data_9J9P # _entry.id 9J9P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9J9P pdb_00009j9p 10.2210/pdb9j9p/pdb WWPDB D_1300050712 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-07-02 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9J9P _pdbx_database_status.recvd_initial_deposition_date 2024-08-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email woonjusong@snu.ac.kr _pdbx_contact_author.name_first 'Woon Ju' _pdbx_contact_author.name_last Song _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0434-2684 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jeong, W.J.' 1 ? 'Song, W.J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Metal-Installer: A protein designer tool to create metal-binding sites' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jeong, W.J.' 1 ? primary 'Song, W.J.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Outer membrane porin F' 37140.230 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Outer membrane protein 1A,Outer membrane protein B,Outer membrane protein F,Outer membrane protein IA,Porin OmpF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGHWEYNFQGNNSEGADAQTGNK TRHAHAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGK NERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPI TNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDS DNKLGVGSDDTVAVGIVYQF ; _entity_poly.pdbx_seq_one_letter_code_can ;AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGHWEYNFQGNNSEGADAQTGNK TRHAHAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGK NERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPI TNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDS DNKLGVGSDDTVAVGIVYQF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 ILE n 1 4 TYR n 1 5 ASN n 1 6 LYS n 1 7 ASP n 1 8 GLY n 1 9 ASN n 1 10 LYS n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 TYR n 1 15 GLY n 1 16 LYS n 1 17 ALA n 1 18 VAL n 1 19 GLY n 1 20 LEU n 1 21 HIS n 1 22 TYR n 1 23 PHE n 1 24 SER n 1 25 LYS n 1 26 GLY n 1 27 ASN n 1 28 GLY n 1 29 GLU n 1 30 ASN n 1 31 SER n 1 32 TYR n 1 33 GLY n 1 34 GLY n 1 35 ASN n 1 36 GLY n 1 37 ASP n 1 38 MET n 1 39 THR n 1 40 TYR n 1 41 ALA n 1 42 ARG n 1 43 LEU n 1 44 GLY n 1 45 PHE n 1 46 LYS n 1 47 GLY n 1 48 GLU n 1 49 THR n 1 50 GLN n 1 51 ILE n 1 52 ASN n 1 53 SER n 1 54 ASP n 1 55 LEU n 1 56 THR n 1 57 GLY n 1 58 TYR n 1 59 GLY n 1 60 HIS n 1 61 TRP n 1 62 GLU n 1 63 TYR n 1 64 ASN n 1 65 PHE n 1 66 GLN n 1 67 GLY n 1 68 ASN n 1 69 ASN n 1 70 SER n 1 71 GLU n 1 72 GLY n 1 73 ALA n 1 74 ASP n 1 75 ALA n 1 76 GLN n 1 77 THR n 1 78 GLY n 1 79 ASN n 1 80 LYS n 1 81 THR n 1 82 ARG n 1 83 HIS n 1 84 ALA n 1 85 HIS n 1 86 ALA n 1 87 GLY n 1 88 LEU n 1 89 LYS n 1 90 TYR n 1 91 ALA n 1 92 ASP n 1 93 VAL n 1 94 GLY n 1 95 SER n 1 96 PHE n 1 97 ASP n 1 98 TYR n 1 99 GLY n 1 100 ARG n 1 101 ASN n 1 102 TYR n 1 103 GLY n 1 104 VAL n 1 105 VAL n 1 106 TYR n 1 107 ASP n 1 108 ALA n 1 109 LEU n 1 110 GLY n 1 111 TYR n 1 112 THR n 1 113 ASP n 1 114 MET n 1 115 LEU n 1 116 PRO n 1 117 GLU n 1 118 PHE n 1 119 GLY n 1 120 GLY n 1 121 ASP n 1 122 THR n 1 123 ALA n 1 124 TYR n 1 125 SER n 1 126 ASP n 1 127 ASP n 1 128 PHE n 1 129 PHE n 1 130 VAL n 1 131 GLY n 1 132 ARG n 1 133 VAL n 1 134 GLY n 1 135 GLY n 1 136 VAL n 1 137 ALA n 1 138 THR n 1 139 TYR n 1 140 ARG n 1 141 ASN n 1 142 SER n 1 143 ASN n 1 144 PHE n 1 145 PHE n 1 146 GLY n 1 147 LEU n 1 148 VAL n 1 149 ASP n 1 150 GLY n 1 151 LEU n 1 152 ASN n 1 153 PHE n 1 154 ALA n 1 155 VAL n 1 156 GLN n 1 157 TYR n 1 158 LEU n 1 159 GLY n 1 160 LYS n 1 161 ASN n 1 162 GLU n 1 163 ARG n 1 164 ASP n 1 165 THR n 1 166 ALA n 1 167 ARG n 1 168 ARG n 1 169 SER n 1 170 ASN n 1 171 GLY n 1 172 ASP n 1 173 GLY n 1 174 VAL n 1 175 GLY n 1 176 GLY n 1 177 SER n 1 178 ILE n 1 179 SER n 1 180 TYR n 1 181 GLU n 1 182 TYR n 1 183 GLU n 1 184 GLY n 1 185 PHE n 1 186 GLY n 1 187 ILE n 1 188 VAL n 1 189 GLY n 1 190 ALA n 1 191 TYR n 1 192 GLY n 1 193 ALA n 1 194 ALA n 1 195 ASP n 1 196 ARG n 1 197 THR n 1 198 ASN n 1 199 LEU n 1 200 GLN n 1 201 GLU n 1 202 ALA n 1 203 GLN n 1 204 PRO n 1 205 LEU n 1 206 GLY n 1 207 ASN n 1 208 GLY n 1 209 LYS n 1 210 LYS n 1 211 ALA n 1 212 GLU n 1 213 GLN n 1 214 TRP n 1 215 ALA n 1 216 THR n 1 217 GLY n 1 218 LEU n 1 219 LYS n 1 220 TYR n 1 221 ASP n 1 222 ALA n 1 223 ASN n 1 224 ASN n 1 225 ILE n 1 226 TYR n 1 227 LEU n 1 228 ALA n 1 229 ALA n 1 230 ASN n 1 231 TYR n 1 232 GLY n 1 233 GLU n 1 234 THR n 1 235 ARG n 1 236 ASN n 1 237 ALA n 1 238 THR n 1 239 PRO n 1 240 ILE n 1 241 THR n 1 242 ASN n 1 243 LYS n 1 244 PHE n 1 245 THR n 1 246 ASN n 1 247 THR n 1 248 SER n 1 249 GLY n 1 250 PHE n 1 251 ALA n 1 252 ASN n 1 253 LYS n 1 254 THR n 1 255 GLN n 1 256 ASP n 1 257 VAL n 1 258 LEU n 1 259 LEU n 1 260 VAL n 1 261 ALA n 1 262 GLN n 1 263 TYR n 1 264 GLN n 1 265 PHE n 1 266 ASP n 1 267 PHE n 1 268 GLY n 1 269 LEU n 1 270 ARG n 1 271 PRO n 1 272 SER n 1 273 ILE n 1 274 ALA n 1 275 TYR n 1 276 THR n 1 277 LYS n 1 278 SER n 1 279 LYS n 1 280 ALA n 1 281 LYS n 1 282 ASP n 1 283 VAL n 1 284 GLU n 1 285 GLY n 1 286 ILE n 1 287 GLY n 1 288 ASP n 1 289 VAL n 1 290 ASP n 1 291 LEU n 1 292 VAL n 1 293 ASN n 1 294 TYR n 1 295 PHE n 1 296 GLU n 1 297 VAL n 1 298 GLY n 1 299 ALA n 1 300 THR n 1 301 TYR n 1 302 TYR n 1 303 PHE n 1 304 ASN n 1 305 LYS n 1 306 ASN n 1 307 MET n 1 308 SER n 1 309 THR n 1 310 TYR n 1 311 VAL n 1 312 ASP n 1 313 TYR n 1 314 ILE n 1 315 ILE n 1 316 ASN n 1 317 GLN n 1 318 ILE n 1 319 ASP n 1 320 SER n 1 321 ASP n 1 322 ASN n 1 323 LYS n 1 324 LEU n 1 325 GLY n 1 326 VAL n 1 327 GLY n 1 328 SER n 1 329 ASP n 1 330 ASP n 1 331 THR n 1 332 VAL n 1 333 ALA n 1 334 VAL n 1 335 GLY n 1 336 ILE n 1 337 VAL n 1 338 TYR n 1 339 GLN n 1 340 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 340 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ompF, cmlB, coa, cry, tolF, b0929, JW0912' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASN 27 27 ? ? ? A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 ARG 140 140 140 ARG ARG A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 ARG 168 168 168 ARG ARG A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ASN 170 170 170 ASN ASN A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 TYR 191 191 191 TYR TYR A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 ARG 196 196 196 ARG ARG A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 GLN 200 200 200 GLN GLN A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 ALA 202 202 202 ALA ALA A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 GLY 206 206 206 GLY GLY A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 GLN 213 213 213 GLN GLN A . n A 1 214 TRP 214 214 214 TRP TRP A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 THR 216 216 216 THR THR A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 TYR 220 220 220 TYR TYR A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 ALA 222 222 222 ALA ALA A . n A 1 223 ASN 223 223 223 ASN ASN A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 TYR 226 226 226 TYR TYR A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 ASN 230 230 230 ASN ASN A . n A 1 231 TYR 231 231 231 TYR TYR A . n A 1 232 GLY 232 232 232 GLY GLY A . n A 1 233 GLU 233 233 233 GLU GLU A . n A 1 234 THR 234 234 234 THR THR A . n A 1 235 ARG 235 235 235 ARG ARG A . n A 1 236 ASN 236 236 236 ASN ASN A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 THR 238 238 238 THR THR A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 ILE 240 240 240 ILE ILE A . n A 1 241 THR 241 241 241 THR THR A . n A 1 242 ASN 242 242 242 ASN ASN A . n A 1 243 LYS 243 243 243 LYS LYS A . n A 1 244 PHE 244 244 244 PHE PHE A . n A 1 245 THR 245 245 245 THR THR A . n A 1 246 ASN 246 246 246 ASN ASN A . n A 1 247 THR 247 247 247 THR THR A . n A 1 248 SER 248 248 248 SER SER A . n A 1 249 GLY 249 249 249 GLY GLY A . n A 1 250 PHE 250 250 250 PHE PHE A . n A 1 251 ALA 251 251 251 ALA ALA A . n A 1 252 ASN 252 252 252 ASN ASN A . n A 1 253 LYS 253 253 253 LYS LYS A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 GLN 255 255 255 GLN GLN A . n A 1 256 ASP 256 256 256 ASP ASP A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 LEU 259 259 259 LEU LEU A . n A 1 260 VAL 260 260 260 VAL VAL A . n A 1 261 ALA 261 261 261 ALA ALA A . n A 1 262 GLN 262 262 262 GLN GLN A . n A 1 263 TYR 263 263 263 TYR TYR A . n A 1 264 GLN 264 264 264 GLN GLN A . n A 1 265 PHE 265 265 265 PHE PHE A . n A 1 266 ASP 266 266 266 ASP ASP A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 ARG 270 270 270 ARG ARG A . n A 1 271 PRO 271 271 271 PRO PRO A . n A 1 272 SER 272 272 272 SER SER A . n A 1 273 ILE 273 273 273 ILE ILE A . n A 1 274 ALA 274 274 274 ALA ALA A . n A 1 275 TYR 275 275 275 TYR TYR A . n A 1 276 THR 276 276 276 THR THR A . n A 1 277 LYS 277 277 277 LYS LYS A . n A 1 278 SER 278 278 278 SER SER A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 LYS 281 281 281 LYS LYS A . n A 1 282 ASP 282 282 282 ASP ASP A . n A 1 283 VAL 283 283 283 VAL VAL A . n A 1 284 GLU 284 284 284 GLU GLU A . n A 1 285 GLY 285 285 285 GLY GLY A . n A 1 286 ILE 286 286 286 ILE ILE A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 ASP 288 288 288 ASP ASP A . n A 1 289 VAL 289 289 289 VAL VAL A . n A 1 290 ASP 290 290 290 ASP ASP A . n A 1 291 LEU 291 291 291 LEU LEU A . n A 1 292 VAL 292 292 292 VAL VAL A . n A 1 293 ASN 293 293 293 ASN ASN A . n A 1 294 TYR 294 294 294 TYR TYR A . n A 1 295 PHE 295 295 295 PHE PHE A . n A 1 296 GLU 296 296 296 GLU GLU A . n A 1 297 VAL 297 297 297 VAL VAL A . n A 1 298 GLY 298 298 298 GLY GLY A . n A 1 299 ALA 299 299 299 ALA ALA A . n A 1 300 THR 300 300 300 THR THR A . n A 1 301 TYR 301 301 301 TYR TYR A . n A 1 302 TYR 302 302 302 TYR TYR A . n A 1 303 PHE 303 303 303 PHE PHE A . n A 1 304 ASN 304 304 304 ASN ASN A . n A 1 305 LYS 305 305 305 LYS LYS A . n A 1 306 ASN 306 306 306 ASN ASN A . n A 1 307 MET 307 307 307 MET MET A . n A 1 308 SER 308 308 308 SER SER A . n A 1 309 THR 309 309 309 THR THR A . n A 1 310 TYR 310 310 310 TYR TYR A . n A 1 311 VAL 311 311 311 VAL VAL A . n A 1 312 ASP 312 312 312 ASP ASP A . n A 1 313 TYR 313 313 313 TYR TYR A . n A 1 314 ILE 314 314 314 ILE ILE A . n A 1 315 ILE 315 315 315 ILE ILE A . n A 1 316 ASN 316 316 316 ASN ASN A . n A 1 317 GLN 317 317 317 GLN GLN A . n A 1 318 ILE 318 318 318 ILE ILE A . n A 1 319 ASP 319 319 319 ASP ASP A . n A 1 320 SER 320 320 320 SER SER A . n A 1 321 ASP 321 321 321 ASP ASP A . n A 1 322 ASN 322 322 322 ASN ASN A . n A 1 323 LYS 323 323 323 LYS LYS A . n A 1 324 LEU 324 324 324 LEU LEU A . n A 1 325 GLY 325 325 325 GLY GLY A . n A 1 326 VAL 326 326 326 VAL VAL A . n A 1 327 GLY 327 327 327 GLY GLY A . n A 1 328 SER 328 328 328 SER SER A . n A 1 329 ASP 329 329 329 ASP ASP A . n A 1 330 ASP 330 330 330 ASP ASP A . n A 1 331 THR 331 331 331 THR THR A . n A 1 332 VAL 332 332 332 VAL VAL A . n A 1 333 ALA 333 333 333 ALA ALA A . n A 1 334 VAL 334 334 334 VAL VAL A . n A 1 335 GLY 335 335 335 GLY GLY A . n A 1 336 ILE 336 336 336 ILE ILE A . n A 1 337 VAL 337 337 337 VAL VAL A . n A 1 338 TYR 338 338 338 TYR TYR A . n A 1 339 GLN 339 339 339 GLN GLN A . n A 1 340 PHE 340 340 340 PHE PHE A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 1 ZN ZN A . C 3 HOH 1 501 1 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 25 ? CG ? A LYS 25 CG 2 1 Y 1 A LYS 25 ? CD ? A LYS 25 CD 3 1 Y 1 A LYS 25 ? CE ? A LYS 25 CE 4 1 Y 1 A LYS 25 ? NZ ? A LYS 25 NZ 5 1 Y 1 A GLU 29 ? CG ? A GLU 29 CG 6 1 Y 1 A GLU 29 ? CD ? A GLU 29 CD 7 1 Y 1 A GLU 29 ? OE1 ? A GLU 29 OE1 8 1 Y 1 A GLU 29 ? OE2 ? A GLU 29 OE2 9 1 Y 1 A LYS 80 ? CG ? A LYS 80 CG 10 1 Y 1 A LYS 80 ? CD ? A LYS 80 CD 11 1 Y 1 A LYS 80 ? CE ? A LYS 80 CE 12 1 Y 1 A LYS 80 ? NZ ? A LYS 80 NZ 13 1 Y 1 A LYS 209 ? CG ? A LYS 209 CG 14 1 Y 1 A LYS 209 ? CD ? A LYS 209 CD 15 1 Y 1 A LYS 209 ? CE ? A LYS 209 CE 16 1 Y 1 A LYS 209 ? NZ ? A LYS 209 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0430 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9J9P _cell.details ? _cell.formula_units_Z ? _cell.length_a 136.572 _cell.length_a_esd ? _cell.length_b 136.572 _cell.length_b_esd ? _cell.length_c 49.683 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9J9P _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9J9P _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.60 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 65.85 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.3 M MgCl2, MOPS pH 8.0, and 28 % w/v PEG 2000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-02-29 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979340 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979340 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9J9P _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.47 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6986 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 2.93 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.31 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.937 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.34 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 3.47 3.68 ? ? ? ? ? ? 491 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.836 ? ? 1 1 0.836 ? ? ? ? 1.563 ? ? ? ? ? ? ? ? ? 3.68 3.93 ? ? ? ? ? ? 497 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.696 ? ? 2 1 0.614 ? ? ? ? 1.097 ? ? ? ? ? ? ? ? ? 3.93 4.24 ? ? ? ? ? ? 467 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.91 ? ? 3 1 0.682 ? ? ? ? 0.692 ? ? ? ? ? ? ? ? ? 4.24 4.64 ? ? ? ? ? ? 444 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.516 ? ? 4 1 0.87 ? ? ? ? 0.393 ? ? ? ? ? ? ? ? ? 4.64 5.17 ? ? ? ? ? ? 394 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.364 ? ? 5 1 0.927 ? ? ? ? 0.279 ? ? ? ? ? ? ? ? ? 5.17 5.94 ? ? ? ? ? ? 345 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.431 ? ? 6 1 0.909 ? ? ? ? 0.33 ? ? ? ? ? ? ? ? ? 5.94 7.2 ? ? ? ? ? ? 275 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.332 ? ? 7 1 0.899 ? ? ? ? 0.253 ? ? ? ? ? ? ? ? ? 7.20 9.89 ? ? ? ? ? ? 212 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.146 ? ? 8 1 0.97 ? ? ? ? 0.114 ? ? ? ? ? ? ? ? ? 9.89 30 ? ? ? ? ? ? 124 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.057 ? ? 9 1 0.997 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -3.64 _refine.aniso_B[1][2] -1.82 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -3.64 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 11.82 _refine.B_iso_max ? _refine.B_iso_mean 82.201 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.925 _refine.correlation_coeff_Fo_to_Fc_free 0.892 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9J9P _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.47 _refine.ls_d_res_low 29.57 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6635 _refine.ls_number_reflns_R_free 350 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.60 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.21673 _refine.ls_R_factor_R_free 0.26588 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.21417 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.592 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 34.668 _refine.overall_SU_ML 0.507 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 3.47 _refine_hist.d_res_low 29.57 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 2607 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2605 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 0.011 2662 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 2330 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 0.918 1.790 3605 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.337 1.752 5324 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.534 5.000 337 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 3.339 5.000 11 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 14.376 10.000 383 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.039 0.200 366 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 3308 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 696 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 5.084 8.184 1354 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.084 8.184 1354 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 8.261 14.699 1689 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 8.260 14.699 1690 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.969 8.545 1308 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.967 8.544 1309 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 8.254 15.557 1917 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 13.553 100.09 10963 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 13.553 100.09 10964 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.474 _refine_ls_shell.d_res_low 3.563 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 24 _refine_ls_shell.number_reflns_R_work 446 _refine_ls_shell.percent_reflns_obs 90.21 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.326 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.335 # _struct.entry_id 9J9P _struct.title 'artificial mononuclear Zn-bound metalloprotein 3 (M3:Zn)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9J9P _struct_keywords.text 'Membrane protein, artificial metalloprotein' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OMPF_ECOLI _struct_ref.pdbx_db_accession P02931 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNK TRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGK NERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPI TNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDS DNKLGVGSDDTVAVGIVYQF ; _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9J9P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 340 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02931 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 362 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 340 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9J9P HIS A 60 ? UNP P02931 GLN 82 conflict 60 1 1 9J9P HIS A 83 ? UNP P02931 LEU 105 conflict 83 2 1 9J9P HIS A 85 ? UNP P02931 PHE 107 conflict 85 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9080 ? 1 MORE -152 ? 1 'SSA (A^2)' 39690 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_565 -y,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 -68.2860000000 0.8660254038 -0.5000000000 0.0000000000 118.2748214456 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_455 -x+y-1,-x,z -0.5000000000 0.8660254038 0.0000000000 -136.5720000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 105 ? GLY A 110 ? VAL A 105 GLY A 110 1 ? 6 HELX_P HELX_P2 AA2 ASN A 143 ? LEU A 147 ? ASN A 143 LEU A 147 5 ? 5 HELX_P HELX_P3 AA3 THR A 197 ? ALA A 202 ? THR A 197 ALA A 202 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 60 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 60 A ZN 401 1_555 ? ? ? ? ? ? ? 2.168 ? ? metalc2 metalc ? ? A HIS 83 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 83 A ZN 401 1_555 ? ? ? ? ? ? ? 2.563 ? ? metalc3 metalc ? ? A HIS 85 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 85 A ZN 401 1_555 ? ? ? ? ? ? ? 2.097 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 60 ? A HIS 60 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 83 ? A HIS 83 ? 1_555 83.8 ? 2 ND1 ? A HIS 60 ? A HIS 60 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 85 ? A HIS 85 ? 1_555 97.1 ? 3 ND1 ? A HIS 83 ? A HIS 83 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 85 ? A HIS 85 ? 1_555 82.0 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 19 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel AA1 12 13 ? anti-parallel AA1 13 14 ? anti-parallel AA1 14 15 ? anti-parallel AA1 15 16 ? anti-parallel AA1 16 17 ? anti-parallel AA1 17 18 ? anti-parallel AA1 18 19 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 2 ? LYS A 6 ? GLU A 2 LYS A 6 AA1 2 GLY A 36 ? ASP A 37 ? GLY A 36 ASP A 37 AA1 3 TYR A 40 ? GLN A 50 ? TYR A 40 GLN A 50 AA1 4 LEU A 55 ? GLN A 66 ? LEU A 55 GLN A 66 AA1 5 LYS A 80 ? TYR A 90 ? LYS A 80 TYR A 90 AA1 6 GLY A 94 ? TYR A 102 ? GLY A 94 TYR A 102 AA1 7 ARG A 132 ? ASN A 141 ? ARG A 132 ASN A 141 AA1 8 LEU A 151 ? LEU A 158 ? LEU A 151 LEU A 158 AA1 9 GLY A 173 ? TYR A 180 ? GLY A 173 TYR A 180 AA1 10 PHE A 185 ? ALA A 194 ? PHE A 185 ALA A 194 AA1 11 ALA A 211 ? ALA A 222 ? ALA A 211 ALA A 222 AA1 12 ILE A 225 ? ARG A 235 ? ILE A 225 ARG A 235 AA1 13 LYS A 253 ? TYR A 263 ? LYS A 253 TYR A 263 AA1 14 LEU A 269 ? VAL A 283 ? LEU A 269 VAL A 283 AA1 15 GLY A 287 ? TYR A 302 ? GLY A 287 TYR A 302 AA1 16 MET A 307 ? ASN A 316 ? MET A 307 ASN A 316 AA1 17 THR A 331 ? PHE A 340 ? THR A 331 PHE A 340 AA1 18 ASN A 9 ? PHE A 23 ? ASN A 9 PHE A 23 AA1 19 GLY A 36 ? ASP A 37 ? GLY A 36 ASP A 37 AA2 1 THR A 238 ? PRO A 239 ? THR A 238 PRO A 239 AA2 2 PHE A 250 ? ALA A 251 ? PHE A 250 ALA A 251 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 3 4 N ALA A 41 ? N ALA A 41 O PHE A 65 ? O PHE A 65 AA1 4 5 N THR A 56 ? N THR A 56 O LYS A 89 ? O LYS A 89 AA1 5 6 N ALA A 84 ? N ALA A 84 O ARG A 100 ? O ARG A 100 AA1 6 7 N ASN A 101 ? N ASN A 101 O VAL A 133 ? O VAL A 133 AA1 7 8 N TYR A 139 ? N TYR A 139 O VAL A 155 ? O VAL A 155 AA1 8 9 N GLN A 156 ? N GLN A 156 O GLY A 175 ? O GLY A 175 AA1 9 10 N GLY A 176 ? N GLY A 176 O TYR A 191 ? O TYR A 191 AA1 10 11 N ALA A 194 ? N ALA A 194 O ALA A 211 ? O ALA A 211 AA1 11 12 N THR A 216 ? N THR A 216 O TYR A 231 ? O TYR A 231 AA1 12 13 N TYR A 226 ? N TYR A 226 O GLN A 262 ? O GLN A 262 AA1 13 14 N ALA A 261 ? N ALA A 261 O ILE A 273 ? O ILE A 273 AA1 14 15 N ALA A 280 ? N ALA A 280 O VAL A 289 ? O VAL A 289 AA1 15 16 N PHE A 295 ? N PHE A 295 O ILE A 315 ? O ILE A 315 AA1 16 17 N SER A 308 ? N SER A 308 O VAL A 337 ? O VAL A 337 AA1 17 18 O VAL A 332 ? O VAL A 332 N PHE A 23 ? N PHE A 23 AA1 18 19 N TYR A 22 ? N TYR A 22 O GLY A 36 ? O GLY A 36 AA2 1 2 N THR A 238 ? N THR A 238 O ALA A 251 ? O ALA A 251 # _pdbx_entry_details.entry_id 9J9P _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 5 ? ? -152.53 63.39 2 1 ASN A 52 ? ? -152.74 -158.83 3 1 ALA A 84 ? ? -162.48 97.42 4 1 ALA A 91 ? ? 48.69 -132.12 5 1 PHE A 118 ? ? -102.29 -152.68 6 1 PHE A 128 ? ? 62.48 -107.52 7 1 PHE A 144 ? ? 39.44 68.53 8 1 LYS A 210 ? ? -176.27 133.31 9 1 SER A 248 ? ? -87.42 -159.74 10 1 ILE A 286 ? ? -134.15 -40.54 11 1 ASN A 304 ? ? -149.16 -158.50 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id ASN _pdbx_unobs_or_zero_occ_residues.auth_seq_id 27 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id ASN _pdbx_unobs_or_zero_occ_residues.label_seq_id 27 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 ZN ZN ZN N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'Other private' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number 2019R1C1C1003863 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2zfg _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9J9P _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.007322 _atom_sites.fract_transf_matrix[1][2] 0.004227 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008455 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020128 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ #