data_9JF6 # _entry.id 9JF6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9JF6 pdb_00009jf6 10.2210/pdb9jf6/pdb WWPDB D_1300051197 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-03-11 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9JF6 _pdbx_database_status.recvd_initial_deposition_date 2024-09-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 wangxiaoyu@imm.ac.cn Xiaoyu Wang ? 'principal investigator/group leader' 0000-0001-6094-7747 3 tianmz@imm.ac.cn Meizhen Tian ? 'principal investigator/group leader' 0009-0002-0707-9252 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, X.Y.' 1 0000-0001-6094-7747 'Tian, M.Z.' 2 0009-0002-0707-9252 'Zhou, J.' 3 0000-0002-5029-9149 'Xu, B.L.' 4 0000-0003-2633-0887 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of human Pin1 in complex with a covalent inhibitor' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, X.Y.' 1 0000-0001-6094-7747 primary 'Tian, M.Z.' 2 0009-0002-0707-9252 primary 'Zhou, J.' 3 0000-0002-5029-9149 primary 'Xu, B.L.' 4 0000-0003-2633-0887 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1' 17693.617 1 5.2.1.8 ? ? ? 2 non-polymer syn 'methyl (~{Z})-4-[1-benzothiophen-2-ylmethyl-[(3~{S})-1,1-bis(oxidanylidene)thiolan-3-yl]amino]-4-oxidanylidene-but-2-enoate' 393.477 1 ? ? ? ? 3 non-polymer syn '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' 252.305 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Peptidyl-prolyl cis-trans isomerase Pin1,PPIase Pin1,Rotamase Pin1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEA LELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE ; _entity_poly.pdbx_seq_one_letter_code_can ;KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEQITRTQEEA LELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'methyl (~{Z})-4-[1-benzothiophen-2-ylmethyl-[(3~{S})-1,1-bis(oxidanylidene)thiolan-3-yl]amino]-4-oxidanylidene-but-2-enoate' A1EBR 3 '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' 1PG # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 LEU n 1 3 PRO n 1 4 PRO n 1 5 GLY n 1 6 TRP n 1 7 GLU n 1 8 LYS n 1 9 ARG n 1 10 MET n 1 11 SER n 1 12 ARG n 1 13 SER n 1 14 SER n 1 15 GLY n 1 16 ARG n 1 17 VAL n 1 18 TYR n 1 19 TYR n 1 20 PHE n 1 21 ASN n 1 22 HIS n 1 23 ILE n 1 24 THR n 1 25 ASN n 1 26 ALA n 1 27 SER n 1 28 GLN n 1 29 TRP n 1 30 GLU n 1 31 ARG n 1 32 PRO n 1 33 SER n 1 34 GLY n 1 35 ASN n 1 36 SER n 1 37 SER n 1 38 SER n 1 39 GLY n 1 40 GLY n 1 41 LYS n 1 42 ASN n 1 43 GLY n 1 44 GLN n 1 45 GLY n 1 46 GLU n 1 47 PRO n 1 48 ALA n 1 49 ARG n 1 50 VAL n 1 51 ARG n 1 52 CYS n 1 53 SER n 1 54 HIS n 1 55 LEU n 1 56 LEU n 1 57 VAL n 1 58 LYS n 1 59 HIS n 1 60 SER n 1 61 GLN n 1 62 SER n 1 63 ARG n 1 64 ARG n 1 65 PRO n 1 66 SER n 1 67 SER n 1 68 TRP n 1 69 ARG n 1 70 GLN n 1 71 GLU n 1 72 GLN n 1 73 ILE n 1 74 THR n 1 75 ARG n 1 76 THR n 1 77 GLN n 1 78 GLU n 1 79 GLU n 1 80 ALA n 1 81 LEU n 1 82 GLU n 1 83 LEU n 1 84 ILE n 1 85 ASN n 1 86 GLY n 1 87 TYR n 1 88 ILE n 1 89 GLN n 1 90 LYS n 1 91 ILE n 1 92 LYS n 1 93 SER n 1 94 GLY n 1 95 GLU n 1 96 GLU n 1 97 ASP n 1 98 PHE n 1 99 GLU n 1 100 SER n 1 101 LEU n 1 102 ALA n 1 103 SER n 1 104 GLN n 1 105 PHE n 1 106 SER n 1 107 ASP n 1 108 CYS n 1 109 SER n 1 110 SER n 1 111 ALA n 1 112 LYS n 1 113 ALA n 1 114 ARG n 1 115 GLY n 1 116 ASP n 1 117 LEU n 1 118 GLY n 1 119 ALA n 1 120 PHE n 1 121 SER n 1 122 ARG n 1 123 GLY n 1 124 GLN n 1 125 MET n 1 126 GLN n 1 127 LYS n 1 128 PRO n 1 129 PHE n 1 130 GLU n 1 131 ASP n 1 132 ALA n 1 133 SER n 1 134 PHE n 1 135 ALA n 1 136 LEU n 1 137 ARG n 1 138 THR n 1 139 GLY n 1 140 GLU n 1 141 MET n 1 142 SER n 1 143 GLY n 1 144 PRO n 1 145 VAL n 1 146 PHE n 1 147 THR n 1 148 ASP n 1 149 SER n 1 150 GLY n 1 151 ILE n 1 152 HIS n 1 153 ILE n 1 154 ILE n 1 155 LEU n 1 156 ARG n 1 157 THR n 1 158 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 158 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIN1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 1PG non-polymer . '2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHANOL' ? 'C11 H24 O6' 252.305 A1EBR non-polymer . 'methyl (~{Z})-4-[1-benzothiophen-2-ylmethyl-[(3~{S})-1,1-bis(oxidanylidene)thiolan-3-yl]amino]-4-oxidanylidene-but-2-enoate' ? 'C18 H19 N O5 S2' 393.477 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 6 6 LYS LYS A . n A 1 2 LEU 2 7 7 LEU LEU A . n A 1 3 PRO 3 8 8 PRO PRO A . n A 1 4 PRO 4 9 9 PRO PRO A . n A 1 5 GLY 5 10 10 GLY GLY A . n A 1 6 TRP 6 11 11 TRP TRP A . n A 1 7 GLU 7 12 12 GLU GLU A . n A 1 8 LYS 8 13 13 LYS LYS A . n A 1 9 ARG 9 14 14 ARG ARG A . n A 1 10 MET 10 15 15 MET MET A . n A 1 11 SER 11 16 16 SER SER A . n A 1 12 ARG 12 17 17 ARG ARG A . n A 1 13 SER 13 18 18 SER SER A . n A 1 14 SER 14 19 19 SER SER A . n A 1 15 GLY 15 20 20 GLY GLY A . n A 1 16 ARG 16 21 21 ARG ARG A . n A 1 17 VAL 17 22 22 VAL VAL A . n A 1 18 TYR 18 23 23 TYR TYR A . n A 1 19 TYR 19 24 24 TYR TYR A . n A 1 20 PHE 20 25 25 PHE PHE A . n A 1 21 ASN 21 26 26 ASN ASN A . n A 1 22 HIS 22 27 27 HIS HIS A . n A 1 23 ILE 23 28 28 ILE ILE A . n A 1 24 THR 24 29 29 THR THR A . n A 1 25 ASN 25 30 30 ASN ASN A . n A 1 26 ALA 26 31 31 ALA ALA A . n A 1 27 SER 27 32 32 SER SER A . n A 1 28 GLN 28 33 33 GLN GLN A . n A 1 29 TRP 29 34 34 TRP TRP A . n A 1 30 GLU 30 35 35 GLU GLU A . n A 1 31 ARG 31 36 36 ARG ARG A . n A 1 32 PRO 32 37 37 PRO PRO A . n A 1 33 SER 33 38 38 SER SER A . n A 1 34 GLY 34 39 39 GLY GLY A . n A 1 35 ASN 35 40 ? ? ? A . n A 1 36 SER 36 41 ? ? ? A . n A 1 37 SER 37 42 ? ? ? A . n A 1 38 SER 38 43 ? ? ? A . n A 1 39 GLY 39 44 ? ? ? A . n A 1 40 GLY 40 45 ? ? ? A . n A 1 41 LYS 41 46 ? ? ? A . n A 1 42 ASN 42 47 ? ? ? A . n A 1 43 GLY 43 48 48 GLY GLY A . n A 1 44 GLN 44 49 49 GLN GLN A . n A 1 45 GLY 45 50 50 GLY GLY A . n A 1 46 GLU 46 51 51 GLU GLU A . n A 1 47 PRO 47 52 52 PRO PRO A . n A 1 48 ALA 48 53 53 ALA ALA A . n A 1 49 ARG 49 54 54 ARG ARG A . n A 1 50 VAL 50 55 55 VAL VAL A . n A 1 51 ARG 51 56 56 ARG ARG A . n A 1 52 CYS 52 57 57 CYS CYS A . n A 1 53 SER 53 58 58 SER SER A . n A 1 54 HIS 54 59 59 HIS HIS A . n A 1 55 LEU 55 60 60 LEU LEU A . n A 1 56 LEU 56 61 61 LEU LEU A . n A 1 57 VAL 57 62 62 VAL VAL A . n A 1 58 LYS 58 63 63 LYS LYS A . n A 1 59 HIS 59 64 64 HIS HIS A . n A 1 60 SER 60 65 65 SER SER A . n A 1 61 GLN 61 66 66 GLN GLN A . n A 1 62 SER 62 67 67 SER SER A . n A 1 63 ARG 63 68 68 ARG ARG A . n A 1 64 ARG 64 69 69 ARG ARG A . n A 1 65 PRO 65 70 70 PRO PRO A . n A 1 66 SER 66 71 71 SER SER A . n A 1 67 SER 67 72 72 SER SER A . n A 1 68 TRP 68 73 73 TRP TRP A . n A 1 69 ARG 69 74 74 ARG ARG A . n A 1 70 GLN 70 75 75 GLN GLN A . n A 1 71 GLU 71 76 76 GLU GLU A . n A 1 72 GLN 72 77 77 GLN GLN A . n A 1 73 ILE 73 78 78 ILE ILE A . n A 1 74 THR 74 79 79 THR THR A . n A 1 75 ARG 75 80 80 ARG ARG A . n A 1 76 THR 76 81 81 THR THR A . n A 1 77 GLN 77 82 82 GLN GLN A . n A 1 78 GLU 78 83 83 GLU GLU A . n A 1 79 GLU 79 84 84 GLU GLU A . n A 1 80 ALA 80 85 85 ALA ALA A . n A 1 81 LEU 81 86 86 LEU LEU A . n A 1 82 GLU 82 87 87 GLU GLU A . n A 1 83 LEU 83 88 88 LEU LEU A . n A 1 84 ILE 84 89 89 ILE ILE A . n A 1 85 ASN 85 90 90 ASN ASN A . n A 1 86 GLY 86 91 91 GLY GLY A . n A 1 87 TYR 87 92 92 TYR TYR A . n A 1 88 ILE 88 93 93 ILE ILE A . n A 1 89 GLN 89 94 94 GLN GLN A . n A 1 90 LYS 90 95 95 LYS LYS A . n A 1 91 ILE 91 96 96 ILE ILE A . n A 1 92 LYS 92 97 97 LYS LYS A . n A 1 93 SER 93 98 98 SER SER A . n A 1 94 GLY 94 99 99 GLY GLY A . n A 1 95 GLU 95 100 100 GLU GLU A . n A 1 96 GLU 96 101 101 GLU GLU A . n A 1 97 ASP 97 102 102 ASP ASP A . n A 1 98 PHE 98 103 103 PHE PHE A . n A 1 99 GLU 99 104 104 GLU GLU A . n A 1 100 SER 100 105 105 SER SER A . n A 1 101 LEU 101 106 106 LEU LEU A . n A 1 102 ALA 102 107 107 ALA ALA A . n A 1 103 SER 103 108 108 SER SER A . n A 1 104 GLN 104 109 109 GLN GLN A . n A 1 105 PHE 105 110 110 PHE PHE A . n A 1 106 SER 106 111 111 SER SER A . n A 1 107 ASP 107 112 112 ASP ASP A . n A 1 108 CYS 108 113 113 CYS CYS A . n A 1 109 SER 109 114 114 SER SER A . n A 1 110 SER 110 115 115 SER SER A . n A 1 111 ALA 111 116 116 ALA ALA A . n A 1 112 LYS 112 117 117 LYS LYS A . n A 1 113 ALA 113 118 118 ALA ALA A . n A 1 114 ARG 114 119 119 ARG ARG A . n A 1 115 GLY 115 120 120 GLY GLY A . n A 1 116 ASP 116 121 121 ASP ASP A . n A 1 117 LEU 117 122 122 LEU LEU A . n A 1 118 GLY 118 123 123 GLY GLY A . n A 1 119 ALA 119 124 124 ALA ALA A . n A 1 120 PHE 120 125 125 PHE PHE A . n A 1 121 SER 121 126 126 SER SER A . n A 1 122 ARG 122 127 127 ARG ARG A . n A 1 123 GLY 123 128 128 GLY GLY A . n A 1 124 GLN 124 129 129 GLN GLN A . n A 1 125 MET 125 130 130 MET MET A . n A 1 126 GLN 126 131 131 GLN GLN A . n A 1 127 LYS 127 132 132 LYS LYS A . n A 1 128 PRO 128 133 133 PRO PRO A . n A 1 129 PHE 129 134 134 PHE PHE A . n A 1 130 GLU 130 135 135 GLU GLU A . n A 1 131 ASP 131 136 136 ASP ASP A . n A 1 132 ALA 132 137 137 ALA ALA A . n A 1 133 SER 133 138 138 SER SER A . n A 1 134 PHE 134 139 139 PHE PHE A . n A 1 135 ALA 135 140 140 ALA ALA A . n A 1 136 LEU 136 141 141 LEU LEU A . n A 1 137 ARG 137 142 142 ARG ARG A . n A 1 138 THR 138 143 143 THR THR A . n A 1 139 GLY 139 144 144 GLY GLY A . n A 1 140 GLU 140 145 145 GLU GLU A . n A 1 141 MET 141 146 146 MET MET A . n A 1 142 SER 142 147 147 SER SER A . n A 1 143 GLY 143 148 148 GLY GLY A . n A 1 144 PRO 144 149 149 PRO PRO A . n A 1 145 VAL 145 150 150 VAL VAL A . n A 1 146 PHE 146 151 151 PHE PHE A . n A 1 147 THR 147 152 152 THR THR A . n A 1 148 ASP 148 153 153 ASP ASP A . n A 1 149 SER 149 154 154 SER SER A . n A 1 150 GLY 150 155 155 GLY GLY A . n A 1 151 ILE 151 156 156 ILE ILE A . n A 1 152 HIS 152 157 157 HIS HIS A . n A 1 153 ILE 153 158 158 ILE ILE A . n A 1 154 ILE 154 159 159 ILE ILE A . n A 1 155 LEU 155 160 160 LEU LEU A . n A 1 156 ARG 156 161 161 ARG ARG A . n A 1 157 THR 157 162 162 THR THR A . n A 1 158 GLU 158 163 163 GLU GLU A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 A1EBR ? ? A1EBR ? ? 'SUBJECT OF INVESTIGATION' ? 2 1PG ? ? 1PG ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1EBR 1 200 200 A1EBR LIG A . C 3 1PG 1 201 201 1PG PEG A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 6 ? CG ? A LYS 1 CG 2 1 Y 1 A LYS 6 ? CD ? A LYS 1 CD 3 1 Y 1 A LYS 6 ? CE ? A LYS 1 CE 4 1 Y 1 A LYS 6 ? NZ ? A LYS 1 NZ 5 1 Y 1 A SER 18 ? OG ? A SER 13 OG 6 1 Y 1 A GLN 49 ? CG ? A GLN 44 CG 7 1 Y 1 A GLN 49 ? CD ? A GLN 44 CD 8 1 Y 1 A GLN 49 ? OE1 ? A GLN 44 OE1 9 1 Y 1 A GLN 49 ? NE2 ? A GLN 44 NE2 10 1 Y 1 A GLU 76 ? CG ? A GLU 71 CG 11 1 Y 1 A GLU 76 ? CD ? A GLU 71 CD 12 1 Y 1 A GLU 76 ? OE1 ? A GLU 71 OE1 13 1 Y 1 A GLU 76 ? OE2 ? A GLU 71 OE2 14 1 Y 1 A GLN 77 ? NE2 ? A GLN 72 NE2 15 1 Y 1 A GLN 82 ? NE2 ? A GLN 77 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9JF6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 69.156 _cell.length_a_esd ? _cell.length_b 69.156 _cell.length_b_esd ? _cell.length_c 79.505 _cell.length_c_esd ? _cell.volume 329294.749 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9JF6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ;P 31 2" ; _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9JF6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.99 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '(NH4)2SO4 2.4 M, HEPES-Na 0.1 M, PEG 400 1.0% (v/v) pH 7.5' _exptl_crystal_grow.pdbx_pH_range 7.3-7.7 _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU SATURN 944' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-03-28 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-X' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 32.81 _reflns.entry_id 9JF6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.96 _reflns.d_resolution_low 33.12 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4849 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.69 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 19.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.24 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1797 _reflns.pdbx_Rpim_I_all 0.04007 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.996 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1751 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.961 _reflns_shell.d_res_low 3.067 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 480 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.986 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.77 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 25.99 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9JF6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.96 _refine.ls_d_res_low 33.12 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4848 _refine.ls_number_reflns_R_free 224 _refine.ls_number_reflns_R_work 4624 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.79 _refine.ls_percent_reflns_R_free 4.62 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2406 _refine.ls_R_factor_R_free 0.2784 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2386 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 21.7377 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.0895 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.96 _refine_hist.d_res_low 33.12 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1220 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1177 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0032 ? 1246 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8534 ? 1669 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0450 ? 166 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0218 ? 219 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 19.4411 ? 482 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.96 3.73 . . 138 2228 99.75 . . . . 0.2662 . . . . . . . . . . . 0.2947 'X-RAY DIFFRACTION' 3.73 33.12 . . 86 2396 99.84 . . . . 0.2208 . . . . . . . . . . . 0.2598 # _struct.entry_id 9JF6 _struct.title 'Crystal Structure of human Pin1 in complex with a covalent inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9JF6 _struct_keywords.text 'human Pin1; complex structure; covalent inhibitor; Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, ISOMERASE' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PIN1_HUMAN _struct_ref.pdbx_db_accession Q13526 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEA LELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE ; _struct_ref.pdbx_align_begin 6 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9JF6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 158 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13526 _struct_ref_seq.db_align_beg 6 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 163 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 163 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9JF6 GLN A 72 ? UNP Q13526 LYS 77 conflict 77 1 1 9JF6 GLN A 77 ? UNP Q13526 LYS 82 conflict 82 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 76 ? GLY A 94 ? THR A 81 GLY A 99 1 ? 19 HELX_P HELX_P2 AA2 ASP A 97 ? SER A 106 ? ASP A 102 SER A 111 1 ? 10 HELX_P HELX_P3 AA3 CYS A 108 ? ARG A 114 ? CYS A 113 ARG A 119 5 ? 7 HELX_P HELX_P4 AA4 GLN A 126 ? LEU A 136 ? GLN A 131 LEU A 141 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 108 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id A1EBR _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C4 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 113 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id A1EBR _struct_conn.ptnr2_auth_seq_id 200 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.769 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1EBR _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 108 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1EBR _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 200 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 113 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C4 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1EBR _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TRP A 6 ? MET A 10 ? TRP A 11 MET A 15 AA1 2 VAL A 17 ? ASN A 21 ? VAL A 22 ASN A 26 AA1 3 SER A 27 ? GLN A 28 ? SER A 32 GLN A 33 AA2 1 ASP A 116 ? PHE A 120 ? ASP A 121 PHE A 125 AA2 2 VAL A 50 ? VAL A 57 ? VAL A 55 VAL A 62 AA2 3 ILE A 151 ? GLU A 158 ? ILE A 156 GLU A 163 AA2 4 MET A 141 ? PHE A 146 ? MET A 146 PHE A 151 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 7 ? N GLU A 12 O PHE A 20 ? O PHE A 25 AA1 2 3 N TYR A 19 ? N TYR A 24 O GLN A 28 ? O GLN A 33 AA2 1 2 O PHE A 120 ? O PHE A 125 N VAL A 50 ? N VAL A 55 AA2 2 3 N ARG A 51 ? N ARG A 56 O THR A 157 ? O THR A 162 AA2 3 4 O ILE A 154 ? O ILE A 159 N SER A 142 ? N SER A 147 # _pdbx_entry_details.entry_id 9JF6 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 70 ? ? -66.29 62.24 2 1 ALA A 118 ? ? -95.88 34.08 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 17 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.186 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+1/3 3 -x+y,-x,z+2/3 4 x-y,-y,-z+2/3 5 -x,-x+y,-z+1/3 6 y,x,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASN 40 ? A ASN 35 2 1 Y 1 A SER 41 ? A SER 36 3 1 Y 1 A SER 42 ? A SER 37 4 1 Y 1 A SER 43 ? A SER 38 5 1 Y 1 A GLY 44 ? A GLY 39 6 1 Y 1 A GLY 45 ? A GLY 40 7 1 Y 1 A LYS 46 ? A LYS 41 8 1 Y 1 A ASN 47 ? A ASN 42 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 1PG C2 C N N 1 1PG C1 C N N 2 1PG O1 O N N 3 1PG O2 O N N 4 1PG C3 C N N 5 1PG C4 C N N 6 1PG C5 C N N 7 1PG O3 O N N 8 1PG C6 C N N 9 1PG C7 C N N 10 1PG O4 O N N 11 1PG C8 C N N 12 1PG C9 C N N 13 1PG O5 O N N 14 1PG C10 C N N 15 1PG C11 C N N 16 1PG O6 O N N 17 1PG H21 H N N 18 1PG H22 H N N 19 1PG H11 H N N 20 1PG H12 H N N 21 1PG H13 H N N 22 1PG H31 H N N 23 1PG H32 H N N 24 1PG H41 H N N 25 1PG H42 H N N 26 1PG H51 H N N 27 1PG H52 H N N 28 1PG H61 H N N 29 1PG H62 H N N 30 1PG H71 H N N 31 1PG H72 H N N 32 1PG H81 H N N 33 1PG H82 H N N 34 1PG H91 H N N 35 1PG H92 H N N 36 1PG H101 H N N 37 1PG H102 H N N 38 1PG H111 H N N 39 1PG H112 H N N 40 1PG HO6 H N N 41 A1EBR N1 N N N 42 A1EBR C4 C N N 43 A1EBR C5 C N N 44 A1EBR C6 C N S 45 A1EBR C7 C N N 46 A1EBR C8 C N N 47 A1EBR C10 C N N 48 A1EBR C13 C Y N 49 A1EBR C15 C Y N 50 A1EBR C17 C Y N 51 A1EBR C1 C N N 52 A1EBR C11 C Y N 53 A1EBR C12 C Y N 54 A1EBR C14 C Y N 55 A1EBR C16 C Y N 56 A1EBR C18 C Y N 57 A1EBR C2 C N N 58 A1EBR C3 C N N 59 A1EBR C9 C N N 60 A1EBR O1 O N N 61 A1EBR O2 O N N 62 A1EBR O3 O N N 63 A1EBR O4 O N N 64 A1EBR O5 O N N 65 A1EBR S1 S N N 66 A1EBR S2 S Y N 67 A1EBR H12 H N N 68 A1EBR H13 H N N 69 A1EBR H14 H N N 70 A1EBR H15 H N N 71 A1EBR H16 H N N 72 A1EBR H17 H N N 73 A1EBR H2 H N N 74 A1EBR H1 H N N 75 A1EBR H4 H N N 76 A1EBR H6 H N N 77 A1EBR H3 H N N 78 A1EBR H5 H N N 79 A1EBR H7 H N N 80 A1EBR H9 H N N 81 A1EBR H8 H N N 82 A1EBR H10 H N N 83 A1EBR H11 H N N 84 A1EBR H19 H N N 85 A1EBR H18 H N N 86 ALA N N N N 87 ALA CA C N S 88 ALA C C N N 89 ALA O O N N 90 ALA CB C N N 91 ALA OXT O N N 92 ALA H H N N 93 ALA H2 H N N 94 ALA HA H N N 95 ALA HB1 H N N 96 ALA HB2 H N N 97 ALA HB3 H N N 98 ALA HXT H N N 99 ARG N N N N 100 ARG CA C N S 101 ARG C C N N 102 ARG O O N N 103 ARG CB C N N 104 ARG CG C N N 105 ARG CD C N N 106 ARG NE N N N 107 ARG CZ C N N 108 ARG NH1 N N N 109 ARG NH2 N N N 110 ARG OXT O N N 111 ARG H H N N 112 ARG H2 H N N 113 ARG HA H N N 114 ARG HB2 H N N 115 ARG HB3 H N N 116 ARG HG2 H N N 117 ARG HG3 H N N 118 ARG HD2 H N N 119 ARG HD3 H N N 120 ARG HE H N N 121 ARG HH11 H N N 122 ARG HH12 H N N 123 ARG HH21 H N N 124 ARG HH22 H N N 125 ARG HXT H N N 126 ASN N N N N 127 ASN CA C N S 128 ASN C C N N 129 ASN O O N N 130 ASN CB C N N 131 ASN CG C N N 132 ASN OD1 O N N 133 ASN ND2 N N N 134 ASN OXT O N N 135 ASN H H N N 136 ASN H2 H N N 137 ASN HA H N N 138 ASN HB2 H N N 139 ASN HB3 H N N 140 ASN HD21 H N N 141 ASN HD22 H N N 142 ASN HXT H N N 143 ASP N N N N 144 ASP CA C N S 145 ASP C C N N 146 ASP O O N N 147 ASP CB C N N 148 ASP CG C N N 149 ASP OD1 O N N 150 ASP OD2 O N N 151 ASP OXT O N N 152 ASP H H N N 153 ASP H2 H N N 154 ASP HA H N N 155 ASP HB2 H N N 156 ASP HB3 H N N 157 ASP HD2 H N N 158 ASP HXT H N N 159 CYS N N N N 160 CYS CA C N R 161 CYS C C N N 162 CYS O O N N 163 CYS CB C N N 164 CYS SG S N N 165 CYS OXT O N N 166 CYS H H N N 167 CYS H2 H N N 168 CYS HA H N N 169 CYS HB2 H N N 170 CYS HB3 H N N 171 CYS HG H N N 172 CYS HXT H N N 173 GLN N N N N 174 GLN CA C N S 175 GLN C C N N 176 GLN O O N N 177 GLN CB C N N 178 GLN CG C N N 179 GLN CD C N N 180 GLN OE1 O N N 181 GLN NE2 N N N 182 GLN OXT O N N 183 GLN H H N N 184 GLN H2 H N N 185 GLN HA H N N 186 GLN HB2 H N N 187 GLN HB3 H N N 188 GLN HG2 H N N 189 GLN HG3 H N N 190 GLN HE21 H N N 191 GLN HE22 H N N 192 GLN HXT H N N 193 GLU N N N N 194 GLU CA C N S 195 GLU C C N N 196 GLU O O N N 197 GLU CB C N N 198 GLU CG C N N 199 GLU CD C N N 200 GLU OE1 O N N 201 GLU OE2 O N N 202 GLU OXT O N N 203 GLU H H N N 204 GLU H2 H N N 205 GLU HA H N N 206 GLU HB2 H N N 207 GLU HB3 H N N 208 GLU HG2 H N N 209 GLU HG3 H N N 210 GLU HE2 H N N 211 GLU HXT H N N 212 GLY N N N N 213 GLY CA C N N 214 GLY C C N N 215 GLY O O N N 216 GLY OXT O N N 217 GLY H H N N 218 GLY H2 H N N 219 GLY HA2 H N N 220 GLY HA3 H N N 221 GLY HXT H N N 222 HIS N N N N 223 HIS CA C N S 224 HIS C C N N 225 HIS O O N N 226 HIS CB C N N 227 HIS CG C Y N 228 HIS ND1 N Y N 229 HIS CD2 C Y N 230 HIS CE1 C Y N 231 HIS NE2 N Y N 232 HIS OXT O N N 233 HIS H H N N 234 HIS H2 H N N 235 HIS HA H N N 236 HIS HB2 H N N 237 HIS HB3 H N N 238 HIS HD1 H N N 239 HIS HD2 H N N 240 HIS HE1 H N N 241 HIS HE2 H N N 242 HIS HXT H N N 243 ILE N N N N 244 ILE CA C N S 245 ILE C C N N 246 ILE O O N N 247 ILE CB C N S 248 ILE CG1 C N N 249 ILE CG2 C N N 250 ILE CD1 C N N 251 ILE OXT O N N 252 ILE H H N N 253 ILE H2 H N N 254 ILE HA H N N 255 ILE HB H N N 256 ILE HG12 H N N 257 ILE HG13 H N N 258 ILE HG21 H N N 259 ILE HG22 H N N 260 ILE HG23 H N N 261 ILE HD11 H N N 262 ILE HD12 H N N 263 ILE HD13 H N N 264 ILE HXT H N N 265 LEU N N N N 266 LEU CA C N S 267 LEU C C N N 268 LEU O O N N 269 LEU CB C N N 270 LEU CG C N N 271 LEU CD1 C N N 272 LEU CD2 C N N 273 LEU OXT O N N 274 LEU H H N N 275 LEU H2 H N N 276 LEU HA H N N 277 LEU HB2 H N N 278 LEU HB3 H N N 279 LEU HG H N N 280 LEU HD11 H N N 281 LEU HD12 H N N 282 LEU HD13 H N N 283 LEU HD21 H N N 284 LEU HD22 H N N 285 LEU HD23 H N N 286 LEU HXT H N N 287 LYS N N N N 288 LYS CA C N S 289 LYS C C N N 290 LYS O O N N 291 LYS CB C N N 292 LYS CG C N N 293 LYS CD C N N 294 LYS CE C N N 295 LYS NZ N N N 296 LYS OXT O N N 297 LYS H H N N 298 LYS H2 H N N 299 LYS HA H N N 300 LYS HB2 H N N 301 LYS HB3 H N N 302 LYS HG2 H N N 303 LYS HG3 H N N 304 LYS HD2 H N N 305 LYS HD3 H N N 306 LYS HE2 H N N 307 LYS HE3 H N N 308 LYS HZ1 H N N 309 LYS HZ2 H N N 310 LYS HZ3 H N N 311 LYS HXT H N N 312 MET N N N N 313 MET CA C N S 314 MET C C N N 315 MET O O N N 316 MET CB C N N 317 MET CG C N N 318 MET SD S N N 319 MET CE C N N 320 MET OXT O N N 321 MET H H N N 322 MET H2 H N N 323 MET HA H N N 324 MET HB2 H N N 325 MET HB3 H N N 326 MET HG2 H N N 327 MET HG3 H N N 328 MET HE1 H N N 329 MET HE2 H N N 330 MET HE3 H N N 331 MET HXT H N N 332 PHE N N N N 333 PHE CA C N S 334 PHE C C N N 335 PHE O O N N 336 PHE CB C N N 337 PHE CG C Y N 338 PHE CD1 C Y N 339 PHE CD2 C Y N 340 PHE CE1 C Y N 341 PHE CE2 C Y N 342 PHE CZ C Y N 343 PHE OXT O N N 344 PHE H H N N 345 PHE H2 H N N 346 PHE HA H N N 347 PHE HB2 H N N 348 PHE HB3 H N N 349 PHE HD1 H N N 350 PHE HD2 H N N 351 PHE HE1 H N N 352 PHE HE2 H N N 353 PHE HZ H N N 354 PHE HXT H N N 355 PRO N N N N 356 PRO CA C N S 357 PRO C C N N 358 PRO O O N N 359 PRO CB C N N 360 PRO CG C N N 361 PRO CD C N N 362 PRO OXT O N N 363 PRO H H N N 364 PRO HA H N N 365 PRO HB2 H N N 366 PRO HB3 H N N 367 PRO HG2 H N N 368 PRO HG3 H N N 369 PRO HD2 H N N 370 PRO HD3 H N N 371 PRO HXT H N N 372 SER N N N N 373 SER CA C N S 374 SER C C N N 375 SER O O N N 376 SER CB C N N 377 SER OG O N N 378 SER OXT O N N 379 SER H H N N 380 SER H2 H N N 381 SER HA H N N 382 SER HB2 H N N 383 SER HB3 H N N 384 SER HG H N N 385 SER HXT H N N 386 THR N N N N 387 THR CA C N S 388 THR C C N N 389 THR O O N N 390 THR CB C N R 391 THR OG1 O N N 392 THR CG2 C N N 393 THR OXT O N N 394 THR H H N N 395 THR H2 H N N 396 THR HA H N N 397 THR HB H N N 398 THR HG1 H N N 399 THR HG21 H N N 400 THR HG22 H N N 401 THR HG23 H N N 402 THR HXT H N N 403 TRP N N N N 404 TRP CA C N S 405 TRP C C N N 406 TRP O O N N 407 TRP CB C N N 408 TRP CG C Y N 409 TRP CD1 C Y N 410 TRP CD2 C Y N 411 TRP NE1 N Y N 412 TRP CE2 C Y N 413 TRP CE3 C Y N 414 TRP CZ2 C Y N 415 TRP CZ3 C Y N 416 TRP CH2 C Y N 417 TRP OXT O N N 418 TRP H H N N 419 TRP H2 H N N 420 TRP HA H N N 421 TRP HB2 H N N 422 TRP HB3 H N N 423 TRP HD1 H N N 424 TRP HE1 H N N 425 TRP HE3 H N N 426 TRP HZ2 H N N 427 TRP HZ3 H N N 428 TRP HH2 H N N 429 TRP HXT H N N 430 TYR N N N N 431 TYR CA C N S 432 TYR C C N N 433 TYR O O N N 434 TYR CB C N N 435 TYR CG C Y N 436 TYR CD1 C Y N 437 TYR CD2 C Y N 438 TYR CE1 C Y N 439 TYR CE2 C Y N 440 TYR CZ C Y N 441 TYR OH O N N 442 TYR OXT O N N 443 TYR H H N N 444 TYR H2 H N N 445 TYR HA H N N 446 TYR HB2 H N N 447 TYR HB3 H N N 448 TYR HD1 H N N 449 TYR HD2 H N N 450 TYR HE1 H N N 451 TYR HE2 H N N 452 TYR HH H N N 453 TYR HXT H N N 454 VAL N N N N 455 VAL CA C N S 456 VAL C C N N 457 VAL O O N N 458 VAL CB C N N 459 VAL CG1 C N N 460 VAL CG2 C N N 461 VAL OXT O N N 462 VAL H H N N 463 VAL H2 H N N 464 VAL HA H N N 465 VAL HB H N N 466 VAL HG11 H N N 467 VAL HG12 H N N 468 VAL HG13 H N N 469 VAL HG21 H N N 470 VAL HG22 H N N 471 VAL HG23 H N N 472 VAL HXT H N N 473 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 1PG C2 O1 sing N N 1 1PG C2 C3 sing N N 2 1PG C2 H21 sing N N 3 1PG C2 H22 sing N N 4 1PG C1 O1 sing N N 5 1PG C1 H11 sing N N 6 1PG C1 H12 sing N N 7 1PG C1 H13 sing N N 8 1PG O2 C3 sing N N 9 1PG O2 C4 sing N N 10 1PG C3 H31 sing N N 11 1PG C3 H32 sing N N 12 1PG C4 C5 sing N N 13 1PG C4 H41 sing N N 14 1PG C4 H42 sing N N 15 1PG C5 O3 sing N N 16 1PG C5 H51 sing N N 17 1PG C5 H52 sing N N 18 1PG O3 C6 sing N N 19 1PG C6 C7 sing N N 20 1PG C6 H61 sing N N 21 1PG C6 H62 sing N N 22 1PG C7 O4 sing N N 23 1PG C7 H71 sing N N 24 1PG C7 H72 sing N N 25 1PG O4 C8 sing N N 26 1PG C8 C9 sing N N 27 1PG C8 H81 sing N N 28 1PG C8 H82 sing N N 29 1PG C9 O5 sing N N 30 1PG C9 H91 sing N N 31 1PG C9 H92 sing N N 32 1PG O5 C10 sing N N 33 1PG C10 C11 sing N N 34 1PG C10 H101 sing N N 35 1PG C10 H102 sing N N 36 1PG C11 O6 sing N N 37 1PG C11 H111 sing N N 38 1PG C11 H112 sing N N 39 1PG O6 HO6 sing N N 40 A1EBR C1 O2 sing N N 41 A1EBR C1 O1 doub N N 42 A1EBR C1 C3 sing N N 43 A1EBR C10 C11 sing N N 44 A1EBR C10 N1 sing N N 45 A1EBR C11 C14 doub Y N 46 A1EBR C11 S2 sing Y N 47 A1EBR C12 S2 sing Y N 48 A1EBR C12 C13 doub Y N 49 A1EBR C12 C18 sing Y N 50 A1EBR C13 C15 sing Y N 51 A1EBR C13 C14 sing Y N 52 A1EBR C15 C16 doub Y N 53 A1EBR C16 C17 sing Y N 54 A1EBR C17 C18 doub Y N 55 A1EBR C2 O2 sing N N 56 A1EBR C3 C4 doub N Z 57 A1EBR C4 C5 sing N N 58 A1EBR C5 O3 doub N N 59 A1EBR C5 N1 sing N N 60 A1EBR C6 C9 sing N N 61 A1EBR C6 N1 sing N N 62 A1EBR C6 C7 sing N N 63 A1EBR C7 C8 sing N N 64 A1EBR C8 S1 sing N N 65 A1EBR C9 S1 sing N N 66 A1EBR O4 S1 doub N N 67 A1EBR O5 S1 doub N N 68 A1EBR C4 H12 sing N N 69 A1EBR C6 H13 sing N N 70 A1EBR C7 H14 sing N N 71 A1EBR C7 H15 sing N N 72 A1EBR C8 H16 sing N N 73 A1EBR C8 H17 sing N N 74 A1EBR C10 H2 sing N N 75 A1EBR C10 H1 sing N N 76 A1EBR C15 H4 sing N N 77 A1EBR C17 H6 sing N N 78 A1EBR C14 H3 sing N N 79 A1EBR C16 H5 sing N N 80 A1EBR C18 H7 sing N N 81 A1EBR C2 H9 sing N N 82 A1EBR C2 H8 sing N N 83 A1EBR C2 H10 sing N N 84 A1EBR C3 H11 sing N N 85 A1EBR C9 H19 sing N N 86 A1EBR C9 H18 sing N N 87 ALA N CA sing N N 88 ALA N H sing N N 89 ALA N H2 sing N N 90 ALA CA C sing N N 91 ALA CA CB sing N N 92 ALA CA HA sing N N 93 ALA C O doub N N 94 ALA C OXT sing N N 95 ALA CB HB1 sing N N 96 ALA CB HB2 sing N N 97 ALA CB HB3 sing N N 98 ALA OXT HXT sing N N 99 ARG N CA sing N N 100 ARG N H sing N N 101 ARG N H2 sing N N 102 ARG CA C sing N N 103 ARG CA CB sing N N 104 ARG CA HA sing N N 105 ARG C O doub N N 106 ARG C OXT sing N N 107 ARG CB CG sing N N 108 ARG CB HB2 sing N N 109 ARG CB HB3 sing N N 110 ARG CG CD sing N N 111 ARG CG HG2 sing N N 112 ARG CG HG3 sing N N 113 ARG CD NE sing N N 114 ARG CD HD2 sing N N 115 ARG CD HD3 sing N N 116 ARG NE CZ sing N N 117 ARG NE HE sing N N 118 ARG CZ NH1 sing N N 119 ARG CZ NH2 doub N N 120 ARG NH1 HH11 sing N N 121 ARG NH1 HH12 sing N N 122 ARG NH2 HH21 sing N N 123 ARG NH2 HH22 sing N N 124 ARG OXT HXT sing N N 125 ASN N CA sing N N 126 ASN N H sing N N 127 ASN N H2 sing N N 128 ASN CA C sing N N 129 ASN CA CB sing N N 130 ASN CA HA sing N N 131 ASN C O doub N N 132 ASN C OXT sing N N 133 ASN CB CG sing N N 134 ASN CB HB2 sing N N 135 ASN CB HB3 sing N N 136 ASN CG OD1 doub N N 137 ASN CG ND2 sing N N 138 ASN ND2 HD21 sing N N 139 ASN ND2 HD22 sing N N 140 ASN OXT HXT sing N N 141 ASP N CA sing N N 142 ASP N H sing N N 143 ASP N H2 sing N N 144 ASP CA C sing N N 145 ASP CA CB sing N N 146 ASP CA HA sing N N 147 ASP C O doub N N 148 ASP C OXT sing N N 149 ASP CB CG sing N N 150 ASP CB HB2 sing N N 151 ASP CB HB3 sing N N 152 ASP CG OD1 doub N N 153 ASP CG OD2 sing N N 154 ASP OD2 HD2 sing N N 155 ASP OXT HXT sing N N 156 CYS N CA sing N N 157 CYS N H sing N N 158 CYS N H2 sing N N 159 CYS CA C sing N N 160 CYS CA CB sing N N 161 CYS CA HA sing N N 162 CYS C O doub N N 163 CYS C OXT sing N N 164 CYS CB SG sing N N 165 CYS CB HB2 sing N N 166 CYS CB HB3 sing N N 167 CYS SG HG sing N N 168 CYS OXT HXT sing N N 169 GLN N CA sing N N 170 GLN N H sing N N 171 GLN N H2 sing N N 172 GLN CA C sing N N 173 GLN CA CB sing N N 174 GLN CA HA sing N N 175 GLN C O doub N N 176 GLN C OXT sing N N 177 GLN CB CG sing N N 178 GLN CB HB2 sing N N 179 GLN CB HB3 sing N N 180 GLN CG CD sing N N 181 GLN CG HG2 sing N N 182 GLN CG HG3 sing N N 183 GLN CD OE1 doub N N 184 GLN CD NE2 sing N N 185 GLN NE2 HE21 sing N N 186 GLN NE2 HE22 sing N N 187 GLN OXT HXT sing N N 188 GLU N CA sing N N 189 GLU N H sing N N 190 GLU N H2 sing N N 191 GLU CA C sing N N 192 GLU CA CB sing N N 193 GLU CA HA sing N N 194 GLU C O doub N N 195 GLU C OXT sing N N 196 GLU CB CG sing N N 197 GLU CB HB2 sing N N 198 GLU CB HB3 sing N N 199 GLU CG CD sing N N 200 GLU CG HG2 sing N N 201 GLU CG HG3 sing N N 202 GLU CD OE1 doub N N 203 GLU CD OE2 sing N N 204 GLU OE2 HE2 sing N N 205 GLU OXT HXT sing N N 206 GLY N CA sing N N 207 GLY N H sing N N 208 GLY N H2 sing N N 209 GLY CA C sing N N 210 GLY CA HA2 sing N N 211 GLY CA HA3 sing N N 212 GLY C O doub N N 213 GLY C OXT sing N N 214 GLY OXT HXT sing N N 215 HIS N CA sing N N 216 HIS N H sing N N 217 HIS N H2 sing N N 218 HIS CA C sing N N 219 HIS CA CB sing N N 220 HIS CA HA sing N N 221 HIS C O doub N N 222 HIS C OXT sing N N 223 HIS CB CG sing N N 224 HIS CB HB2 sing N N 225 HIS CB HB3 sing N N 226 HIS CG ND1 sing Y N 227 HIS CG CD2 doub Y N 228 HIS ND1 CE1 doub Y N 229 HIS ND1 HD1 sing N N 230 HIS CD2 NE2 sing Y N 231 HIS CD2 HD2 sing N N 232 HIS CE1 NE2 sing Y N 233 HIS CE1 HE1 sing N N 234 HIS NE2 HE2 sing N N 235 HIS OXT HXT sing N N 236 ILE N CA sing N N 237 ILE N H sing N N 238 ILE N H2 sing N N 239 ILE CA C sing N N 240 ILE CA CB sing N N 241 ILE CA HA sing N N 242 ILE C O doub N N 243 ILE C OXT sing N N 244 ILE CB CG1 sing N N 245 ILE CB CG2 sing N N 246 ILE CB HB sing N N 247 ILE CG1 CD1 sing N N 248 ILE CG1 HG12 sing N N 249 ILE CG1 HG13 sing N N 250 ILE CG2 HG21 sing N N 251 ILE CG2 HG22 sing N N 252 ILE CG2 HG23 sing N N 253 ILE CD1 HD11 sing N N 254 ILE CD1 HD12 sing N N 255 ILE CD1 HD13 sing N N 256 ILE OXT HXT sing N N 257 LEU N CA sing N N 258 LEU N H sing N N 259 LEU N H2 sing N N 260 LEU CA C sing N N 261 LEU CA CB sing N N 262 LEU CA HA sing N N 263 LEU C O doub N N 264 LEU C OXT sing N N 265 LEU CB CG sing N N 266 LEU CB HB2 sing N N 267 LEU CB HB3 sing N N 268 LEU CG CD1 sing N N 269 LEU CG CD2 sing N N 270 LEU CG HG sing N N 271 LEU CD1 HD11 sing N N 272 LEU CD1 HD12 sing N N 273 LEU CD1 HD13 sing N N 274 LEU CD2 HD21 sing N N 275 LEU CD2 HD22 sing N N 276 LEU CD2 HD23 sing N N 277 LEU OXT HXT sing N N 278 LYS N CA sing N N 279 LYS N H sing N N 280 LYS N H2 sing N N 281 LYS CA C sing N N 282 LYS CA CB sing N N 283 LYS CA HA sing N N 284 LYS C O doub N N 285 LYS C OXT sing N N 286 LYS CB CG sing N N 287 LYS CB HB2 sing N N 288 LYS CB HB3 sing N N 289 LYS CG CD sing N N 290 LYS CG HG2 sing N N 291 LYS CG HG3 sing N N 292 LYS CD CE sing N N 293 LYS CD HD2 sing N N 294 LYS CD HD3 sing N N 295 LYS CE NZ sing N N 296 LYS CE HE2 sing N N 297 LYS CE HE3 sing N N 298 LYS NZ HZ1 sing N N 299 LYS NZ HZ2 sing N N 300 LYS NZ HZ3 sing N N 301 LYS OXT HXT sing N N 302 MET N CA sing N N 303 MET N H sing N N 304 MET N H2 sing N N 305 MET CA C sing N N 306 MET CA CB sing N N 307 MET CA HA sing N N 308 MET C O doub N N 309 MET C OXT sing N N 310 MET CB CG sing N N 311 MET CB HB2 sing N N 312 MET CB HB3 sing N N 313 MET CG SD sing N N 314 MET CG HG2 sing N N 315 MET CG HG3 sing N N 316 MET SD CE sing N N 317 MET CE HE1 sing N N 318 MET CE HE2 sing N N 319 MET CE HE3 sing N N 320 MET OXT HXT sing N N 321 PHE N CA sing N N 322 PHE N H sing N N 323 PHE N H2 sing N N 324 PHE CA C sing N N 325 PHE CA CB sing N N 326 PHE CA HA sing N N 327 PHE C O doub N N 328 PHE C OXT sing N N 329 PHE CB CG sing N N 330 PHE CB HB2 sing N N 331 PHE CB HB3 sing N N 332 PHE CG CD1 doub Y N 333 PHE CG CD2 sing Y N 334 PHE CD1 CE1 sing Y N 335 PHE CD1 HD1 sing N N 336 PHE CD2 CE2 doub Y N 337 PHE CD2 HD2 sing N N 338 PHE CE1 CZ doub Y N 339 PHE CE1 HE1 sing N N 340 PHE CE2 CZ sing Y N 341 PHE CE2 HE2 sing N N 342 PHE CZ HZ sing N N 343 PHE OXT HXT sing N N 344 PRO N CA sing N N 345 PRO N CD sing N N 346 PRO N H sing N N 347 PRO CA C sing N N 348 PRO CA CB sing N N 349 PRO CA HA sing N N 350 PRO C O doub N N 351 PRO C OXT sing N N 352 PRO CB CG sing N N 353 PRO CB HB2 sing N N 354 PRO CB HB3 sing N N 355 PRO CG CD sing N N 356 PRO CG HG2 sing N N 357 PRO CG HG3 sing N N 358 PRO CD HD2 sing N N 359 PRO CD HD3 sing N N 360 PRO OXT HXT sing N N 361 SER N CA sing N N 362 SER N H sing N N 363 SER N H2 sing N N 364 SER CA C sing N N 365 SER CA CB sing N N 366 SER CA HA sing N N 367 SER C O doub N N 368 SER C OXT sing N N 369 SER CB OG sing N N 370 SER CB HB2 sing N N 371 SER CB HB3 sing N N 372 SER OG HG sing N N 373 SER OXT HXT sing N N 374 THR N CA sing N N 375 THR N H sing N N 376 THR N H2 sing N N 377 THR CA C sing N N 378 THR CA CB sing N N 379 THR CA HA sing N N 380 THR C O doub N N 381 THR C OXT sing N N 382 THR CB OG1 sing N N 383 THR CB CG2 sing N N 384 THR CB HB sing N N 385 THR OG1 HG1 sing N N 386 THR CG2 HG21 sing N N 387 THR CG2 HG22 sing N N 388 THR CG2 HG23 sing N N 389 THR OXT HXT sing N N 390 TRP N CA sing N N 391 TRP N H sing N N 392 TRP N H2 sing N N 393 TRP CA C sing N N 394 TRP CA CB sing N N 395 TRP CA HA sing N N 396 TRP C O doub N N 397 TRP C OXT sing N N 398 TRP CB CG sing N N 399 TRP CB HB2 sing N N 400 TRP CB HB3 sing N N 401 TRP CG CD1 doub Y N 402 TRP CG CD2 sing Y N 403 TRP CD1 NE1 sing Y N 404 TRP CD1 HD1 sing N N 405 TRP CD2 CE2 doub Y N 406 TRP CD2 CE3 sing Y N 407 TRP NE1 CE2 sing Y N 408 TRP NE1 HE1 sing N N 409 TRP CE2 CZ2 sing Y N 410 TRP CE3 CZ3 doub Y N 411 TRP CE3 HE3 sing N N 412 TRP CZ2 CH2 doub Y N 413 TRP CZ2 HZ2 sing N N 414 TRP CZ3 CH2 sing Y N 415 TRP CZ3 HZ3 sing N N 416 TRP CH2 HH2 sing N N 417 TRP OXT HXT sing N N 418 TYR N CA sing N N 419 TYR N H sing N N 420 TYR N H2 sing N N 421 TYR CA C sing N N 422 TYR CA CB sing N N 423 TYR CA HA sing N N 424 TYR C O doub N N 425 TYR C OXT sing N N 426 TYR CB CG sing N N 427 TYR CB HB2 sing N N 428 TYR CB HB3 sing N N 429 TYR CG CD1 doub Y N 430 TYR CG CD2 sing Y N 431 TYR CD1 CE1 sing Y N 432 TYR CD1 HD1 sing N N 433 TYR CD2 CE2 doub Y N 434 TYR CD2 HD2 sing N N 435 TYR CE1 CZ doub Y N 436 TYR CE1 HE1 sing N N 437 TYR CE2 CZ sing Y N 438 TYR CE2 HE2 sing N N 439 TYR CZ OH sing N N 440 TYR OH HH sing N N 441 TYR OXT HXT sing N N 442 VAL N CA sing N N 443 VAL N H sing N N 444 VAL N H2 sing N N 445 VAL CA C sing N N 446 VAL CA CB sing N N 447 VAL CA HA sing N N 448 VAL C O doub N N 449 VAL C OXT sing N N 450 VAL CB CG1 sing N N 451 VAL CB CG2 sing N N 452 VAL CB HB sing N N 453 VAL CG1 HG11 sing N N 454 VAL CG1 HG12 sing N N 455 VAL CG1 HG13 sing N N 456 VAL CG2 HG21 sing N N 457 VAL CG2 HG22 sing N N 458 VAL CG2 HG23 sing N N 459 VAL OXT HXT sing N N 460 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 82104009 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6VAJ _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 31 2 1' _space_group.name_Hall ;P 31 2" ; _space_group.IT_number 152 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9JF6 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.014460 _atom_sites.fract_transf_matrix[1][2] 0.008349 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016697 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012578 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #