data_9JBD # _entry.id 9JBD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9JBD pdb_00009jbd 10.2210/pdb9jbd/pdb WWPDB D_1300050425 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-08-27 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9JBD _pdbx_database_status.recvd_initial_deposition_date 2024-08-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email hyojec@cbnu.ac.kr _pdbx_contact_author.name_first 'Hyo Je' _pdbx_contact_author.name_last Cho _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6822-5685 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cho, H.J.' 1 0000-0001-6822-5685 'Yang, S.H.' 2 0009-0007-7461-8179 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_id_ASTM BBRCA9 _citation.journal_id_CSD 0146 _citation.journal_id_ISSN 1090-2104 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 768 _citation.language ? _citation.page_first 151945 _citation.page_last 151945 _citation.title ;Structural comparison of three MoaE proteins in Mycobacterium tuberculosis: Insights into molybdopterin synthase assembly and specificity. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2025.151945 _citation.pdbx_database_id_PubMed 40345009 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cho, H.J.' 1 ? primary 'Yang, S.H.' 2 ? primary 'Lee, H.S.' 3 ? primary 'Kang, B.S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Probable MoaD-MoaE fusion protein MoaX' 15903.997 1 ? ? ? 'MoaE like domain in MoaX protein' 2 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 4 water nat water 18.015 28 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'molybdopterin synthase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRNNNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQAD GVRVAVAHRTGELRIGDAAVVIGASAPHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP ; _entity_poly.pdbx_seq_one_letter_code_can ;IPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRNNNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQAD GVRVAVAHRTGELRIGDAAVVIGASAPHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 PRO n 1 3 GLN n 1 4 VAL n 1 5 ALA n 1 6 GLY n 1 7 GLY n 1 8 SER n 1 9 ASP n 1 10 VAL n 1 11 TYR n 1 12 CYS n 1 13 ARG n 1 14 LEU n 1 15 THR n 1 16 ASP n 1 17 GLU n 1 18 PRO n 1 19 LEU n 1 20 SER n 1 21 VAL n 1 22 ASP n 1 23 GLU n 1 24 VAL n 1 25 LEU n 1 26 ASN n 1 27 ALA n 1 28 ILE n 1 29 SER n 1 30 GLY n 1 31 PRO n 1 32 SER n 1 33 GLN n 1 34 GLY n 1 35 GLY n 1 36 ALA n 1 37 VAL n 1 38 ILE n 1 39 PHE n 1 40 VAL n 1 41 GLY n 1 42 THR n 1 43 VAL n 1 44 ARG n 1 45 ASN n 1 46 ASN n 1 47 ASN n 1 48 ASN n 1 49 GLY n 1 50 HIS n 1 51 GLU n 1 52 VAL n 1 53 THR n 1 54 LYS n 1 55 LEU n 1 56 TYR n 1 57 TYR n 1 58 GLU n 1 59 ALA n 1 60 TYR n 1 61 PRO n 1 62 ALA n 1 63 MET n 1 64 VAL n 1 65 HIS n 1 66 ARG n 1 67 THR n 1 68 LEU n 1 69 MET n 1 70 ASP n 1 71 ILE n 1 72 ILE n 1 73 GLU n 1 74 GLU n 1 75 CYS n 1 76 GLU n 1 77 ARG n 1 78 GLN n 1 79 ALA n 1 80 ASP n 1 81 GLY n 1 82 VAL n 1 83 ARG n 1 84 VAL n 1 85 ALA n 1 86 VAL n 1 87 ALA n 1 88 HIS n 1 89 ARG n 1 90 THR n 1 91 GLY n 1 92 GLU n 1 93 LEU n 1 94 ARG n 1 95 ILE n 1 96 GLY n 1 97 ASP n 1 98 ALA n 1 99 ALA n 1 100 VAL n 1 101 VAL n 1 102 ILE n 1 103 GLY n 1 104 ALA n 1 105 SER n 1 106 ALA n 1 107 PRO n 1 108 HIS n 1 109 ARG n 1 110 ALA n 1 111 ALA n 1 112 ALA n 1 113 PHE n 1 114 ASP n 1 115 ALA n 1 116 ALA n 1 117 ARG n 1 118 MET n 1 119 CYS n 1 120 ILE n 1 121 GLU n 1 122 ARG n 1 123 LEU n 1 124 LYS n 1 125 GLN n 1 126 ASP n 1 127 VAL n 1 128 PRO n 1 129 ILE n 1 130 TRP n 1 131 LYS n 1 132 LYS n 1 133 GLU n 1 134 PHE n 1 135 ALA n 1 136 LEU n 1 137 ASP n 1 138 GLY n 1 139 VAL n 1 140 GLU n 1 141 TRP n 1 142 VAL n 1 143 ALA n 1 144 ASN n 1 145 ARG n 1 146 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 146 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'moaX, Rv3323c' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MES non-polymer . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S' 195.237 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 76 ? ? ? A . n A 1 2 PRO 2 77 ? ? ? A . n A 1 3 GLN 3 78 ? ? ? A . n A 1 4 VAL 4 79 ? ? ? A . n A 1 5 ALA 5 80 ? ? ? A . n A 1 6 GLY 6 81 ? ? ? A . n A 1 7 GLY 7 82 ? ? ? A . n A 1 8 SER 8 83 83 SER SER A . n A 1 9 ASP 9 84 84 ASP ASP A . n A 1 10 VAL 10 85 85 VAL VAL A . n A 1 11 TYR 11 86 86 TYR TYR A . n A 1 12 CYS 12 87 87 CYS CYS A . n A 1 13 ARG 13 88 88 ARG ARG A . n A 1 14 LEU 14 89 89 LEU LEU A . n A 1 15 THR 15 90 90 THR THR A . n A 1 16 ASP 16 91 91 ASP ASP A . n A 1 17 GLU 17 92 92 GLU GLU A . n A 1 18 PRO 18 93 93 PRO PRO A . n A 1 19 LEU 19 94 94 LEU LEU A . n A 1 20 SER 20 95 95 SER SER A . n A 1 21 VAL 21 96 96 VAL VAL A . n A 1 22 ASP 22 97 97 ASP ASP A . n A 1 23 GLU 23 98 98 GLU GLU A . n A 1 24 VAL 24 99 99 VAL VAL A . n A 1 25 LEU 25 100 100 LEU LEU A . n A 1 26 ASN 26 101 101 ASN ASN A . n A 1 27 ALA 27 102 102 ALA ALA A . n A 1 28 ILE 28 103 103 ILE ILE A . n A 1 29 SER 29 104 104 SER SER A . n A 1 30 GLY 30 105 105 GLY GLY A . n A 1 31 PRO 31 106 106 PRO PRO A . n A 1 32 SER 32 107 107 SER SER A . n A 1 33 GLN 33 108 108 GLN GLN A . n A 1 34 GLY 34 109 109 GLY GLY A . n A 1 35 GLY 35 110 110 GLY GLY A . n A 1 36 ALA 36 111 111 ALA ALA A . n A 1 37 VAL 37 112 112 VAL VAL A . n A 1 38 ILE 38 113 113 ILE ILE A . n A 1 39 PHE 39 114 114 PHE PHE A . n A 1 40 VAL 40 115 115 VAL VAL A . n A 1 41 GLY 41 116 116 GLY GLY A . n A 1 42 THR 42 117 117 THR THR A . n A 1 43 VAL 43 118 118 VAL VAL A . n A 1 44 ARG 44 119 119 ARG ARG A . n A 1 45 ASN 45 120 120 ASN ASN A . n A 1 46 ASN 46 121 121 ASN ASN A . n A 1 47 ASN 47 122 122 ASN ASN A . n A 1 48 ASN 48 123 123 ASN ASN A . n A 1 49 GLY 49 124 124 GLY GLY A . n A 1 50 HIS 50 125 125 HIS HIS A . n A 1 51 GLU 51 126 126 GLU GLU A . n A 1 52 VAL 52 127 127 VAL VAL A . n A 1 53 THR 53 128 128 THR THR A . n A 1 54 LYS 54 129 129 LYS LYS A . n A 1 55 LEU 55 130 130 LEU LEU A . n A 1 56 TYR 56 131 131 TYR TYR A . n A 1 57 TYR 57 132 132 TYR TYR A . n A 1 58 GLU 58 133 133 GLU GLU A . n A 1 59 ALA 59 134 134 ALA ALA A . n A 1 60 TYR 60 135 135 TYR TYR A . n A 1 61 PRO 61 136 136 PRO PRO A . n A 1 62 ALA 62 137 137 ALA ALA A . n A 1 63 MET 63 138 138 MET MET A . n A 1 64 VAL 64 139 139 VAL VAL A . n A 1 65 HIS 65 140 140 HIS HIS A . n A 1 66 ARG 66 141 141 ARG ARG A . n A 1 67 THR 67 142 142 THR THR A . n A 1 68 LEU 68 143 143 LEU LEU A . n A 1 69 MET 69 144 144 MET MET A . n A 1 70 ASP 70 145 145 ASP ASP A . n A 1 71 ILE 71 146 146 ILE ILE A . n A 1 72 ILE 72 147 147 ILE ILE A . n A 1 73 GLU 73 148 148 GLU GLU A . n A 1 74 GLU 74 149 149 GLU GLU A . n A 1 75 CYS 75 150 150 CYS CYS A . n A 1 76 GLU 76 151 151 GLU GLU A . n A 1 77 ARG 77 152 152 ARG ARG A . n A 1 78 GLN 78 153 153 GLN GLN A . n A 1 79 ALA 79 154 154 ALA ALA A . n A 1 80 ASP 80 155 155 ASP ASP A . n A 1 81 GLY 81 156 156 GLY GLY A . n A 1 82 VAL 82 157 157 VAL VAL A . n A 1 83 ARG 83 158 158 ARG ARG A . n A 1 84 VAL 84 159 159 VAL VAL A . n A 1 85 ALA 85 160 160 ALA ALA A . n A 1 86 VAL 86 161 161 VAL VAL A . n A 1 87 ALA 87 162 162 ALA ALA A . n A 1 88 HIS 88 163 163 HIS HIS A . n A 1 89 ARG 89 164 164 ARG ARG A . n A 1 90 THR 90 165 165 THR THR A . n A 1 91 GLY 91 166 166 GLY GLY A . n A 1 92 GLU 92 167 167 GLU GLU A . n A 1 93 LEU 93 168 168 LEU LEU A . n A 1 94 ARG 94 169 169 ARG ARG A . n A 1 95 ILE 95 170 170 ILE ILE A . n A 1 96 GLY 96 171 171 GLY GLY A . n A 1 97 ASP 97 172 172 ASP ASP A . n A 1 98 ALA 98 173 173 ALA ALA A . n A 1 99 ALA 99 174 174 ALA ALA A . n A 1 100 VAL 100 175 175 VAL VAL A . n A 1 101 VAL 101 176 176 VAL VAL A . n A 1 102 ILE 102 177 177 ILE ILE A . n A 1 103 GLY 103 178 178 GLY GLY A . n A 1 104 ALA 104 179 179 ALA ALA A . n A 1 105 SER 105 180 180 SER SER A . n A 1 106 ALA 106 181 181 ALA ALA A . n A 1 107 PRO 107 182 182 PRO PRO A . n A 1 108 HIS 108 183 183 HIS HIS A . n A 1 109 ARG 109 184 184 ARG ARG A . n A 1 110 ALA 110 185 185 ALA ALA A . n A 1 111 ALA 111 186 186 ALA ALA A . n A 1 112 ALA 112 187 187 ALA ALA A . n A 1 113 PHE 113 188 188 PHE PHE A . n A 1 114 ASP 114 189 189 ASP ASP A . n A 1 115 ALA 115 190 190 ALA ALA A . n A 1 116 ALA 116 191 191 ALA ALA A . n A 1 117 ARG 117 192 192 ARG ARG A . n A 1 118 MET 118 193 193 MET MET A . n A 1 119 CYS 119 194 194 CYS CYS A . n A 1 120 ILE 120 195 195 ILE ILE A . n A 1 121 GLU 121 196 196 GLU GLU A . n A 1 122 ARG 122 197 197 ARG ARG A . n A 1 123 LEU 123 198 198 LEU LEU A . n A 1 124 LYS 124 199 199 LYS LYS A . n A 1 125 GLN 125 200 200 GLN GLN A . n A 1 126 ASP 126 201 201 ASP ASP A . n A 1 127 VAL 127 202 202 VAL VAL A . n A 1 128 PRO 128 203 203 PRO PRO A . n A 1 129 ILE 129 204 204 ILE ILE A . n A 1 130 TRP 130 205 205 TRP TRP A . n A 1 131 LYS 131 206 206 LYS LYS A . n A 1 132 LYS 132 207 207 LYS LYS A . n A 1 133 GLU 133 208 208 GLU GLU A . n A 1 134 PHE 134 209 209 PHE PHE A . n A 1 135 ALA 135 210 210 ALA ALA A . n A 1 136 LEU 136 211 211 LEU LEU A . n A 1 137 ASP 137 212 212 ASP ASP A . n A 1 138 GLY 138 213 213 GLY GLY A . n A 1 139 VAL 139 214 214 VAL VAL A . n A 1 140 GLU 140 215 215 GLU GLU A . n A 1 141 TRP 141 216 216 TRP TRP A . n A 1 142 VAL 142 217 217 VAL VAL A . n A 1 143 ALA 143 218 218 ALA ALA A . n A 1 144 ASN 144 219 219 ASN ASN A . n A 1 145 ARG 145 220 220 ARG ARG A . n A 1 146 PRO 146 221 221 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MES 1 301 1 MES MES A . C 3 GOL 1 302 1 GOL GOL A . D 3 GOL 1 303 2 GOL GOL A . E 4 HOH 1 401 27 HOH HOH A . E 4 HOH 2 402 26 HOH HOH A . E 4 HOH 3 403 17 HOH HOH A . E 4 HOH 4 404 3 HOH HOH A . E 4 HOH 5 405 15 HOH HOH A . E 4 HOH 6 406 5 HOH HOH A . E 4 HOH 7 407 4 HOH HOH A . E 4 HOH 8 408 10 HOH HOH A . E 4 HOH 9 409 11 HOH HOH A . E 4 HOH 10 410 20 HOH HOH A . E 4 HOH 11 411 16 HOH HOH A . E 4 HOH 12 412 7 HOH HOH A . E 4 HOH 13 413 2 HOH HOH A . E 4 HOH 14 414 12 HOH HOH A . E 4 HOH 15 415 22 HOH HOH A . E 4 HOH 16 416 6 HOH HOH A . E 4 HOH 17 417 19 HOH HOH A . E 4 HOH 18 418 9 HOH HOH A . E 4 HOH 19 419 18 HOH HOH A . E 4 HOH 20 420 25 HOH HOH A . E 4 HOH 21 421 28 HOH HOH A . E 4 HOH 22 422 1 HOH HOH A . E 4 HOH 23 423 21 HOH HOH A . E 4 HOH 24 424 13 HOH HOH A . E 4 HOH 25 425 24 HOH HOH A . E 4 HOH 26 426 14 HOH HOH A . E 4 HOH 27 427 23 HOH HOH A . E 4 HOH 28 428 8 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9JBD _cell.details ? _cell.formula_units_Z ? _cell.length_a 98.015 _cell.length_a_esd ? _cell.length_b 98.015 _cell.length_b_esd ? _cell.length_c 102.940 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9JBD _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9JBD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 72.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '18% PEG 400, 0.04M Li2SO4, 0.1M MES pH 6.5' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-06-18 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97933 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 7A (6B, 6C1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97933 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '7A (6B, 6C1)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9JBD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.40 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11920 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.893 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.071 _reflns.pdbx_Rpim_I_all 0.016 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 223537 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.069 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.40 2.44 ? ? ? ? ? ? 574 ? ? ? ? ? ? ? ? ? ? ? 18.3 0.469 ? ? 0.970 0.224 ? 1 1 0.965 0.991 ? 100.0 ? 0.943 ? ? ? ? ? ? ? ? ? 2.44 2.49 ? ? ? ? ? ? 574 ? ? ? ? ? ? ? ? ? ? ? 18.1 0.470 ? ? 0.764 0.178 ? 2 1 0.971 0.993 ? 99.7 ? 0.743 ? ? ? ? ? ? ? ? ? 2.49 2.53 ? ? ? ? ? ? 585 ? ? ? ? ? ? ? ? ? ? ? 18.4 0.478 ? ? 0.661 0.153 ? 3 1 0.979 0.995 ? 99.7 ? 0.642 ? ? ? ? ? ? ? ? ? 2.53 2.59 ? ? ? ? ? ? 579 ? ? ? ? ? ? ? ? ? ? ? 19.8 0.481 ? ? 0.567 0.126 ? 4 1 0.987 0.997 ? 99.8 ? 0.553 ? ? ? ? ? ? ? ? ? 2.59 2.64 ? ? ? ? ? ? 575 ? ? ? ? ? ? ? ? ? ? ? 20.2 0.484 ? ? 0.522 0.114 ? 5 1 0.987 0.997 ? 99.8 ? 0.509 ? ? ? ? ? ? ? ? ? 2.64 2.70 ? ? ? ? ? ? 574 ? ? ? ? ? ? ? ? ? ? ? 19.8 0.511 ? ? 0.382 0.085 ? 6 1 0.995 0.999 ? 100.0 ? 0.372 ? ? ? ? ? ? ? ? ? 2.70 2.77 ? ? ? ? ? ? 573 ? ? ? ? ? ? ? ? ? ? ? 19.5 0.540 ? ? 0.296 0.067 ? 7 1 0.996 0.999 ? 99.8 ? 0.288 ? ? ? ? ? ? ? ? ? 2.77 2.85 ? ? ? ? ? ? 597 ? ? ? ? ? ? ? ? ? ? ? 19.0 0.548 ? ? 0.309 0.071 ? 8 1 0.994 0.999 ? 99.8 ? 0.301 ? ? ? ? ? ? ? ? ? 2.85 2.93 ? ? ? ? ? ? 583 ? ? ? ? ? ? ? ? ? ? ? 17.8 0.614 ? ? 0.200 0.048 ? 9 1 0.998 0.999 ? 99.8 ? 0.194 ? ? ? ? ? ? ? ? ? 2.93 3.02 ? ? ? ? ? ? 589 ? ? ? ? ? ? ? ? ? ? ? 19.2 0.617 ? ? 0.156 0.035 ? 10 1 0.999 1.000 ? 99.8 ? 0.152 ? ? ? ? ? ? ? ? ? 3.02 3.13 ? ? ? ? ? ? 579 ? ? ? ? ? ? ? ? ? ? ? 20.2 0.768 ? ? 0.140 0.031 ? 11 1 0.998 1.000 ? 100.0 ? 0.136 ? ? ? ? ? ? ? ? ? 3.13 3.26 ? ? ? ? ? ? 602 ? ? ? ? ? ? ? ? ? ? ? 19.9 0.713 ? ? 0.111 0.025 ? 12 1 0.999 1.000 ? 100.0 ? 0.109 ? ? ? ? ? ? ? ? ? 3.26 3.41 ? ? ? ? ? ? 593 ? ? ? ? ? ? ? ? ? ? ? 19.9 0.807 ? ? 0.089 0.020 ? 13 1 0.999 1.000 ? 100.0 ? 0.087 ? ? ? ? ? ? ? ? ? 3.41 3.58 ? ? ? ? ? ? 584 ? ? ? ? ? ? ? ? ? ? ? 19.5 0.968 ? ? 0.072 0.016 ? 14 1 0.999 1.000 ? 100.0 ? 0.071 ? ? ? ? ? ? ? ? ? 3.58 3.81 ? ? ? ? ? ? 613 ? ? ? ? ? ? ? ? ? ? ? 19.0 1.124 ? ? 0.061 0.014 ? 15 1 0.999 1.000 ? 100.0 ? 0.060 ? ? ? ? ? ? ? ? ? 3.81 4.10 ? ? ? ? ? ? 597 ? ? ? ? ? ? ? ? ? ? ? 18.5 1.341 ? ? 0.056 0.013 ? 16 1 0.999 1.000 ? 100.0 ? 0.054 ? ? ? ? ? ? ? ? ? 4.10 4.52 ? ? ? ? ? ? 606 ? ? ? ? ? ? ? ? ? ? ? 17.0 1.534 ? ? 0.051 0.012 ? 17 1 0.999 1.000 ? 100.0 ? 0.049 ? ? ? ? ? ? ? ? ? 4.52 5.17 ? ? ? ? ? ? 620 ? ? ? ? ? ? ? ? ? ? ? 18.3 1.708 ? ? 0.047 0.011 ? 18 1 0.999 1.000 ? 100.0 ? 0.046 ? ? ? ? ? ? ? ? ? 5.17 6.51 ? ? ? ? ? ? 629 ? ? ? ? ? ? ? ? ? ? ? 17.0 1.742 ? ? 0.047 0.011 ? 19 1 0.999 1.000 ? 99.8 ? 0.046 ? ? ? ? ? ? ? ? ? 6.51 50.00 ? ? ? ? ? ? 694 ? ? ? ? ? ? ? ? ? ? ? 16.4 1.993 ? ? 0.043 0.011 ? 20 1 0.999 1.000 ? 99.3 ? 0.042 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9JBD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.40 _refine.ls_d_res_low 35.49 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11807 _refine.ls_number_reflns_R_free 1182 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.22 _refine.ls_percent_reflns_R_free 10.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2223 _refine.ls_R_factor_R_free 0.2648 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2175 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.09 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.29 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 35.49 _refine_hist.number_atoms_solvent 28 _refine_hist.number_atoms_total 1123 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1071 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? ? ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.952 ? ? ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 17.777 ? 419 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.052 ? 168 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 ? 199 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.40 2.51 . . 141 1274 98.00 . . . . 0.2960 . . . . . . . . . . . 0.3536 'X-RAY DIFFRACTION' 2.51 2.64 . . 144 1282 99.00 . . . . 0.2613 . . . . . . . . . . . 0.2932 'X-RAY DIFFRACTION' 2.64 2.81 . . 142 1291 99.00 . . . . 0.2488 . . . . . . . . . . . 0.3131 'X-RAY DIFFRACTION' 2.81 3.03 . . 145 1310 99.00 . . . . 0.2433 . . . . . . . . . . . 0.3148 'X-RAY DIFFRACTION' 3.03 3.33 . . 147 1314 100.00 . . . . 0.2381 . . . . . . . . . . . 0.2832 'X-RAY DIFFRACTION' 3.33 3.81 . . 149 1345 100.00 . . . . 0.2210 . . . . . . . . . . . 0.2754 'X-RAY DIFFRACTION' 3.81 4.80 . . 151 1350 100.00 . . . . 0.2002 . . . . . . . . . . . 0.2158 'X-RAY DIFFRACTION' 4.80 35.49 . . 163 1459 100.00 . . . . 0.1997 . . . . . . . . . . . 0.2662 # _struct.entry_id 9JBD _struct.title 'Crystal Structure of the MoaE-like domain within Rv3323c from Mycobacterium tuberculosis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9JBD _struct_keywords.text 'molybdopterin synthase, MoaX, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q6MWY3_MYCTU _struct_ref.pdbx_db_accession Q6MWY3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRNNNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQAD GVRVAVAHRTGELRIGDAAVVIGASAPHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP ; _struct_ref.pdbx_align_begin 76 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9JBD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 146 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q6MWY3 _struct_ref_seq.db_align_beg 76 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 221 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 76 _struct_ref_seq.pdbx_auth_seq_align_end 221 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 300 ? 1 MORE -0 ? 1 'SSA (A^2)' 7640 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 20 ? SER A 29 ? SER A 95 SER A 104 1 ? 10 HELX_P HELX_P2 AA2 TYR A 60 ? ARG A 77 ? TYR A 135 ARG A 152 1 ? 18 HELX_P HELX_P3 AA3 HIS A 108 ? VAL A 127 ? HIS A 183 VAL A 202 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 12 ? THR A 15 ? CYS A 87 THR A 90 AA1 2 ARG A 83 ? ARG A 89 ? ARG A 158 ARG A 164 AA1 3 ALA A 98 ? ALA A 106 ? ALA A 173 ALA A 181 AA1 4 GLY A 35 ? THR A 42 ? GLY A 110 THR A 117 AA2 1 ASN A 46 ? ASN A 47 ? ASN A 121 ASN A 122 AA2 2 HIS A 50 ? GLU A 58 ? HIS A 125 GLU A 133 AA2 3 GLY A 91 ? LEU A 93 ? GLY A 166 LEU A 168 AA3 1 ASN A 46 ? ASN A 47 ? ASN A 121 ASN A 122 AA3 2 HIS A 50 ? GLU A 58 ? HIS A 125 GLU A 133 AA3 3 TRP A 130 ? ALA A 135 ? TRP A 205 ALA A 210 AA3 4 GLU A 140 ? ALA A 143 ? GLU A 215 ALA A 218 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 13 ? N ARG A 88 O HIS A 88 ? O HIS A 163 AA1 2 3 N ALA A 87 ? N ALA A 162 O VAL A 101 ? O VAL A 176 AA1 3 4 O ILE A 102 ? O ILE A 177 N PHE A 39 ? N PHE A 114 AA2 1 2 N ASN A 47 ? N ASN A 122 O HIS A 50 ? O HIS A 125 AA2 2 3 N LEU A 55 ? N LEU A 130 O LEU A 93 ? O LEU A 168 AA3 1 2 N ASN A 47 ? N ASN A 122 O HIS A 50 ? O HIS A 125 AA3 2 3 N LYS A 54 ? N LYS A 129 O PHE A 134 ? O PHE A 209 AA3 3 4 N LYS A 131 ? N LYS A 206 O ALA A 143 ? O ALA A 218 # _pdbx_entry_details.entry_id 9JBD _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 219 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -96.19 _pdbx_validate_torsion.psi 31.43 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 76 ? A ILE 1 2 1 Y 1 A PRO 77 ? A PRO 2 3 1 Y 1 A GLN 78 ? A GLN 3 4 1 Y 1 A VAL 79 ? A VAL 4 5 1 Y 1 A ALA 80 ? A ALA 5 6 1 Y 1 A GLY 81 ? A GLY 6 7 1 Y 1 A GLY 82 ? A GLY 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MES O1 O N N 244 MES C2 C N N 245 MES C3 C N N 246 MES N4 N N N 247 MES C5 C N N 248 MES C6 C N N 249 MES C7 C N N 250 MES C8 C N N 251 MES S S N N 252 MES O1S O N N 253 MES O2S O N N 254 MES O3S O N N 255 MES H21 H N N 256 MES H22 H N N 257 MES H31 H N N 258 MES H32 H N N 259 MES HN4 H N N 260 MES H51 H N N 261 MES H52 H N N 262 MES H61 H N N 263 MES H62 H N N 264 MES H71 H N N 265 MES H72 H N N 266 MES H81 H N N 267 MES H82 H N N 268 MET N N N N 269 MET CA C N S 270 MET C C N N 271 MET O O N N 272 MET CB C N N 273 MET CG C N N 274 MET SD S N N 275 MET CE C N N 276 MET OXT O N N 277 MET H H N N 278 MET H2 H N N 279 MET HA H N N 280 MET HB2 H N N 281 MET HB3 H N N 282 MET HG2 H N N 283 MET HG3 H N N 284 MET HE1 H N N 285 MET HE2 H N N 286 MET HE3 H N N 287 MET HXT H N N 288 PHE N N N N 289 PHE CA C N S 290 PHE C C N N 291 PHE O O N N 292 PHE CB C N N 293 PHE CG C Y N 294 PHE CD1 C Y N 295 PHE CD2 C Y N 296 PHE CE1 C Y N 297 PHE CE2 C Y N 298 PHE CZ C Y N 299 PHE OXT O N N 300 PHE H H N N 301 PHE H2 H N N 302 PHE HA H N N 303 PHE HB2 H N N 304 PHE HB3 H N N 305 PHE HD1 H N N 306 PHE HD2 H N N 307 PHE HE1 H N N 308 PHE HE2 H N N 309 PHE HZ H N N 310 PHE HXT H N N 311 PRO N N N N 312 PRO CA C N S 313 PRO C C N N 314 PRO O O N N 315 PRO CB C N N 316 PRO CG C N N 317 PRO CD C N N 318 PRO OXT O N N 319 PRO H H N N 320 PRO HA H N N 321 PRO HB2 H N N 322 PRO HB3 H N N 323 PRO HG2 H N N 324 PRO HG3 H N N 325 PRO HD2 H N N 326 PRO HD3 H N N 327 PRO HXT H N N 328 SER N N N N 329 SER CA C N S 330 SER C C N N 331 SER O O N N 332 SER CB C N N 333 SER OG O N N 334 SER OXT O N N 335 SER H H N N 336 SER H2 H N N 337 SER HA H N N 338 SER HB2 H N N 339 SER HB3 H N N 340 SER HG H N N 341 SER HXT H N N 342 THR N N N N 343 THR CA C N S 344 THR C C N N 345 THR O O N N 346 THR CB C N R 347 THR OG1 O N N 348 THR CG2 C N N 349 THR OXT O N N 350 THR H H N N 351 THR H2 H N N 352 THR HA H N N 353 THR HB H N N 354 THR HG1 H N N 355 THR HG21 H N N 356 THR HG22 H N N 357 THR HG23 H N N 358 THR HXT H N N 359 TRP N N N N 360 TRP CA C N S 361 TRP C C N N 362 TRP O O N N 363 TRP CB C N N 364 TRP CG C Y N 365 TRP CD1 C Y N 366 TRP CD2 C Y N 367 TRP NE1 N Y N 368 TRP CE2 C Y N 369 TRP CE3 C Y N 370 TRP CZ2 C Y N 371 TRP CZ3 C Y N 372 TRP CH2 C Y N 373 TRP OXT O N N 374 TRP H H N N 375 TRP H2 H N N 376 TRP HA H N N 377 TRP HB2 H N N 378 TRP HB3 H N N 379 TRP HD1 H N N 380 TRP HE1 H N N 381 TRP HE3 H N N 382 TRP HZ2 H N N 383 TRP HZ3 H N N 384 TRP HH2 H N N 385 TRP HXT H N N 386 TYR N N N N 387 TYR CA C N S 388 TYR C C N N 389 TYR O O N N 390 TYR CB C N N 391 TYR CG C Y N 392 TYR CD1 C Y N 393 TYR CD2 C Y N 394 TYR CE1 C Y N 395 TYR CE2 C Y N 396 TYR CZ C Y N 397 TYR OH O N N 398 TYR OXT O N N 399 TYR H H N N 400 TYR H2 H N N 401 TYR HA H N N 402 TYR HB2 H N N 403 TYR HB3 H N N 404 TYR HD1 H N N 405 TYR HD2 H N N 406 TYR HE1 H N N 407 TYR HE2 H N N 408 TYR HH H N N 409 TYR HXT H N N 410 VAL N N N N 411 VAL CA C N S 412 VAL C C N N 413 VAL O O N N 414 VAL CB C N N 415 VAL CG1 C N N 416 VAL CG2 C N N 417 VAL OXT O N N 418 VAL H H N N 419 VAL H2 H N N 420 VAL HA H N N 421 VAL HB H N N 422 VAL HG11 H N N 423 VAL HG12 H N N 424 VAL HG13 H N N 425 VAL HG21 H N N 426 VAL HG22 H N N 427 VAL HG23 H N N 428 VAL HXT H N N 429 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MES O1 C2 sing N N 231 MES O1 C6 sing N N 232 MES C2 C3 sing N N 233 MES C2 H21 sing N N 234 MES C2 H22 sing N N 235 MES C3 N4 sing N N 236 MES C3 H31 sing N N 237 MES C3 H32 sing N N 238 MES N4 C5 sing N N 239 MES N4 C7 sing N N 240 MES N4 HN4 sing N N 241 MES C5 C6 sing N N 242 MES C5 H51 sing N N 243 MES C5 H52 sing N N 244 MES C6 H61 sing N N 245 MES C6 H62 sing N N 246 MES C7 C8 sing N N 247 MES C7 H71 sing N N 248 MES C7 H72 sing N N 249 MES C8 S sing N N 250 MES C8 H81 sing N N 251 MES C8 H82 sing N N 252 MES S O1S doub N N 253 MES S O2S doub N N 254 MES S O3S sing N N 255 MET N CA sing N N 256 MET N H sing N N 257 MET N H2 sing N N 258 MET CA C sing N N 259 MET CA CB sing N N 260 MET CA HA sing N N 261 MET C O doub N N 262 MET C OXT sing N N 263 MET CB CG sing N N 264 MET CB HB2 sing N N 265 MET CB HB3 sing N N 266 MET CG SD sing N N 267 MET CG HG2 sing N N 268 MET CG HG3 sing N N 269 MET SD CE sing N N 270 MET CE HE1 sing N N 271 MET CE HE2 sing N N 272 MET CE HE3 sing N N 273 MET OXT HXT sing N N 274 PHE N CA sing N N 275 PHE N H sing N N 276 PHE N H2 sing N N 277 PHE CA C sing N N 278 PHE CA CB sing N N 279 PHE CA HA sing N N 280 PHE C O doub N N 281 PHE C OXT sing N N 282 PHE CB CG sing N N 283 PHE CB HB2 sing N N 284 PHE CB HB3 sing N N 285 PHE CG CD1 doub Y N 286 PHE CG CD2 sing Y N 287 PHE CD1 CE1 sing Y N 288 PHE CD1 HD1 sing N N 289 PHE CD2 CE2 doub Y N 290 PHE CD2 HD2 sing N N 291 PHE CE1 CZ doub Y N 292 PHE CE1 HE1 sing N N 293 PHE CE2 CZ sing Y N 294 PHE CE2 HE2 sing N N 295 PHE CZ HZ sing N N 296 PHE OXT HXT sing N N 297 PRO N CA sing N N 298 PRO N CD sing N N 299 PRO N H sing N N 300 PRO CA C sing N N 301 PRO CA CB sing N N 302 PRO CA HA sing N N 303 PRO C O doub N N 304 PRO C OXT sing N N 305 PRO CB CG sing N N 306 PRO CB HB2 sing N N 307 PRO CB HB3 sing N N 308 PRO CG CD sing N N 309 PRO CG HG2 sing N N 310 PRO CG HG3 sing N N 311 PRO CD HD2 sing N N 312 PRO CD HD3 sing N N 313 PRO OXT HXT sing N N 314 SER N CA sing N N 315 SER N H sing N N 316 SER N H2 sing N N 317 SER CA C sing N N 318 SER CA CB sing N N 319 SER CA HA sing N N 320 SER C O doub N N 321 SER C OXT sing N N 322 SER CB OG sing N N 323 SER CB HB2 sing N N 324 SER CB HB3 sing N N 325 SER OG HG sing N N 326 SER OXT HXT sing N N 327 THR N CA sing N N 328 THR N H sing N N 329 THR N H2 sing N N 330 THR CA C sing N N 331 THR CA CB sing N N 332 THR CA HA sing N N 333 THR C O doub N N 334 THR C OXT sing N N 335 THR CB OG1 sing N N 336 THR CB CG2 sing N N 337 THR CB HB sing N N 338 THR OG1 HG1 sing N N 339 THR CG2 HG21 sing N N 340 THR CG2 HG22 sing N N 341 THR CG2 HG23 sing N N 342 THR OXT HXT sing N N 343 TRP N CA sing N N 344 TRP N H sing N N 345 TRP N H2 sing N N 346 TRP CA C sing N N 347 TRP CA CB sing N N 348 TRP CA HA sing N N 349 TRP C O doub N N 350 TRP C OXT sing N N 351 TRP CB CG sing N N 352 TRP CB HB2 sing N N 353 TRP CB HB3 sing N N 354 TRP CG CD1 doub Y N 355 TRP CG CD2 sing Y N 356 TRP CD1 NE1 sing Y N 357 TRP CD1 HD1 sing N N 358 TRP CD2 CE2 doub Y N 359 TRP CD2 CE3 sing Y N 360 TRP NE1 CE2 sing Y N 361 TRP NE1 HE1 sing N N 362 TRP CE2 CZ2 sing Y N 363 TRP CE3 CZ3 doub Y N 364 TRP CE3 HE3 sing N N 365 TRP CZ2 CH2 doub Y N 366 TRP CZ2 HZ2 sing N N 367 TRP CZ3 CH2 sing Y N 368 TRP CZ3 HZ3 sing N N 369 TRP CH2 HH2 sing N N 370 TRP OXT HXT sing N N 371 TYR N CA sing N N 372 TYR N H sing N N 373 TYR N H2 sing N N 374 TYR CA C sing N N 375 TYR CA CB sing N N 376 TYR CA HA sing N N 377 TYR C O doub N N 378 TYR C OXT sing N N 379 TYR CB CG sing N N 380 TYR CB HB2 sing N N 381 TYR CB HB3 sing N N 382 TYR CG CD1 doub Y N 383 TYR CG CD2 sing Y N 384 TYR CD1 CE1 sing Y N 385 TYR CD1 HD1 sing N N 386 TYR CD2 CE2 doub Y N 387 TYR CD2 HD2 sing N N 388 TYR CE1 CZ doub Y N 389 TYR CE1 HE1 sing N N 390 TYR CE2 CZ sing Y N 391 TYR CE2 HE2 sing N N 392 TYR CZ OH sing N N 393 TYR OH HH sing N N 394 TYR OXT HXT sing N N 395 VAL N CA sing N N 396 VAL N H sing N N 397 VAL N H2 sing N N 398 VAL CA C sing N N 399 VAL CA CB sing N N 400 VAL CA HA sing N N 401 VAL C O doub N N 402 VAL C OXT sing N N 403 VAL CB CG1 sing N N 404 VAL CB CG2 sing N N 405 VAL CB HB sing N N 406 VAL CG1 HG11 sing N N 407 VAL CG1 HG12 sing N N 408 VAL CG1 HG13 sing N N 409 VAL CG2 HG21 sing N N 410 VAL CG2 HG22 sing N N 411 VAL CG2 HG23 sing N N 412 VAL OXT HXT sing N N 413 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' 2021RIS-001 1 'National Research Foundation (NRF, Korea)' 'Korea, Republic Of' 2022R1F1A1074091 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2WP4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9JBD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.010203 _atom_sites.fract_transf_matrix[1][2] 0.005890 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011781 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009714 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #