ARG n 1 12 ARG n 1 13 LEU n 1 14 LEU n 1 15 CYS n 1 16 PRO n 1 17 LYS n 1 18 SER n 1 19 CYS n 1 20 SER n 1 21 ILE n 1 22 GLU n 1 23 GLY n 1 24 GLY n 1 25 CYS n 1 26 PRO n 1 27 GLU n 1 28 VAL n 1 29 CYS n 1 30 SER n 1 31 HIS n 1 32 MET n 1 33 CYS n 1 34 PRO n 1 35 LEU n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 35 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 LEU 35 35 35 LEU LEU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9J5H _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9J5H _struct.title 'Solution structure of disulfide-directed multicyclic peptides with affinity to pdl1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9J5H _struct_keywords.text 'disulfide-directed multicyclic peptides, pdl1, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9J5H _struct_ref.pdbx_db_accession 9J5H _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9J5H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9J5H _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 35 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 35 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? CYS A 15 ? ASP A 2 CYS A 15 1 ? 14 HELX_P HELX_P2 AA2 LYS A 17 ? GLU A 22 ? LYS A 17 GLU A 22 1 ? 6 HELX_P HELX_P3 AA3 PRO A 26 ? CYS A 33 ? PRO A 26 CYS A 33 5 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 7 A CYS 33 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 15 A CYS 29 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf3 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 19 A CYS 25 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 7 ? CYS A 33 ? CYS A 7 ? 1_555 CYS A 33 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 15 ? CYS A 29 ? CYS A 15 ? 1_555 CYS A 29 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 19 ? CYS A 25 ? CYS A 19 ? 1_555 CYS A 25 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 9J5H _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A TRP 5 ? ? HG1 A THR 9 ? ? 1.57 2 4 O A TRP 5 ? ? HG1 A THR 9 ? ? 1.59 3 8 O A TRP 5 ? ? HG1 A THR 9 ? ? 1.59 4 14 O A TRP 5 ? ? HG1 A THR 9 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? 73.04 -8.27 2 1 ILE A 21 ? ? -98.95 -60.15 3 2 ILE A 21 ? ? -101.89 -62.25 4 3 ILE A 21 ? ? -90.07 -61.03 5 4 ILE A 21 ? ? -102.39 -60.07 6 4 HIS A 31 ? ? -104.78 42.34 7 5 HIS A 31 ? ? -96.96 33.25 8 8 ILE A 21 ? ? -95.74 -60.57 9 9 ILE A 21 ? ? -99.66 -61.44 10 9 HIS A 31 ? ? -102.53 41.47 11 10 ILE A 21 ? ? -101.26 -60.27 12 10 HIS A 31 ? ? -98.06 43.90 13 10 CYS A 33 ? ? -151.75 79.50 14 10 PRO A 34 ? ? -82.12 32.43 15 11 ILE A 21 ? ? -101.97 -61.04 16 11 HIS A 31 ? ? -96.90 41.22 17 11 PRO A 34 ? ? -94.30 30.64 18 12 ILE A 21 ? ? -98.08 -61.01 19 13 HIS A 31 ? ? -140.81 43.63 20 13 PRO A 34 ? ? -90.22 44.00 21 14 CYS A 33 ? ? -153.26 85.90 22 14 PRO A 34 ? ? -88.49 41.14 23 15 ILE A 21 ? ? -101.74 -61.61 # _pdbx_nmr_ensemble.entry_id 9J5H _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9J5H _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM p1, 50% perdeuterated acetonitrile and 50% H2O' _pdbx_nmr_sample_details.solvent_system '50% perdeuterated acetonitrile and 50% H2O' _pdbx_nmr_sample_details.label p1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component p1 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label c2 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 anisotropic 2 1 1 '2D 1H-15N HSQC' 1 anisotropic 3 1 1 '2D 1H-1H NOESY' 1 anisotropic 4 1 1 '2D 1H-1H TOCSY' 1 anisotropic # _pdbx_nmr_refine.entry_id 9J5H _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 refinement CNS ? 'Brunger, Adams, Clore, Gros, Nilges and Read' 4 processing TopSpin ? 'Bruker Biospin' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASP N N N N 28 ASP CA C N S 29 ASP C C N N 30 ASP O O N N 31 ASP CB C N N 32 ASP CG C N N 33 ASP OD1 O N N 34 ASP OD2 O N N 35 ASP OXT O N N 36 ASP H H N N 37 ASP H2 H N N 38 ASP HA H N N 39 ASP HB2 H N N 40 ASP HB3 H N N 41 ASP HD2 H N N 42 ASP HXT H N N 43 CYS N N N N 44 CYS CA C N R 45 CYS C C N N 46 CYS O O N N 47 CYS CB C N N 48 CYS SG S N N 49 CYS OXT O N N 50 CYS H H N N 51 CYS H2 H N N 52 CYS HA H N N 53 CYS HB2 H N N 54 CYS HB3 H N N 55 CYS HG H N N 56 CYS HXT H N N 57 GLU N N N N 58 GLU CA C N S 59 GLU C C N N 60 GLU O O N N 61 GLU CB C N N 62 GLU CG C N N 63 GLU CD C N N 64 GLU OE1 O N N 65 GLU OE2 O N N 66 GLU OXT O N N 67 GLU H H N N 68 GLU H2 H N N 69 GLU HA H N N 70 GLU HB2 H N N 71 GLU HB3 H N N 72 GLU HG2 H N N 73 GLU HG3 H N N 74 GLU HE2 H N N 75 GLU HXT H N N 76 GLY N N N N 77 GLY CA C N N 78 GLY C C N N 79 GLY O O N N 80 GLY OXT O N N 81 GLY H H N N 82 GLY H2 H N N 83 GLY HA2 H N N 84 GLY HA3 H N N 85 GLY HXT H N N 86 HIS N N N N 87 HIS CA C N S 88 HIS C C N N 89 HIS O O N N 90 HIS CB C N N 91 HIS CG C Y N 92 HIS ND1 N Y N 93 HIS CD2 C Y N 94 HIS CE1 C Y N 95 HIS NE2 N Y N 96 HIS OXT O N N 97 HIS H H N N 98 HIS H2 H N N 99 HIS HA H N N 100 HIS HB2 H N N 101 HIS HB3 H N N 102 HIS HD1 H N N 103 HIS HD2 H N N 104 HIS HE1 H N N 105 HIS HE2 H N N 106 HIS HXT H N N 107 ILE N N N N 108 ILE CA C N S 109 ILE C C N N 110 ILE O O N N 111 ILE CB C N S 112 ILE CG1 C N N 113 ILE CG2 C N N 114 ILE CD1 C N N 115 ILE OXT O N N 116 ILE H H N N 117 ILE H2 H N N 118 ILE HA H N N 119 ILE HB H N N 120 ILE HG12 H N N 121 ILE HG13 H N N 122 ILE HG21 H N N 123 ILE HG22 H N N 124 ILE HG23 H N N 125 ILE HD11 H N N 126 ILE HD12 H N N 127 ILE HD13 H N N 128 ILE HXT H N N 129 LEU N N N N 130 LEU CA C N S 131 LEU C C N N 132 LEU O O N N 133 LEU CB C N N 134 LEU CG C N N 135 LEU CD1 C N N 136 LEU CD2 C N N 137 LEU OXT O N N 138 LEU H H N N 139 LEU H2 H N N 140 LEU HA H N N 141 LEU HB2 H N N 142 LEU HB3 H N N 143 LEU HG H N N 144 LEU HD11 H N N 145 LEU HD12 H N N 146 LEU HD13 H N N 147 LEU HD21 H N N 148 LEU HD22 H N N 149 LEU HD23 H N N 150 LEU HXT H N N 151 LYS N N N N 152 LYS CA C N S 153 LYS C C N N 154 LYS O O N N 155 LYS CB C N N 156 LYS CG C N N 157 LYS CD C N N 158 LYS CE C N N 159 LYS NZ N N N 160 LYS OXT O N N 161 LYS H H N N 162 LYS H2 H N N 163 LYS HA H N N 164 LYS HB2 H N N 165 LYS HB3 H N N 166 LYS HG2 H N N 167 LYS HG3 H N N 168 LYS HD2 H N N 169 LYS HD3 H N N 170 LYS HE2 H N N 171 LYS HE3 H N N 172 LYS HZ1 H N N 173 LYS HZ2 H N N 174 LYS HZ3 H N N 175 LYS HXT H N N 176 MET N N N N 177 MET CA C N S 178 MET C C N N 179 MET O O N N 180 MET CB C N N 181 MET CG C N N 182 MET SD S N N 183 MET CE C N N 184 MET OXT O N N 185 MET H H N N 186 MET H2 H N N 187 MET HA H N N 188 MET HB2 H N N 189 MET HB3 H N N 190 MET HG2 H N N 191 MET HG3 H N N 192 MET HE1 H N N 193 MET HE2 H N N 194 MET HE3 H N N 195 MET HXT H N N 196 PHE N N N N 197 PHE CA C N S 198 PHE C C N N 199 PHE O O N N 200 PHE CB C N N 201 PHE CG C Y N 202 PHE CD1 C Y N 203 PHE CD2 C Y N 204 PHE CE1 C Y N 205 PHE CE2 C Y N 206 PHE CZ C Y N 207 PHE OXT O N N 208 PHE H H N N 209 PHE H2 H N N 210 PHE HA H N N 211 PHE HB2 H N N 212 PHE HB3 H N N 213 PHE HD1 H N N 214 PHE HD2 H N N 215 PHE HE1 H N N 216 PHE HE2 H N N 217 PHE HZ H N N 218 PHE HXT H N N 219 PRO N N N N 220 PRO CA C N S 221 PRO C C N N 222 PRO O O N N 223 PRO CB C N N 224 PRO CG C N N 225 PRO CD C N N 226 PRO OXT O N N 227 PRO H H N N 228 PRO HA H N N 229 PRO HB2 H N N 230 PRO HB3 H N N 231 PRO HG2 H N N 232 PRO HG3 H N N 233 PRO HD2 H N N 234 PRO HD3 H N N 235 PRO HXT H N N 236 SER N N N N 237 SER CA C N S 238 SER C C N N 239 SER O O N N 240 SER CB C N N 241 SER OG O N N 242 SER OXT O N N 243 SER H H N N 244 SER H2 H N N 245 SER HA H N N 246 SER HB2 H N N 247 SER HB3 H N N 248 SER HG H N N 249 SER HXT H N N 250 THR N N N N 251 THR CA C N S 252 THR C C N N 253 THR O O N N 254 THR CB C N R 255 THR OG1 O N N 256 THR CG2 C N N 257 THR OXT O N N 258 THR H H N N 259 THR H2 H N N 260 THR HA H N N 261 THR HB H N N 262 THR HG1 H N N 263 THR HG21 H N N 264 THR HG22 H N N 265 THR HG23 H N N 266 THR HXT H N N 267 TRP N N N N 268 TRP CA C N S 269 TRP C C N N 270 TRP O O N N 271 TRP CB C N N 272 TRP CG C Y N 273 TRP CD1 C Y N 274 TRP CD2 C Y N 275 TRP NE1 N Y N 276 TRP CE2 C Y N 277 TRP CE3 C Y N 278 TRP CZ2 C Y N 279 TRP CZ3 C Y N 280 TRP CH2 C Y N 281 TRP OXT O N N 282 TRP H H N N 283 TRP H2 H N N 284 TRP HA H N N 285 TRP HB2 H N N 286 TRP HB3 H N N 287 TRP HD1 H N N 288 TRP HE1 H N N 289 TRP HE3 H N N 290 TRP HZ2 H N N 291 TRP HZ3 H N N 292 TRP HH2 H N N 293 TRP HXT H N N 294 VAL N N N N 295 VAL CA C N S 296 VAL C C N N 297 VAL O O N N 298 VAL CB C N N 299 VAL CG1 C N N 300 VAL CG2 C N N 301 VAL OXT O N N 302 VAL H H N N 303 VAL H2 H N N 304 VAL HA H N N 305 VAL HB H N N 306 VAL HG11 H N N 307 VAL HG12 H N N 308 VAL HG13 H N N 309 VAL HG21 H N N 310 VAL HG22 H N N 311 VAL HG23 H N N 312 VAL HXT H N N 313 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASP N CA sing N N 27 ASP N H sing N N 28 ASP N H2 sing N N 29 ASP CA C sing N N 30 ASP CA CB sing N N 31 ASP CA HA sing N N 32 ASP C O doub N N 33 ASP C OXT sing N N 34 ASP CB CG sing N N 35 ASP CB HB2 sing N N 36 ASP CB HB3 sing N N 37 ASP CG OD1 doub N N 38 ASP CG OD2 sing N N 39 ASP OD2 HD2 sing N N 40 ASP OXT HXT sing N N 41 CYS N CA sing N N 42 CYS N H sing N N 43 CYS N H2 sing N N 44 CYS CA C sing N N 45 CYS CA CB sing N N 46 CYS CA HA sing N N 47 CYS C O doub N N 48 CYS C OXT sing N N 49 CYS CB SG sing N N 50 CYS CB HB2 sing N N 51 CYS CB HB3 sing N N 52 CYS SG HG sing N N 53 CYS OXT HXT sing N N 54 GLU N CA sing N N 55 GLU N H sing N N 56 GLU N H2 sing N N 57 GLU CA C sing N N 58 GLU CA CB sing N N 59 GLU CA HA sing N N 60 GLU C O doub N N 61 GLU C OXT sing N N 62 GLU CB CG sing N N 63 GLU CB HB2 sing N N 64 GLU CB HB3 sing N N 65 GLU CG CD sing N N 66 GLU CG HG2 sing N N 67 GLU CG HG3 sing N N 68 GLU CD OE1 doub N N 69 GLU CD OE2 sing N N 70 GLU OE2 HE2 sing N N 71 GLU OXT HXT sing N N 72 GLY N CA sing N N 73 GLY N H sing N N 74 GLY N H2 sing N N 75 GLY CA C sing N N 76 GLY CA HA2 sing N N 77 GLY CA HA3 sing N N 78 GLY C O doub N N 79 GLY C OXT sing N N 80 GLY OXT HXT sing N N 81 HIS N CA sing N N 82 HIS N H sing N N 83 HIS N H2 sing N N 84 HIS CA C sing N N 85 HIS CA CB sing N N 86 HIS CA HA sing N N 87 HIS C O doub N N 88 HIS C OXT sing N N 89 HIS CB CG sing N N 90 HIS CB HB2 sing N N 91 HIS CB HB3 sing N N 92 HIS CG ND1 sing Y N 93 HIS CG CD2 doub Y N 94 HIS ND1 CE1 doub Y N 95 HIS ND1 HD1 sing N N 96 HIS CD2 NE2 sing Y N 97 HIS CD2 HD2 sing N N 98 HIS CE1 NE2 sing Y N 99 HIS CE1 HE1 sing N N 100 HIS NE2 HE2 sing N N 101 HIS OXT HXT sing N N 102 ILE N CA sing N N 103 ILE N H sing N N 104 ILE N H2 sing N N 105 ILE CA C sing N N 106 ILE CA CB sing N N 107 ILE CA HA sing N N 108 ILE C O doub N N 109 ILE C OXT sing N N 110 ILE CB CG1 sing N N 111 ILE CB CG2 sing N N 112 ILE CB HB sing N N 113 ILE CG1 CD1 sing N N 114 ILE CG1 HG12 sing N N 115 ILE CG1 HG13 sing N N 116 ILE CG2 HG21 sing N N 117 ILE CG2 HG22 sing N N 118 ILE CG2 HG23 sing N N 119 ILE CD1 HD11 sing N N 120 ILE CD1 HD12 sing N N 121 ILE CD1 HD13 sing N N 122 ILE OXT HXT sing N N 123 LEU N CA sing N N 124 LEU N H sing N N 125 LEU N H2 sing N N 126 LEU CA C sing N N 127 LEU CA CB sing N N 128 LEU CA HA sing N N 129 LEU C O doub N N 130 LEU C OXT sing N N 131 LEU CB CG sing N N 132 LEU CB HB2 sing N N 133 LEU CB HB3 sing N N 134 LEU CG CD1 sing N N 135 LEU CG CD2 sing N N 136 LEU CG HG sing N N 137 LEU CD1 HD11 sing N N 138 LEU CD1 HD12 sing N N 139 LEU CD1 HD13 sing N N 140 LEU CD2 HD21 sing N N 141 LEU CD2 HD22 sing N N 142 LEU CD2 HD23 sing N N 143 LEU OXT HXT sing N N 144 LYS N CA sing N N 145 LYS N H sing N N 146 LYS N H2 sing N N 147 LYS CA C sing N N 148 LYS CA CB sing N N 149 LYS CA HA sing N N 150 LYS C O doub N N 151 LYS C OXT sing N N 152 LYS CB CG sing N N 153 LYS CB HB2 sing N N 154 LYS CB HB3 sing N N 155 LYS CG CD sing N N 156 LYS CG HG2 sing N N 157 LYS CG HG3 sing N N 158 LYS CD CE sing N N 159 LYS CD HD2 sing N N 160 LYS CD HD3 sing N N 161 LYS CE NZ sing N N 162 LYS CE HE2 sing N N 163 LYS CE HE3 sing N N 164 LYS NZ HZ1 sing N N 165 LYS NZ HZ2 sing N N 166 LYS NZ HZ3 sing N N 167 LYS OXT HXT sing N N 168 MET N CA sing N N 169 MET N H sing N N 170 MET N H2 sing N N 171 MET CA C sing N N 172 MET CA CB sing N N 173 MET CA HA sing N N 174 MET C O doub N N 175 MET C OXT sing N N 176 MET CB CG sing N N 177 MET CB HB2 sing N N 178 MET CB HB3 sing N N 179 MET CG SD sing N N 180 MET CG HG2 sing N N 181 MET CG HG3 sing N N 182 MET SD CE sing N N 183 MET CE HE1 sing N N 184 MET CE HE2 sing N N 185 MET CE HE3 sing N N 186 MET OXT HXT sing N N 187 PHE N CA sing N N 188 PHE N H sing N N 189 PHE N H2 sing N N 190 PHE CA C sing N N 191 PHE CA CB sing N N 192 PHE CA HA sing N N 193 PHE C O doub N N 194 PHE C OXT sing N N 195 PHE CB CG sing N N 196 PHE CB HB2 sing N N 197 PHE CB HB3 sing N N 198 PHE CG CD1 doub Y N 199 PHE CG CD2 sing Y N 200 PHE CD1 CE1 sing Y N 201 PHE CD1 HD1 sing N N 202 PHE CD2 CE2 doub Y N 203 PHE CD2 HD2 sing N N 204 PHE CE1 CZ doub Y N 205 PHE CE1 HE1 sing N N 206 PHE CE2 CZ sing Y N 207 PHE CE2 HE2 sing N N 208 PHE CZ HZ sing N N 209 PHE OXT HXT sing N N 210 PRO N CA sing N N 211 PRO N CD sing N N 212 PRO N H sing N N 213 PRO CA C sing N N 214 PRO CA CB sing N N 215 PRO CA HA sing N N 216 PRO C O doub N N 217 PRO C OXT sing N N 218 PRO CB CG sing N N 219 PRO CB HB2 sing N N 220 PRO CB HB3 sing N N 221 PRO CG CD sing N N 222 PRO CG HG2 sing N N 223 PRO CG HG3 sing N N 224 PRO CD HD2 sing N N 225 PRO CD HD3 sing N N 226 PRO OXT HXT sing N N 227 SER N CA sing N N 228 SER N H sing N N 229 SER N H2 sing N N 230 SER CA C sing N N 231 SER CA CB sing N N 232 SER CA HA sing N N 233 SER C O doub N N 234 SER C OXT sing N N 235 SER CB OG sing N N 236 SER CB HB2 sing N N 237 SER CB HB3 sing N N 238 SER OG HG sing N N 239 SER OXT HXT sing N N 240 THR N CA sing N N 241 THR N H sing N N 242 THR N H2 sing N N 243 THR CA C sing N N 244 THR CA CB sing N N 245 THR CA HA sing N N 246 THR C O doub N N 247 THR C OXT sing N N 248 THR CB OG1 sing N N 249 THR CB CG2 sing N N 250 THR CB HB sing N N 251 THR OG1 HG1 sing N N 252 THR CG2 HG21 sing N N 253 THR CG2 HG22 sing N N 254 THR CG2 HG23 sing N N 255 THR OXT HXT sing N N 256 TRP N CA sing N N 257 TRP N H sing N N 258 TRP N H2 sing N N 259 TRP CA C sing N N 260 TRP CA CB sing N N 261 TRP CA HA sing N N 262 TRP C O doub N N 263 TRP C OXT sing N N 264 TRP CB CG sing N N 265 TRP CB HB2 sing N N 266 TRP CB HB3 sing N N 267 TRP CG CD1 doub Y N 268 TRP CG CD2 sing Y N 269 TRP CD1 NE1 sing Y N 270 TRP CD1 HD1 sing N N 271 TRP CD2 CE2 doub Y N 272 TRP CD2 CE3 sing Y N 273 TRP NE1 CE2 sing Y N 274 TRP NE1 HE1 sing N N 275 TRP CE2 CZ2 sing Y N 276 TRP CE3 CZ3 doub Y N 277 TRP CE3 HE3 sing N N 278 TRP CZ2 CH2 doub Y N 279 TRP CZ2 HZ2 sing N N 280 TRP CZ3 CH2 sing Y N 281 TRP CZ3 HZ3 sing N N 282 TRP CH2 HH2 sing N N 283 TRP OXT HXT sing N N 284 VAL N CA sing N N 285 VAL N H sing N N 286 VAL N H2 sing N N 287 VAL CA C sing N N 288 VAL CA CB sing N N 289 VAL CA HA sing N N 290 VAL C O doub N N 291 VAL C OXT sing N N 292 VAL CB CG1 sing N N 293 VAL CB CG2 sing N N 294 VAL CB HB sing N N 295 VAL CG1 HG11 sing N N 296 VAL CG1 HG12 sing N N 297 VAL CG1 HG13 sing N N 298 VAL CG2 HG21 sing N N 299 VAL CG2 HG22 sing N N 300 VAL CG2 HG23 sing N N 301 VAL OXT HXT sing N N 302 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9J5H _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #