data_9JM2 # _entry.id 9JM2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.407 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9JM2 pdb_00009jm2 10.2210/pdb9jm2/pdb WWPDB D_1300051657 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-08-27 ? 2 'Structure model' 1 1 2025-09-10 ? 3 'Structure model' 1 2 2025-12-17 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9JM2 _pdbx_database_status.recvd_initial_deposition_date 2024-09-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 caolongxing@westlake.edu.cn Longxing Cao ? 'principal investigator/group leader' 0000-0003-4002-3648 3 yubowen@westlake.edu.cn Bowen Yu ? 'principal investigator/group leader' 0000-0002-0852-6280 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yu, B.' 1 0000-0002-0852-6280 'Cao, L.' 2 0000-0003-4002-3648 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nat.Chem. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1755-4349 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 17 _citation.language ? _citation.page_first 1910 _citation.page_last 1919 _citation.title 'De novo design of light-responsive protein-protein interactions enables reversible formation of protein assemblies.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41557-025-01929-2 _citation.pdbx_database_id_PubMed 40877575 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yu, B.' 1 ? primary 'Liu, J.' 2 ? primary 'Cui, Z.' 3 ? primary 'Wang, C.' 4 ? primary 'Chen, P.' 5 ? primary 'Wang, C.' 6 ? primary 'Zhang, Y.' 7 ? primary 'Zhu, X.' 8 ? primary 'Zhang, Z.' 9 ? primary 'Li, S.' 10 ? primary 'Pan, J.' 11 ? primary 'Xie, M.' 12 ? primary 'Shen, H.' 13 ? primary 'Cao, L.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man LRO-C2-35 8636.998 2 ? ? ? ? 2 water nat water 18.015 123 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'MGEFEKRAKELIERAKKLNTPAAKVIEEALKL(OZW)IEAYKEAKKKGDALQQALLEESLAQAEEMLRRLEHHHHHH' _entity_poly.pdbx_seq_one_letter_code_can MGEFEKRAKELIERAKKLNTPAAKVIEEALKLFIEAYKEAKKKGDALQQALLEESLAQAEEMLRRLEHHHHHH _entity_poly.pdbx_strand_id B,A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 GLU n 1 4 PHE n 1 5 GLU n 1 6 LYS n 1 7 ARG n 1 8 ALA n 1 9 LYS n 1 10 GLU n 1 11 LEU n 1 12 ILE n 1 13 GLU n 1 14 ARG n 1 15 ALA n 1 16 LYS n 1 17 LYS n 1 18 LEU n 1 19 ASN n 1 20 THR n 1 21 PRO n 1 22 ALA n 1 23 ALA n 1 24 LYS n 1 25 VAL n 1 26 ILE n 1 27 GLU n 1 28 GLU n 1 29 ALA n 1 30 LEU n 1 31 LYS n 1 32 LEU n 1 33 OZW n 1 34 ILE n 1 35 GLU n 1 36 ALA n 1 37 TYR n 1 38 LYS n 1 39 GLU n 1 40 ALA n 1 41 LYS n 1 42 LYS n 1 43 LYS n 1 44 GLY n 1 45 ASP n 1 46 ALA n 1 47 LEU n 1 48 GLN n 1 49 GLN n 1 50 ALA n 1 51 LEU n 1 52 LEU n 1 53 GLU n 1 54 GLU n 1 55 SER n 1 56 LEU n 1 57 ALA n 1 58 GLN n 1 59 ALA n 1 60 GLU n 1 61 GLU n 1 62 MET n 1 63 LEU n 1 64 ARG n 1 65 ARG n 1 66 LEU n 1 67 GLU n 1 68 HIS n 1 69 HIS n 1 70 HIS n 1 71 HIS n 1 72 HIS n 1 73 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 73 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 OZW 'L-peptide linking' n 'phenylhydrazinyl phenylalanine' ? 'C15 H17 N3 O2' 271.314 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET B . n A 1 2 GLY 2 2 2 GLY GLY B . n A 1 3 GLU 3 3 3 GLU GLU B . n A 1 4 PHE 4 4 4 PHE PHE B . n A 1 5 GLU 5 5 5 GLU GLU B . n A 1 6 LYS 6 6 6 LYS LYS B . n A 1 7 ARG 7 7 7 ARG ARG B . n A 1 8 ALA 8 8 8 ALA ALA B . n A 1 9 LYS 9 9 9 LYS LYS B . n A 1 10 GLU 10 10 10 GLU GLU B . n A 1 11 LEU 11 11 11 LEU LEU B . n A 1 12 ILE 12 12 12 ILE ILE B . n A 1 13 GLU 13 13 13 GLU GLU B . n A 1 14 ARG 14 14 14 ARG ARG B . n A 1 15 ALA 15 15 15 ALA ALA B . n A 1 16 LYS 16 16 16 LYS LYS B . n A 1 17 LYS 17 17 17 LYS LYS B . n A 1 18 LEU 18 18 18 LEU LEU B . n A 1 19 ASN 19 19 19 ASN ASN B . n A 1 20 THR 20 20 20 THR THR B . n A 1 21 PRO 21 21 21 PRO PRO B . n A 1 22 ALA 22 22 22 ALA ALA B . n A 1 23 ALA 23 23 23 ALA ALA B . n A 1 24 LYS 24 24 24 LYS LYS B . n A 1 25 VAL 25 25 25 VAL VAL B . n A 1 26 ILE 26 26 26 ILE ILE B . n A 1 27 GLU 27 27 27 GLU GLU B . n A 1 28 GLU 28 28 28 GLU GLU B . n A 1 29 ALA 29 29 29 ALA ALA B . n A 1 30 LEU 30 30 30 LEU LEU B . n A 1 31 LYS 31 31 31 LYS LYS B . n A 1 32 LEU 32 32 32 LEU LEU B . n A 1 33 OZW 33 33 33 OZW AFT B . n A 1 34 ILE 34 34 34 ILE ILE B . n A 1 35 GLU 35 35 35 GLU GLU B . n A 1 36 ALA 36 36 36 ALA ALA B . n A 1 37 TYR 37 37 37 TYR TYR B . n A 1 38 LYS 38 38 38 LYS LYS B . n A 1 39 GLU 39 39 39 GLU GLU B . n A 1 40 ALA 40 40 40 ALA ALA B . n A 1 41 LYS 41 41 41 LYS LYS B . n A 1 42 LYS 42 42 42 LYS LYS B . n A 1 43 LYS 43 43 43 LYS LYS B . n A 1 44 GLY 44 44 44 GLY GLY B . n A 1 45 ASP 45 45 45 ASP ASP B . n A 1 46 ALA 46 46 46 ALA ALA B . n A 1 47 LEU 47 47 47 LEU LEU B . n A 1 48 GLN 48 48 48 GLN GLN B . n A 1 49 GLN 49 49 49 GLN GLN B . n A 1 50 ALA 50 50 50 ALA ALA B . n A 1 51 LEU 51 51 51 LEU LEU B . n A 1 52 LEU 52 52 52 LEU LEU B . n A 1 53 GLU 53 53 53 GLU GLU B . n A 1 54 GLU 54 54 54 GLU GLU B . n A 1 55 SER 55 55 55 SER SER B . n A 1 56 LEU 56 56 56 LEU LEU B . n A 1 57 ALA 57 57 57 ALA ALA B . n A 1 58 GLN 58 58 58 GLN GLN B . n A 1 59 ALA 59 59 59 ALA ALA B . n A 1 60 GLU 60 60 60 GLU GLU B . n A 1 61 GLU 61 61 61 GLU GLU B . n A 1 62 MET 62 62 62 MET MET B . n A 1 63 LEU 63 63 63 LEU LEU B . n A 1 64 ARG 64 64 64 ARG ARG B . n A 1 65 ARG 65 65 65 ARG ARG B . n A 1 66 LEU 66 66 66 LEU LEU B . n A 1 67 GLU 67 67 67 GLU GLU B . n A 1 68 HIS 68 68 68 HIS HIS B . n A 1 69 HIS 69 69 69 HIS HIS B . n A 1 70 HIS 70 70 ? ? ? B . n A 1 71 HIS 71 71 ? ? ? B . n A 1 72 HIS 72 72 ? ? ? B . n A 1 73 HIS 73 73 ? ? ? B . n B 1 1 MET 1 1 ? ? ? A . n B 1 2 GLY 2 2 2 GLY GLY A . n B 1 3 GLU 3 3 3 GLU GLU A . n B 1 4 PHE 4 4 4 PHE PHE A . n B 1 5 GLU 5 5 5 GLU GLU A . n B 1 6 LYS 6 6 6 LYS LYS A . n B 1 7 ARG 7 7 7 ARG ARG A . n B 1 8 ALA 8 8 8 ALA ALA A . n B 1 9 LYS 9 9 9 LYS LYS A . n B 1 10 GLU 10 10 10 GLU GLU A . n B 1 11 LEU 11 11 11 LEU LEU A . n B 1 12 ILE 12 12 12 ILE ILE A . n B 1 13 GLU 13 13 13 GLU GLU A . n B 1 14 ARG 14 14 14 ARG ARG A . n B 1 15 ALA 15 15 15 ALA ALA A . n B 1 16 LYS 16 16 16 LYS LYS A . n B 1 17 LYS 17 17 17 LYS LYS A . n B 1 18 LEU 18 18 18 LEU LEU A . n B 1 19 ASN 19 19 19 ASN ASN A . n B 1 20 THR 20 20 20 THR THR A . n B 1 21 PRO 21 21 21 PRO PRO A . n B 1 22 ALA 22 22 22 ALA ALA A . n B 1 23 ALA 23 23 23 ALA ALA A . n B 1 24 LYS 24 24 24 LYS LYS A . n B 1 25 VAL 25 25 25 VAL VAL A . n B 1 26 ILE 26 26 26 ILE ILE A . n B 1 27 GLU 27 27 27 GLU GLU A . n B 1 28 GLU 28 28 28 GLU GLU A . n B 1 29 ALA 29 29 29 ALA ALA A . n B 1 30 LEU 30 30 30 LEU LEU A . n B 1 31 LYS 31 31 31 LYS LYS A . n B 1 32 LEU 32 32 32 LEU LEU A . n B 1 33 OZW 33 33 33 OZW AFT A . n B 1 34 ILE 34 34 34 ILE ILE A . n B 1 35 GLU 35 35 35 GLU GLU A . n B 1 36 ALA 36 36 36 ALA ALA A . n B 1 37 TYR 37 37 37 TYR TYR A . n B 1 38 LYS 38 38 38 LYS LYS A . n B 1 39 GLU 39 39 39 GLU GLU A . n B 1 40 ALA 40 40 40 ALA ALA A . n B 1 41 LYS 41 41 41 LYS LYS A . n B 1 42 LYS 42 42 42 LYS LYS A . n B 1 43 LYS 43 43 43 LYS LYS A . n B 1 44 GLY 44 44 44 GLY GLY A . n B 1 45 ASP 45 45 45 ASP ASP A . n B 1 46 ALA 46 46 46 ALA ALA A . n B 1 47 LEU 47 47 47 LEU LEU A . n B 1 48 GLN 48 48 48 GLN GLN A . n B 1 49 GLN 49 49 49 GLN GLN A . n B 1 50 ALA 50 50 50 ALA ALA A . n B 1 51 LEU 51 51 51 LEU LEU A . n B 1 52 LEU 52 52 52 LEU LEU A . n B 1 53 GLU 53 53 53 GLU GLU A . n B 1 54 GLU 54 54 54 GLU GLU A . n B 1 55 SER 55 55 55 SER SER A . n B 1 56 LEU 56 56 56 LEU LEU A . n B 1 57 ALA 57 57 57 ALA ALA A . n B 1 58 GLN 58 58 58 GLN GLN A . n B 1 59 ALA 59 59 59 ALA ALA A . n B 1 60 GLU 60 60 60 GLU GLU A . n B 1 61 GLU 61 61 61 GLU GLU A . n B 1 62 MET 62 62 62 MET MET A . n B 1 63 LEU 63 63 63 LEU LEU A . n B 1 64 ARG 64 64 64 ARG ARG A . n B 1 65 ARG 65 65 65 ARG ARG A . n B 1 66 LEU 66 66 66 LEU LEU A . n B 1 67 GLU 67 67 67 GLU GLU A . n B 1 68 HIS 68 68 68 HIS HIS A . n B 1 69 HIS 69 69 ? ? ? A . n B 1 70 HIS 70 70 ? ? ? A . n B 1 71 HIS 71 71 ? ? ? A . n B 1 72 HIS 72 72 ? ? ? A . n B 1 73 HIS 73 73 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id OZW _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id OZW _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 101 120 HOH HOH B . C 2 HOH 2 102 81 HOH HOH B . C 2 HOH 3 103 117 HOH HOH B . C 2 HOH 4 104 85 HOH HOH B . C 2 HOH 5 105 80 HOH HOH B . C 2 HOH 6 106 44 HOH HOH B . C 2 HOH 7 107 57 HOH HOH B . C 2 HOH 8 108 14 HOH HOH B . C 2 HOH 9 109 93 HOH HOH B . C 2 HOH 10 110 66 HOH HOH B . C 2 HOH 11 111 34 HOH HOH B . C 2 HOH 12 112 31 HOH HOH B . C 2 HOH 13 113 106 HOH HOH B . C 2 HOH 14 114 20 HOH HOH B . C 2 HOH 15 115 113 HOH HOH B . C 2 HOH 16 116 79 HOH HOH B . C 2 HOH 17 117 5 HOH HOH B . C 2 HOH 18 118 15 HOH HOH B . C 2 HOH 19 119 77 HOH HOH B . C 2 HOH 20 120 71 HOH HOH B . C 2 HOH 21 121 42 HOH HOH B . C 2 HOH 22 122 90 HOH HOH B . C 2 HOH 23 123 7 HOH HOH B . C 2 HOH 24 124 37 HOH HOH B . C 2 HOH 25 125 2 HOH HOH B . C 2 HOH 26 126 3 HOH HOH B . C 2 HOH 27 127 96 HOH HOH B . C 2 HOH 28 128 33 HOH HOH B . C 2 HOH 29 129 16 HOH HOH B . C 2 HOH 30 130 110 HOH HOH B . C 2 HOH 31 131 19 HOH HOH B . C 2 HOH 32 132 49 HOH HOH B . C 2 HOH 33 133 95 HOH HOH B . C 2 HOH 34 134 12 HOH HOH B . C 2 HOH 35 135 35 HOH HOH B . C 2 HOH 36 136 112 HOH HOH B . C 2 HOH 37 137 48 HOH HOH B . C 2 HOH 38 138 115 HOH HOH B . C 2 HOH 39 139 53 HOH HOH B . C 2 HOH 40 140 89 HOH HOH B . C 2 HOH 41 141 52 HOH HOH B . C 2 HOH 42 142 23 HOH HOH B . C 2 HOH 43 143 125 HOH HOH B . C 2 HOH 44 144 124 HOH HOH B . C 2 HOH 45 145 72 HOH HOH B . C 2 HOH 46 146 30 HOH HOH B . C 2 HOH 47 147 8 HOH HOH B . C 2 HOH 48 148 97 HOH HOH B . C 2 HOH 49 149 119 HOH HOH B . C 2 HOH 50 150 11 HOH HOH B . C 2 HOH 51 151 94 HOH HOH B . C 2 HOH 52 152 86 HOH HOH B . C 2 HOH 53 153 98 HOH HOH B . C 2 HOH 54 154 114 HOH HOH B . C 2 HOH 55 155 73 HOH HOH B . C 2 HOH 56 156 55 HOH HOH B . C 2 HOH 57 157 107 HOH HOH B . C 2 HOH 58 158 62 HOH HOH B . C 2 HOH 59 159 64 HOH HOH B . C 2 HOH 60 160 56 HOH HOH B . C 2 HOH 61 161 69 HOH HOH B . C 2 HOH 62 162 43 HOH HOH B . C 2 HOH 63 163 38 HOH HOH B . C 2 HOH 64 164 10 HOH HOH B . C 2 HOH 65 165 109 HOH HOH B . C 2 HOH 66 166 51 HOH HOH B . D 2 HOH 1 101 21 HOH HOH A . D 2 HOH 2 102 27 HOH HOH A . D 2 HOH 3 103 84 HOH HOH A . D 2 HOH 4 104 82 HOH HOH A . D 2 HOH 5 105 78 HOH HOH A . D 2 HOH 6 106 54 HOH HOH A . D 2 HOH 7 107 108 HOH HOH A . D 2 HOH 8 108 70 HOH HOH A . D 2 HOH 9 109 111 HOH HOH A . D 2 HOH 10 110 67 HOH HOH A . D 2 HOH 11 111 18 HOH HOH A . D 2 HOH 12 112 92 HOH HOH A . D 2 HOH 13 113 4 HOH HOH A . D 2 HOH 14 114 9 HOH HOH A . D 2 HOH 15 115 13 HOH HOH A . D 2 HOH 16 116 22 HOH HOH A . D 2 HOH 17 117 40 HOH HOH A . D 2 HOH 18 118 118 HOH HOH A . D 2 HOH 19 119 46 HOH HOH A . D 2 HOH 20 120 32 HOH HOH A . D 2 HOH 21 121 101 HOH HOH A . D 2 HOH 22 122 87 HOH HOH A . D 2 HOH 23 123 29 HOH HOH A . D 2 HOH 24 124 74 HOH HOH A . D 2 HOH 25 125 6 HOH HOH A . D 2 HOH 26 126 63 HOH HOH A . D 2 HOH 27 127 59 HOH HOH A . D 2 HOH 28 128 47 HOH HOH A . D 2 HOH 29 129 105 HOH HOH A . D 2 HOH 30 130 28 HOH HOH A . D 2 HOH 31 131 41 HOH HOH A . D 2 HOH 32 132 25 HOH HOH A . D 2 HOH 33 133 99 HOH HOH A . D 2 HOH 34 134 61 HOH HOH A . D 2 HOH 35 135 26 HOH HOH A . D 2 HOH 36 136 24 HOH HOH A . D 2 HOH 37 137 39 HOH HOH A . D 2 HOH 38 138 68 HOH HOH A . D 2 HOH 39 139 104 HOH HOH A . D 2 HOH 40 140 88 HOH HOH A . D 2 HOH 41 141 75 HOH HOH A . D 2 HOH 42 142 76 HOH HOH A . D 2 HOH 43 143 1 HOH HOH A . D 2 HOH 44 144 60 HOH HOH A . D 2 HOH 45 145 121 HOH HOH A . D 2 HOH 46 146 103 HOH HOH A . D 2 HOH 47 147 83 HOH HOH A . D 2 HOH 48 148 50 HOH HOH A . D 2 HOH 49 149 123 HOH HOH A . D 2 HOH 50 150 122 HOH HOH A . D 2 HOH 51 151 45 HOH HOH A . D 2 HOH 52 152 36 HOH HOH A . D 2 HOH 53 153 116 HOH HOH A . D 2 HOH 54 154 58 HOH HOH A . D 2 HOH 55 155 17 HOH HOH A . D 2 HOH 56 156 102 HOH HOH A . D 2 HOH 57 157 91 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B HIS 68 ? CG ? A HIS 68 CG 2 1 Y 1 B HIS 68 ? ND1 ? A HIS 68 ND1 3 1 Y 1 B HIS 68 ? CD2 ? A HIS 68 CD2 4 1 Y 1 B HIS 68 ? CE1 ? A HIS 68 CE1 5 1 Y 1 B HIS 68 ? NE2 ? A HIS 68 NE2 6 1 Y 1 B HIS 69 ? ND1 ? A HIS 69 ND1 7 1 Y 1 B HIS 69 ? CD2 ? A HIS 69 CD2 8 1 Y 1 B HIS 69 ? CE1 ? A HIS 69 CE1 9 1 Y 1 B HIS 69 ? NE2 ? A HIS 69 NE2 10 1 Y 1 A GLU 3 ? CG ? B GLU 3 CG 11 1 Y 1 A GLU 3 ? CD ? B GLU 3 CD 12 1 Y 1 A GLU 3 ? OE1 ? B GLU 3 OE1 13 1 Y 1 A GLU 3 ? OE2 ? B GLU 3 OE2 14 1 Y 1 A GLU 67 ? OE2 ? B GLU 67 OE2 15 1 Y 1 A HIS 68 ? CG ? B HIS 68 CG 16 1 Y 1 A HIS 68 ? ND1 ? B HIS 68 ND1 17 1 Y 1 A HIS 68 ? CD2 ? B HIS 68 CD2 18 1 Y 1 A HIS 68 ? CE1 ? B HIS 68 CE1 19 1 Y 1 A HIS 68 ? NE2 ? B HIS 68 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9JM2 _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.940 _cell.length_a_esd ? _cell.length_b 50.664 _cell.length_b_esd ? _cell.length_c 63.923 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9JM2 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9JM2 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% w/v Polyethylene glycol 1,500, 0.1 M Sodium acetate trihydrate pH 4.5' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU HyPix-6000HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-03-16 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'Cu FINE FOCUS' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9JM2 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.6 _reflns.d_resolution_low 29.76 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10296 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 84.59 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.41 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.04369 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.6 _reflns_shell.d_res_low 1.657 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1221 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 1.092 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.307 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.413 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9JM2 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 29.76 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9944 _refine.ls_number_reflns_R_free 989 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.29 _refine.ls_percent_reflns_R_free 9.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2198 _refine.ls_R_factor_R_free 0.2589 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2153 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.06 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.60 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.19 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1095 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 123 _refine_hist.number_atoms_total 1218 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 29.76 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? ? ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.703 ? ? ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 10.670 ? 146 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.053 ? 161 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 ? 190 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.00 2.11 . . 138 1214 94.00 . . . . 0.2217 . . . . . . . . . . . 0.2680 'X-RAY DIFFRACTION' 2.11 2.24 . . 133 1223 94.00 . . . . 0.2167 . . . . . . . . . . . 0.2617 'X-RAY DIFFRACTION' 2.24 2.41 . . 136 1261 96.00 . . . . 0.2348 . . . . . . . . . . . 0.2811 'X-RAY DIFFRACTION' 2.41 2.65 . . 138 1266 96.00 . . . . 0.2187 . . . . . . . . . . . 0.2838 'X-RAY DIFFRACTION' 2.65 3.04 . . 142 1266 96.00 . . . . 0.2351 . . . . . . . . . . . 0.3135 'X-RAY DIFFRACTION' 3.04 3.82 . . 148 1328 99.00 . . . . 0.2147 . . . . . . . . . . . 0.2283 'X-RAY DIFFRACTION' 3.82 29.76 . . 154 1397 99.00 . . . . 0.1992 . . . . . . . . . . . 0.2443 # _struct.entry_id 9JM2 _struct.title 'Crystal structure of de novo designed light-responsive oligomer C2-35 (LRO-C2-35) at acidic pH (pH 4.5)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9JM2 _struct_keywords.text 'light-responsive homodimer, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9JM2 _struct_ref.pdbx_db_accession 9JM2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9JM2 B 1 ? 73 ? 9JM2 1 ? 73 ? 1 73 2 1 9JM2 A 1 ? 73 ? 9JM2 1 ? 73 ? 1 73 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1370 ? 1 MORE -12 ? 1 'SSA (A^2)' 7840 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 2 ? ASN A 19 ? GLY B 2 ASN B 19 1 ? 18 HELX_P HELX_P2 AA2 THR A 20 ? GLY A 44 ? THR B 20 GLY B 44 1 ? 25 HELX_P HELX_P3 AA3 ASP A 45 ? HIS A 68 ? ASP B 45 HIS B 68 1 ? 24 HELX_P HELX_P4 AA4 GLU B 3 ? ASN B 19 ? GLU A 3 ASN A 19 1 ? 17 HELX_P HELX_P5 AA5 THR B 20 ? GLY B 44 ? THR A 20 GLY A 44 1 ? 25 HELX_P HELX_P6 AA6 ASP B 45 ? HIS B 68 ? ASP A 45 HIS A 68 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 32 C ? ? ? 1_555 A OZW 33 N ? ? B LEU 32 B OZW 33 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale2 covale both ? A OZW 33 C ? ? ? 1_555 A ILE 34 N ? ? B OZW 33 B ILE 34 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale3 covale both ? B LEU 32 C ? ? ? 1_555 B OZW 33 N ? ? A LEU 32 A OZW 33 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale4 covale both ? B OZW 33 C ? ? ? 1_555 B ILE 34 N ? ? A OZW 33 A ILE 34 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 OZW A 33 ? . . . . OZW B 33 ? 1_555 . . . . . . . ? 1 OZW None 'Non-standard residue' 2 OZW B 33 ? . . . . OZW A 33 ? 1_555 . . . . . . . ? 1 OZW None 'Non-standard residue' # _pdbx_entry_details.entry_id 9JM2 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 B GLU 3 ? ? O B HOH 101 ? ? 2.02 2 1 OH A TYR 37 ? ? O A HOH 101 ? ? 2.02 3 1 O A HOH 116 ? ? O A HOH 127 ? ? 2.16 4 1 OG1 A THR 20 ? ? O A HOH 102 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 B _pdbx_validate_symm_contact.auth_comp_id_1 HIS _pdbx_validate_symm_contact.auth_seq_id_1 69 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NH2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ARG _pdbx_validate_symm_contact.auth_seq_id_2 7 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_544 _pdbx_validate_symm_contact.dist 2.12 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG B ARG 7 ? ? CD B ARG 7 ? ? NE B ARG 7 ? ? 140.27 111.80 28.47 2.10 N 2 1 CA A LYS 43 ? ? CB A LYS 43 ? ? CG A LYS 43 ? ? 131.11 113.40 17.71 2.20 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id HIS _pdbx_validate_torsion.auth_asym_id B _pdbx_validate_torsion.auth_seq_id 68 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -91.57 _pdbx_validate_torsion.psi 47.97 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B HIS 70 ? A HIS 70 2 1 Y 1 B HIS 71 ? A HIS 71 3 1 Y 1 B HIS 72 ? A HIS 72 4 1 Y 1 B HIS 73 ? A HIS 73 5 1 Y 1 A MET 1 ? B MET 1 6 1 Y 1 A HIS 69 ? B HIS 69 7 1 Y 1 A HIS 70 ? B HIS 70 8 1 Y 1 A HIS 71 ? B HIS 71 9 1 Y 1 A HIS 72 ? B HIS 72 10 1 Y 1 A HIS 73 ? B HIS 73 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 OZW C4 C Y N 236 OZW C5 C Y N 237 OZW C6 C Y N 238 OZW C1 C Y N 239 OZW C2 C Y N 240 OZW C3 C Y N 241 OZW N N N N 242 OZW CA C N S 243 OZW C C N N 244 OZW O O N N 245 OZW CB C N N 246 OZW CG C Y N 247 OZW CD1 C Y N 248 OZW CD2 C Y N 249 OZW CE1 C Y N 250 OZW CE2 C Y N 251 OZW CZ C Y N 252 OZW N1 N N N 253 OZW N2 N N N 254 OZW H41 H N N 255 OZW H51 H N N 256 OZW H11 H N N 257 OZW H21 H N N 258 OZW H31 H N N 259 OZW H H N N 260 OZW H2 H N N 261 OZW HA H N N 262 OZW HB2 H N N 263 OZW HB3 H N N 264 OZW HD11 H N N 265 OZW HD21 H N N 266 OZW HE11 H N N 267 OZW HE21 H N N 268 OZW H12 H N N 269 OZW H22 H N N 270 OZW OXT O N N 271 OZW HXT H N N 272 PHE N N N N 273 PHE CA C N S 274 PHE C C N N 275 PHE O O N N 276 PHE CB C N N 277 PHE CG C Y N 278 PHE CD1 C Y N 279 PHE CD2 C Y N 280 PHE CE1 C Y N 281 PHE CE2 C Y N 282 PHE CZ C Y N 283 PHE OXT O N N 284 PHE H H N N 285 PHE H2 H N N 286 PHE HA H N N 287 PHE HB2 H N N 288 PHE HB3 H N N 289 PHE HD1 H N N 290 PHE HD2 H N N 291 PHE HE1 H N N 292 PHE HE2 H N N 293 PHE HZ H N N 294 PHE HXT H N N 295 PRO N N N N 296 PRO CA C N S 297 PRO C C N N 298 PRO O O N N 299 PRO CB C N N 300 PRO CG C N N 301 PRO CD C N N 302 PRO OXT O N N 303 PRO H H N N 304 PRO HA H N N 305 PRO HB2 H N N 306 PRO HB3 H N N 307 PRO HG2 H N N 308 PRO HG3 H N N 309 PRO HD2 H N N 310 PRO HD3 H N N 311 PRO HXT H N N 312 SER N N N N 313 SER CA C N S 314 SER C C N N 315 SER O O N N 316 SER CB C N N 317 SER OG O N N 318 SER OXT O N N 319 SER H H N N 320 SER H2 H N N 321 SER HA H N N 322 SER HB2 H N N 323 SER HB3 H N N 324 SER HG H N N 325 SER HXT H N N 326 THR N N N N 327 THR CA C N S 328 THR C C N N 329 THR O O N N 330 THR CB C N R 331 THR OG1 O N N 332 THR CG2 C N N 333 THR OXT O N N 334 THR H H N N 335 THR H2 H N N 336 THR HA H N N 337 THR HB H N N 338 THR HG1 H N N 339 THR HG21 H N N 340 THR HG22 H N N 341 THR HG23 H N N 342 THR HXT H N N 343 TYR N N N N 344 TYR CA C N S 345 TYR C C N N 346 TYR O O N N 347 TYR CB C N N 348 TYR CG C Y N 349 TYR CD1 C Y N 350 TYR CD2 C Y N 351 TYR CE1 C Y N 352 TYR CE2 C Y N 353 TYR CZ C Y N 354 TYR OH O N N 355 TYR OXT O N N 356 TYR H H N N 357 TYR H2 H N N 358 TYR HA H N N 359 TYR HB2 H N N 360 TYR HB3 H N N 361 TYR HD1 H N N 362 TYR HD2 H N N 363 TYR HE1 H N N 364 TYR HE2 H N N 365 TYR HH H N N 366 TYR HXT H N N 367 VAL N N N N 368 VAL CA C N S 369 VAL C C N N 370 VAL O O N N 371 VAL CB C N N 372 VAL CG1 C N N 373 VAL CG2 C N N 374 VAL OXT O N N 375 VAL H H N N 376 VAL H2 H N N 377 VAL HA H N N 378 VAL HB H N N 379 VAL HG11 H N N 380 VAL HG12 H N N 381 VAL HG13 H N N 382 VAL HG21 H N N 383 VAL HG22 H N N 384 VAL HG23 H N N 385 VAL HXT H N N 386 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 OZW O C doub N N 224 OZW N CA sing N N 225 OZW CD1 CE1 doub Y N 226 OZW CD1 CG sing Y N 227 OZW C CA sing N N 228 OZW CB CA sing N N 229 OZW CB CG sing N N 230 OZW CE1 CZ sing Y N 231 OZW CG CD2 doub Y N 232 OZW CZ N2 sing N N 233 OZW CZ CE2 doub Y N 234 OZW CD2 CE2 sing Y N 235 OZW N2 N1 sing N N 236 OZW C2 C4 doub Y N 237 OZW C2 C6 sing Y N 238 OZW N1 C6 sing N N 239 OZW C4 C5 sing Y N 240 OZW C6 C1 doub Y N 241 OZW C5 C3 doub Y N 242 OZW C1 C3 sing Y N 243 OZW C4 H41 sing N N 244 OZW C5 H51 sing N N 245 OZW C1 H11 sing N N 246 OZW C2 H21 sing N N 247 OZW C3 H31 sing N N 248 OZW N H sing N N 249 OZW N H2 sing N N 250 OZW CA HA sing N N 251 OZW CB HB2 sing N N 252 OZW CB HB3 sing N N 253 OZW CD1 HD11 sing N N 254 OZW CD2 HD21 sing N N 255 OZW CE1 HE11 sing N N 256 OZW CE2 HE21 sing N N 257 OZW N1 H12 sing N N 258 OZW N2 H22 sing N N 259 OZW C OXT sing N N 260 OZW OXT HXT sing N N 261 PHE N CA sing N N 262 PHE N H sing N N 263 PHE N H2 sing N N 264 PHE CA C sing N N 265 PHE CA CB sing N N 266 PHE CA HA sing N N 267 PHE C O doub N N 268 PHE C OXT sing N N 269 PHE CB CG sing N N 270 PHE CB HB2 sing N N 271 PHE CB HB3 sing N N 272 PHE CG CD1 doub Y N 273 PHE CG CD2 sing Y N 274 PHE CD1 CE1 sing Y N 275 PHE CD1 HD1 sing N N 276 PHE CD2 CE2 doub Y N 277 PHE CD2 HD2 sing N N 278 PHE CE1 CZ doub Y N 279 PHE CE1 HE1 sing N N 280 PHE CE2 CZ sing Y N 281 PHE CE2 HE2 sing N N 282 PHE CZ HZ sing N N 283 PHE OXT HXT sing N N 284 PRO N CA sing N N 285 PRO N CD sing N N 286 PRO N H sing N N 287 PRO CA C sing N N 288 PRO CA CB sing N N 289 PRO CA HA sing N N 290 PRO C O doub N N 291 PRO C OXT sing N N 292 PRO CB CG sing N N 293 PRO CB HB2 sing N N 294 PRO CB HB3 sing N N 295 PRO CG CD sing N N 296 PRO CG HG2 sing N N 297 PRO CG HG3 sing N N 298 PRO CD HD2 sing N N 299 PRO CD HD3 sing N N 300 PRO OXT HXT sing N N 301 SER N CA sing N N 302 SER N H sing N N 303 SER N H2 sing N N 304 SER CA C sing N N 305 SER CA CB sing N N 306 SER CA HA sing N N 307 SER C O doub N N 308 SER C OXT sing N N 309 SER CB OG sing N N 310 SER CB HB2 sing N N 311 SER CB HB3 sing N N 312 SER OG HG sing N N 313 SER OXT HXT sing N N 314 THR N CA sing N N 315 THR N H sing N N 316 THR N H2 sing N N 317 THR CA C sing N N 318 THR CA CB sing N N 319 THR CA HA sing N N 320 THR C O doub N N 321 THR C OXT sing N N 322 THR CB OG1 sing N N 323 THR CB CG2 sing N N 324 THR CB HB sing N N 325 THR OG1 HG1 sing N N 326 THR CG2 HG21 sing N N 327 THR CG2 HG22 sing N N 328 THR CG2 HG23 sing N N 329 THR OXT HXT sing N N 330 TYR N CA sing N N 331 TYR N H sing N N 332 TYR N H2 sing N N 333 TYR CA C sing N N 334 TYR CA CB sing N N 335 TYR CA HA sing N N 336 TYR C O doub N N 337 TYR C OXT sing N N 338 TYR CB CG sing N N 339 TYR CB HB2 sing N N 340 TYR CB HB3 sing N N 341 TYR CG CD1 doub Y N 342 TYR CG CD2 sing Y N 343 TYR CD1 CE1 sing Y N 344 TYR CD1 HD1 sing N N 345 TYR CD2 CE2 doub Y N 346 TYR CD2 HD2 sing N N 347 TYR CE1 CZ doub Y N 348 TYR CE1 HE1 sing N N 349 TYR CE2 CZ sing Y N 350 TYR CE2 HE2 sing N N 351 TYR CZ OH sing N N 352 TYR OH HH sing N N 353 TYR OXT HXT sing N N 354 VAL N CA sing N N 355 VAL N H sing N N 356 VAL N H2 sing N N 357 VAL CA C sing N N 358 VAL CA CB sing N N 359 VAL CA HA sing N N 360 VAL C O doub N N 361 VAL C OXT sing N N 362 VAL CB CG1 sing N N 363 VAL CB CG2 sing N N 364 VAL CB HB sing N N 365 VAL CG1 HG11 sing N N 366 VAL CG1 HG12 sing N N 367 VAL CG1 HG13 sing N N 368 VAL CG2 HG21 sing N N 369 VAL CG2 HG22 sing N N 370 VAL CG2 HG23 sing N N 371 VAL OXT HXT sing N N 372 # _pdbx_audit_support.funding_organization 'Ministry of Science and Technology (MoST, China)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 2022YFA1303700 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'Computational designed model' # _atom_sites.entry_id 9JM2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.022252 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019738 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015644 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #