data_9K5H # _entry.id 9K5H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9K5H pdb_00009k5h 10.2210/pdb9k5h/pdb WWPDB D_1300052822 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-10-22 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9K5H _pdbx_database_status.recvd_initial_deposition_date 2024-10-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email caolongxing@westlake.edu.cn _pdbx_contact_author.name_first longxing _pdbx_contact_author.name_last cao _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4002-3648 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Qu, Y.N.' 1 0000-0001-5398-286X 'Cao, L.X.' 2 0000-0003-4002-3648 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'De novo design of metal ion regulated protein assemblies' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qu, Y.N.' 1 0000-0001-5398-286X primary 'Cao, L.X.' 2 0000-0003-4002-3648 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man C2-Zn2-HEHE-2 10248.548 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 water nat water 18.015 64 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLEVLFQGPGGTSVEELLEELRKLDPRVEELVRELVRKLREEGDPDKARFVADDALHLLRQGVSPEEI ERHLRELLK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLEVLFQGPGGTSVEELLEELRKLDPRVEELVRELVRKLREEGDPDKARFVADDALHLLRQGVSPEEI ERHLRELLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 GLU n 1 16 VAL n 1 17 LEU n 1 18 PHE n 1 19 GLN n 1 20 GLY n 1 21 PRO n 1 22 GLY n 1 23 GLY n 1 24 THR n 1 25 SER n 1 26 VAL n 1 27 GLU n 1 28 GLU n 1 29 LEU n 1 30 LEU n 1 31 GLU n 1 32 GLU n 1 33 LEU n 1 34 ARG n 1 35 LYS n 1 36 LEU n 1 37 ASP n 1 38 PRO n 1 39 ARG n 1 40 VAL n 1 41 GLU n 1 42 GLU n 1 43 LEU n 1 44 VAL n 1 45 ARG n 1 46 GLU n 1 47 LEU n 1 48 VAL n 1 49 ARG n 1 50 LYS n 1 51 LEU n 1 52 ARG n 1 53 GLU n 1 54 GLU n 1 55 GLY n 1 56 ASP n 1 57 PRO n 1 58 ASP n 1 59 LYS n 1 60 ALA n 1 61 ARG n 1 62 PHE n 1 63 VAL n 1 64 ALA n 1 65 ASP n 1 66 ASP n 1 67 ALA n 1 68 LEU n 1 69 HIS n 1 70 LEU n 1 71 LEU n 1 72 ARG n 1 73 GLN n 1 74 GLY n 1 75 VAL n 1 76 SER n 1 77 PRO n 1 78 GLU n 1 79 GLU n 1 80 ILE n 1 81 GLU n 1 82 ARG n 1 83 HIS n 1 84 LEU n 1 85 ARG n 1 86 GLU n 1 87 LEU n 1 88 LEU n 1 89 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 89 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -18 ? ? ? A . n A 1 2 GLY 2 -17 ? ? ? A . n A 1 3 SER 3 -16 ? ? ? A . n A 1 4 SER 4 -15 ? ? ? A . n A 1 5 HIS 5 -14 ? ? ? A . n A 1 6 HIS 6 -13 ? ? ? A . n A 1 7 HIS 7 -12 ? ? ? A . n A 1 8 HIS 8 -11 ? ? ? A . n A 1 9 HIS 9 -10 ? ? ? A . n A 1 10 HIS 10 -9 ? ? ? A . n A 1 11 SER 11 -8 ? ? ? A . n A 1 12 SER 12 -7 ? ? ? A . n A 1 13 GLY 13 -6 ? ? ? A . n A 1 14 LEU 14 -5 ? ? ? A . n A 1 15 GLU 15 -4 ? ? ? A . n A 1 16 VAL 16 -3 ? ? ? A . n A 1 17 LEU 17 -2 ? ? ? A . n A 1 18 PHE 18 -1 ? ? ? A . n A 1 19 GLN 19 0 ? ? ? A . n A 1 20 GLY 20 1 1 GLY GLY A . n A 1 21 PRO 21 2 2 PRO PRO A . n A 1 22 GLY 22 3 3 GLY GLY A . n A 1 23 GLY 23 4 4 GLY GLY A . n A 1 24 THR 24 5 5 THR THR A . n A 1 25 SER 25 6 6 SER SER A . n A 1 26 VAL 26 7 7 VAL VAL A . n A 1 27 GLU 27 8 8 GLU GLU A . n A 1 28 GLU 28 9 9 GLU GLU A . n A 1 29 LEU 29 10 10 LEU LEU A . n A 1 30 LEU 30 11 11 LEU LEU A . n A 1 31 GLU 31 12 12 GLU GLU A . n A 1 32 GLU 32 13 13 GLU GLU A . n A 1 33 LEU 33 14 14 LEU LEU A . n A 1 34 ARG 34 15 15 ARG ARG A . n A 1 35 LYS 35 16 16 LYS LYS A . n A 1 36 LEU 36 17 17 LEU LEU A . n A 1 37 ASP 37 18 18 ASP ASP A . n A 1 38 PRO 38 19 19 PRO PRO A . n A 1 39 ARG 39 20 20 ARG ARG A . n A 1 40 VAL 40 21 21 VAL VAL A . n A 1 41 GLU 41 22 22 GLU GLU A . n A 1 42 GLU 42 23 23 GLU GLU A . n A 1 43 LEU 43 24 24 LEU LEU A . n A 1 44 VAL 44 25 25 VAL VAL A . n A 1 45 ARG 45 26 26 ARG ARG A . n A 1 46 GLU 46 27 27 GLU GLU A . n A 1 47 LEU 47 28 28 LEU LEU A . n A 1 48 VAL 48 29 29 VAL VAL A . n A 1 49 ARG 49 30 30 ARG ARG A . n A 1 50 LYS 50 31 31 LYS LYS A . n A 1 51 LEU 51 32 32 LEU LEU A . n A 1 52 ARG 52 33 33 ARG ARG A . n A 1 53 GLU 53 34 34 GLU GLU A . n A 1 54 GLU 54 35 35 GLU GLU A . n A 1 55 GLY 55 36 36 GLY GLY A . n A 1 56 ASP 56 37 37 ASP ASP A . n A 1 57 PRO 57 38 38 PRO PRO A . n A 1 58 ASP 58 39 39 ASP ASP A . n A 1 59 LYS 59 40 40 LYS LYS A . n A 1 60 ALA 60 41 41 ALA ALA A . n A 1 61 ARG 61 42 42 ARG ARG A . n A 1 62 PHE 62 43 43 PHE PHE A . n A 1 63 VAL 63 44 44 VAL VAL A . n A 1 64 ALA 64 45 45 ALA ALA A . n A 1 65 ASP 65 46 46 ASP ASP A . n A 1 66 ASP 66 47 47 ASP ASP A . n A 1 67 ALA 67 48 48 ALA ALA A . n A 1 68 LEU 68 49 49 LEU LEU A . n A 1 69 HIS 69 50 50 HIS HIS A . n A 1 70 LEU 70 51 51 LEU LEU A . n A 1 71 LEU 71 52 52 LEU LEU A . n A 1 72 ARG 72 53 53 ARG ARG A . n A 1 73 GLN 73 54 54 GLN GLN A . n A 1 74 GLY 74 55 55 GLY GLY A . n A 1 75 VAL 75 56 56 VAL VAL A . n A 1 76 SER 76 57 57 SER SER A . n A 1 77 PRO 77 58 58 PRO PRO A . n A 1 78 GLU 78 59 59 GLU GLU A . n A 1 79 GLU 79 60 60 GLU GLU A . n A 1 80 ILE 80 61 61 ILE ILE A . n A 1 81 GLU 81 62 62 GLU GLU A . n A 1 82 ARG 82 63 63 ARG ARG A . n A 1 83 HIS 83 64 64 HIS HIS A . n A 1 84 LEU 84 65 65 LEU LEU A . n A 1 85 ARG 85 66 66 ARG ARG A . n A 1 86 GLU 86 67 67 GLU GLU A . n A 1 87 LEU 87 68 68 LEU LEU A . n A 1 88 LEU 88 69 69 LEU LEU A . n A 1 89 LYS 89 70 70 LYS LYS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 106 ZN ZN A . C 2 ZN 1 102 107 ZN ZN A . D 3 HOH 1 201 1 HOH HOH A . D 3 HOH 2 202 34 HOH HOH A . D 3 HOH 3 203 55 HOH HOH A . D 3 HOH 4 204 47 HOH HOH A . D 3 HOH 5 205 8 HOH HOH A . D 3 HOH 6 206 49 HOH HOH A . D 3 HOH 7 207 40 HOH HOH A . D 3 HOH 8 208 43 HOH HOH A . D 3 HOH 9 209 52 HOH HOH A . D 3 HOH 10 210 56 HOH HOH A . D 3 HOH 11 211 9 HOH HOH A . D 3 HOH 12 212 2 HOH HOH A . D 3 HOH 13 213 6 HOH HOH A . D 3 HOH 14 214 14 HOH HOH A . D 3 HOH 15 215 26 HOH HOH A . D 3 HOH 16 216 39 HOH HOH A . D 3 HOH 17 217 32 HOH HOH A . D 3 HOH 18 218 27 HOH HOH A . D 3 HOH 19 219 54 HOH HOH A . D 3 HOH 20 220 12 HOH HOH A . D 3 HOH 21 221 62 HOH HOH A . D 3 HOH 22 222 19 HOH HOH A . D 3 HOH 23 223 64 HOH HOH A . D 3 HOH 24 224 44 HOH HOH A . D 3 HOH 25 225 60 HOH HOH A . D 3 HOH 26 226 4 HOH HOH A . D 3 HOH 27 227 23 HOH HOH A . D 3 HOH 28 228 3 HOH HOH A . D 3 HOH 29 229 17 HOH HOH A . D 3 HOH 30 230 10 HOH HOH A . D 3 HOH 31 231 24 HOH HOH A . D 3 HOH 32 232 18 HOH HOH A . D 3 HOH 33 233 42 HOH HOH A . D 3 HOH 34 234 13 HOH HOH A . D 3 HOH 35 235 15 HOH HOH A . D 3 HOH 36 236 5 HOH HOH A . D 3 HOH 37 237 37 HOH HOH A . D 3 HOH 38 238 22 HOH HOH A . D 3 HOH 39 239 25 HOH HOH A . D 3 HOH 40 240 30 HOH HOH A . D 3 HOH 41 241 20 HOH HOH A . D 3 HOH 42 242 38 HOH HOH A . D 3 HOH 43 243 29 HOH HOH A . D 3 HOH 44 244 50 HOH HOH A . D 3 HOH 45 245 45 HOH HOH A . D 3 HOH 46 246 21 HOH HOH A . D 3 HOH 47 247 28 HOH HOH A . D 3 HOH 48 248 7 HOH HOH A . D 3 HOH 49 249 16 HOH HOH A . D 3 HOH 50 250 11 HOH HOH A . D 3 HOH 51 251 59 HOH HOH A . D 3 HOH 52 252 41 HOH HOH A . D 3 HOH 53 253 51 HOH HOH A . D 3 HOH 54 254 63 HOH HOH A . D 3 HOH 55 255 35 HOH HOH A . D 3 HOH 56 256 61 HOH HOH A . D 3 HOH 57 257 46 HOH HOH A . D 3 HOH 58 258 57 HOH HOH A . D 3 HOH 59 259 48 HOH HOH A . D 3 HOH 60 260 33 HOH HOH A . D 3 HOH 61 261 58 HOH HOH A . D 3 HOH 62 262 36 HOH HOH A . D 3 HOH 63 263 53 HOH HOH A . D 3 HOH 64 264 31 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9K5H _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.611 _cell.length_a_esd ? _cell.length_b 47.611 _cell.length_b_esd ? _cell.length_c 54.164 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9K5H _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9K5H _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES pH 7, 30% v/v Jeff ED-2001' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU HyPix-6000HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-05-25 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'Cu FINE FOCUS' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9K5H _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.8 _reflns.d_resolution_low 23.81 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6169 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.84 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 45.40 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.03474 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.864 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 597 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.227 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9K5H _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 23.81 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6167 _refine.ls_number_reflns_R_free 617 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.89 _refine.ls_percent_reflns_R_free 10.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1921 _refine.ls_R_factor_R_free 0.2402 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1869 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model RoseTTAFold _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.54 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.17 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 23.81 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 635 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 569 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? ? ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.875 ? ? ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 4.414 ? ? ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? ? ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 ? ? ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.80 1.98 . . 149 1342 100.00 . . . . 0.1804 . . . . . . . . . . . 0.2239 'X-RAY DIFFRACTION' 1.98 2.27 . . 151 1362 100.00 . . . . 0.1805 . . . . . . . . . . . 0.2471 'X-RAY DIFFRACTION' 2.27 2.86 . . 153 1376 100.00 . . . . 0.1955 . . . . . . . . . . . 0.2575 'X-RAY DIFFRACTION' 2.86 23.81 . . 164 1470 100.00 . . . . 0.1863 . . . . . . . . . . . 0.2339 # _struct.entry_id 9K5H _struct.title 'Crystal structure of designed zinc-induced homodimer C2-Zn2-HEHE-2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9K5H _struct_keywords.text 'Dimer, Zinc-binding protein, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9K5H _struct_ref.pdbx_db_accession 9K5H _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9K5H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9K5H _struct_ref_seq.db_align_beg -18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -18 _struct_ref_seq.pdbx_auth_seq_align_end 70 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2320 ? 1 MORE -149 ? 1 'SSA (A^2)' 7350 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'equilibrium centrifugation' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -x,-y-1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -47.6110000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 25 ? ASP A 37 ? SER A 6 ASP A 18 1 ? 13 HELX_P HELX_P2 AA2 ASP A 37 ? GLU A 54 ? ASP A 18 GLU A 35 1 ? 18 HELX_P HELX_P3 AA3 ASP A 56 ? GLN A 73 ? ASP A 37 GLN A 54 1 ? 18 HELX_P HELX_P4 AA4 SER A 76 ? LYS A 89 ? SER A 57 LYS A 70 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLY 20 N ? ? ? 1_555 C ZN . ZN ? ? A GLY 1 A ZN 102 1_555 ? ? ? ? ? ? ? 2.151 ? ? metalc2 metalc ? ? A GLY 20 O ? ? ? 1_555 C ZN . ZN ? ? A GLY 1 A ZN 102 1_555 ? ? ? ? ? ? ? 2.066 ? ? metalc3 metalc ? ? A ASP 65 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 46 A ZN 101 1_555 ? ? ? ? ? ? ? 1.930 ? ? metalc4 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 47 A ZN 101 2_545 ? ? ? ? ? ? ? 2.664 ? ? metalc5 metalc ? ? A ASP 66 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 47 A ZN 101 2_545 ? ? ? ? ? ? ? 1.994 ? ? metalc6 metalc ? ? A HIS 69 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 50 A ZN 101 1_555 ? ? ? ? ? ? ? 1.970 ? ? metalc7 metalc ? ? A HIS 83 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 64 A ZN 101 2_545 ? ? ? ? ? ? ? 1.977 ? ? metalc8 metalc ? ? A LYS 89 O ? ? ? 1_555 C ZN . ZN ? ? A LYS 70 A ZN 102 2_545 ? ? ? ? ? ? ? 2.262 ? ? metalc9 metalc ? ? A LYS 89 OXT ? ? ? 1_555 C ZN . ZN ? ? A LYS 70 A ZN 102 2_545 ? ? ? ? ? ? ? 2.255 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N ? A GLY 20 ? A GLY 1 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 O ? A GLY 20 ? A GLY 1 ? 1_555 85.7 ? 2 N ? A GLY 20 ? A GLY 1 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 O ? A LYS 89 ? A LYS 70 ? 1_555 101.4 ? 3 O ? A GLY 20 ? A GLY 1 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 O ? A LYS 89 ? A LYS 70 ? 1_555 142.4 ? 4 N ? A GLY 20 ? A GLY 1 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OXT ? A LYS 89 ? A LYS 70 ? 1_555 105.0 ? 5 O ? A GLY 20 ? A GLY 1 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OXT ? A LYS 89 ? A LYS 70 ? 1_555 145.5 ? 6 O ? A LYS 89 ? A LYS 70 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 OXT ? A LYS 89 ? A LYS 70 ? 1_555 5.3 ? 7 OD2 ? A ASP 65 ? A ASP 46 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OD1 ? A ASP 66 ? A ASP 47 ? 1_555 67.8 ? 8 OD2 ? A ASP 65 ? A ASP 46 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OD2 ? A ASP 66 ? A ASP 47 ? 1_555 63.0 ? 9 OD1 ? A ASP 66 ? A ASP 47 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 OD2 ? A ASP 66 ? A ASP 47 ? 1_555 5.8 ? 10 OD2 ? A ASP 65 ? A ASP 46 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 69 ? A HIS 50 ? 1_555 107.0 ? 11 OD1 ? A ASP 66 ? A ASP 47 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 69 ? A HIS 50 ? 1_555 76.6 ? 12 OD2 ? A ASP 66 ? A ASP 47 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 69 ? A HIS 50 ? 1_555 75.8 ? 13 OD2 ? A ASP 65 ? A ASP 46 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 83 ? A HIS 64 ? 1_555 73.9 ? 14 OD1 ? A ASP 66 ? A ASP 47 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 83 ? A HIS 64 ? 1_555 6.1 ? 15 OD2 ? A ASP 66 ? A ASP 47 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 83 ? A HIS 64 ? 1_555 11.3 ? 16 NE2 ? A HIS 69 ? A HIS 50 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 83 ? A HIS 64 ? 1_555 73.8 ? # _pdbx_entry_details.entry_id 9K5H _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 18 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -165.98 _pdbx_validate_torsion.psi 102.23 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 201 ? D HOH . 2 1 A HOH 209 ? D HOH . 3 1 A HOH 212 ? D HOH . 4 1 A HOH 260 ? D HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -18 ? A MET 1 2 1 Y 1 A GLY -17 ? A GLY 2 3 1 Y 1 A SER -16 ? A SER 3 4 1 Y 1 A SER -15 ? A SER 4 5 1 Y 1 A HIS -14 ? A HIS 5 6 1 Y 1 A HIS -13 ? A HIS 6 7 1 Y 1 A HIS -12 ? A HIS 7 8 1 Y 1 A HIS -11 ? A HIS 8 9 1 Y 1 A HIS -10 ? A HIS 9 10 1 Y 1 A HIS -9 ? A HIS 10 11 1 Y 1 A SER -8 ? A SER 11 12 1 Y 1 A SER -7 ? A SER 12 13 1 Y 1 A GLY -6 ? A GLY 13 14 1 Y 1 A LEU -5 ? A LEU 14 15 1 Y 1 A GLU -4 ? A GLU 15 16 1 Y 1 A VAL -3 ? A VAL 16 17 1 Y 1 A LEU -2 ? A LEU 17 18 1 Y 1 A PHE -1 ? A PHE 18 19 1 Y 1 A GLN 0 ? A GLN 19 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 HOH O O N N 127 HOH H1 H N N 128 HOH H2 H N N 129 ILE N N N N 130 ILE CA C N S 131 ILE C C N N 132 ILE O O N N 133 ILE CB C N S 134 ILE CG1 C N N 135 ILE CG2 C N N 136 ILE CD1 C N N 137 ILE OXT O N N 138 ILE H H N N 139 ILE H2 H N N 140 ILE HA H N N 141 ILE HB H N N 142 ILE HG12 H N N 143 ILE HG13 H N N 144 ILE HG21 H N N 145 ILE HG22 H N N 146 ILE HG23 H N N 147 ILE HD11 H N N 148 ILE HD12 H N N 149 ILE HD13 H N N 150 ILE HXT H N N 151 LEU N N N N 152 LEU CA C N S 153 LEU C C N N 154 LEU O O N N 155 LEU CB C N N 156 LEU CG C N N 157 LEU CD1 C N N 158 LEU CD2 C N N 159 LEU OXT O N N 160 LEU H H N N 161 LEU H2 H N N 162 LEU HA H N N 163 LEU HB2 H N N 164 LEU HB3 H N N 165 LEU HG H N N 166 LEU HD11 H N N 167 LEU HD12 H N N 168 LEU HD13 H N N 169 LEU HD21 H N N 170 LEU HD22 H N N 171 LEU HD23 H N N 172 LEU HXT H N N 173 LYS N N N N 174 LYS CA C N S 175 LYS C C N N 176 LYS O O N N 177 LYS CB C N N 178 LYS CG C N N 179 LYS CD C N N 180 LYS CE C N N 181 LYS NZ N N N 182 LYS OXT O N N 183 LYS H H N N 184 LYS H2 H N N 185 LYS HA H N N 186 LYS HB2 H N N 187 LYS HB3 H N N 188 LYS HG2 H N N 189 LYS HG3 H N N 190 LYS HD2 H N N 191 LYS HD3 H N N 192 LYS HE2 H N N 193 LYS HE3 H N N 194 LYS HZ1 H N N 195 LYS HZ2 H N N 196 LYS HZ3 H N N 197 LYS HXT H N N 198 MET N N N N 199 MET CA C N S 200 MET C C N N 201 MET O O N N 202 MET CB C N N 203 MET CG C N N 204 MET SD S N N 205 MET CE C N N 206 MET OXT O N N 207 MET H H N N 208 MET H2 H N N 209 MET HA H N N 210 MET HB2 H N N 211 MET HB3 H N N 212 MET HG2 H N N 213 MET HG3 H N N 214 MET HE1 H N N 215 MET HE2 H N N 216 MET HE3 H N N 217 MET HXT H N N 218 PHE N N N N 219 PHE CA C N S 220 PHE C C N N 221 PHE O O N N 222 PHE CB C N N 223 PHE CG C Y N 224 PHE CD1 C Y N 225 PHE CD2 C Y N 226 PHE CE1 C Y N 227 PHE CE2 C Y N 228 PHE CZ C Y N 229 PHE OXT O N N 230 PHE H H N N 231 PHE H2 H N N 232 PHE HA H N N 233 PHE HB2 H N N 234 PHE HB3 H N N 235 PHE HD1 H N N 236 PHE HD2 H N N 237 PHE HE1 H N N 238 PHE HE2 H N N 239 PHE HZ H N N 240 PHE HXT H N N 241 PRO N N N N 242 PRO CA C N S 243 PRO C C N N 244 PRO O O N N 245 PRO CB C N N 246 PRO CG C N N 247 PRO CD C N N 248 PRO OXT O N N 249 PRO H H N N 250 PRO HA H N N 251 PRO HB2 H N N 252 PRO HB3 H N N 253 PRO HG2 H N N 254 PRO HG3 H N N 255 PRO HD2 H N N 256 PRO HD3 H N N 257 PRO HXT H N N 258 SER N N N N 259 SER CA C N S 260 SER C C N N 261 SER O O N N 262 SER CB C N N 263 SER OG O N N 264 SER OXT O N N 265 SER H H N N 266 SER H2 H N N 267 SER HA H N N 268 SER HB2 H N N 269 SER HB3 H N N 270 SER HG H N N 271 SER HXT H N N 272 THR N N N N 273 THR CA C N S 274 THR C C N N 275 THR O O N N 276 THR CB C N R 277 THR OG1 O N N 278 THR CG2 C N N 279 THR OXT O N N 280 THR H H N N 281 THR H2 H N N 282 THR HA H N N 283 THR HB H N N 284 THR HG1 H N N 285 THR HG21 H N N 286 THR HG22 H N N 287 THR HG23 H N N 288 THR HXT H N N 289 VAL N N N N 290 VAL CA C N S 291 VAL C C N N 292 VAL O O N N 293 VAL CB C N N 294 VAL CG1 C N N 295 VAL CG2 C N N 296 VAL OXT O N N 297 VAL H H N N 298 VAL H2 H N N 299 VAL HA H N N 300 VAL HB H N N 301 VAL HG11 H N N 302 VAL HG12 H N N 303 VAL HG13 H N N 304 VAL HG21 H N N 305 VAL HG22 H N N 306 VAL HG23 H N N 307 VAL HXT H N N 308 ZN ZN ZN N N 309 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 HOH O H1 sing N N 121 HOH O H2 sing N N 122 ILE N CA sing N N 123 ILE N H sing N N 124 ILE N H2 sing N N 125 ILE CA C sing N N 126 ILE CA CB sing N N 127 ILE CA HA sing N N 128 ILE C O doub N N 129 ILE C OXT sing N N 130 ILE CB CG1 sing N N 131 ILE CB CG2 sing N N 132 ILE CB HB sing N N 133 ILE CG1 CD1 sing N N 134 ILE CG1 HG12 sing N N 135 ILE CG1 HG13 sing N N 136 ILE CG2 HG21 sing N N 137 ILE CG2 HG22 sing N N 138 ILE CG2 HG23 sing N N 139 ILE CD1 HD11 sing N N 140 ILE CD1 HD12 sing N N 141 ILE CD1 HD13 sing N N 142 ILE OXT HXT sing N N 143 LEU N CA sing N N 144 LEU N H sing N N 145 LEU N H2 sing N N 146 LEU CA C sing N N 147 LEU CA CB sing N N 148 LEU CA HA sing N N 149 LEU C O doub N N 150 LEU C OXT sing N N 151 LEU CB CG sing N N 152 LEU CB HB2 sing N N 153 LEU CB HB3 sing N N 154 LEU CG CD1 sing N N 155 LEU CG CD2 sing N N 156 LEU CG HG sing N N 157 LEU CD1 HD11 sing N N 158 LEU CD1 HD12 sing N N 159 LEU CD1 HD13 sing N N 160 LEU CD2 HD21 sing N N 161 LEU CD2 HD22 sing N N 162 LEU CD2 HD23 sing N N 163 LEU OXT HXT sing N N 164 LYS N CA sing N N 165 LYS N H sing N N 166 LYS N H2 sing N N 167 LYS CA C sing N N 168 LYS CA CB sing N N 169 LYS CA HA sing N N 170 LYS C O doub N N 171 LYS C OXT sing N N 172 LYS CB CG sing N N 173 LYS CB HB2 sing N N 174 LYS CB HB3 sing N N 175 LYS CG CD sing N N 176 LYS CG HG2 sing N N 177 LYS CG HG3 sing N N 178 LYS CD CE sing N N 179 LYS CD HD2 sing N N 180 LYS CD HD3 sing N N 181 LYS CE NZ sing N N 182 LYS CE HE2 sing N N 183 LYS CE HE3 sing N N 184 LYS NZ HZ1 sing N N 185 LYS NZ HZ2 sing N N 186 LYS NZ HZ3 sing N N 187 LYS OXT HXT sing N N 188 MET N CA sing N N 189 MET N H sing N N 190 MET N H2 sing N N 191 MET CA C sing N N 192 MET CA CB sing N N 193 MET CA HA sing N N 194 MET C O doub N N 195 MET C OXT sing N N 196 MET CB CG sing N N 197 MET CB HB2 sing N N 198 MET CB HB3 sing N N 199 MET CG SD sing N N 200 MET CG HG2 sing N N 201 MET CG HG3 sing N N 202 MET SD CE sing N N 203 MET CE HE1 sing N N 204 MET CE HE2 sing N N 205 MET CE HE3 sing N N 206 MET OXT HXT sing N N 207 PHE N CA sing N N 208 PHE N H sing N N 209 PHE N H2 sing N N 210 PHE CA C sing N N 211 PHE CA CB sing N N 212 PHE CA HA sing N N 213 PHE C O doub N N 214 PHE C OXT sing N N 215 PHE CB CG sing N N 216 PHE CB HB2 sing N N 217 PHE CB HB3 sing N N 218 PHE CG CD1 doub Y N 219 PHE CG CD2 sing Y N 220 PHE CD1 CE1 sing Y N 221 PHE CD1 HD1 sing N N 222 PHE CD2 CE2 doub Y N 223 PHE CD2 HD2 sing N N 224 PHE CE1 CZ doub Y N 225 PHE CE1 HE1 sing N N 226 PHE CE2 CZ sing Y N 227 PHE CE2 HE2 sing N N 228 PHE CZ HZ sing N N 229 PHE OXT HXT sing N N 230 PRO N CA sing N N 231 PRO N CD sing N N 232 PRO N H sing N N 233 PRO CA C sing N N 234 PRO CA CB sing N N 235 PRO CA HA sing N N 236 PRO C O doub N N 237 PRO C OXT sing N N 238 PRO CB CG sing N N 239 PRO CB HB2 sing N N 240 PRO CB HB3 sing N N 241 PRO CG CD sing N N 242 PRO CG HG2 sing N N 243 PRO CG HG3 sing N N 244 PRO CD HD2 sing N N 245 PRO CD HD3 sing N N 246 PRO OXT HXT sing N N 247 SER N CA sing N N 248 SER N H sing N N 249 SER N H2 sing N N 250 SER CA C sing N N 251 SER CA CB sing N N 252 SER CA HA sing N N 253 SER C O doub N N 254 SER C OXT sing N N 255 SER CB OG sing N N 256 SER CB HB2 sing N N 257 SER CB HB3 sing N N 258 SER OG HG sing N N 259 SER OXT HXT sing N N 260 THR N CA sing N N 261 THR N H sing N N 262 THR N H2 sing N N 263 THR CA C sing N N 264 THR CA CB sing N N 265 THR CA HA sing N N 266 THR C O doub N N 267 THR C OXT sing N N 268 THR CB OG1 sing N N 269 THR CB CG2 sing N N 270 THR CB HB sing N N 271 THR OG1 HG1 sing N N 272 THR CG2 HG21 sing N N 273 THR CG2 HG22 sing N N 274 THR CG2 HG23 sing N N 275 THR OXT HXT sing N N 276 VAL N CA sing N N 277 VAL N H sing N N 278 VAL N H2 sing N N 279 VAL CA C sing N N 280 VAL CA CB sing N N 281 VAL CA HA sing N N 282 VAL C O doub N N 283 VAL C OXT sing N N 284 VAL CB CG1 sing N N 285 VAL CB CG2 sing N N 286 VAL CB HB sing N N 287 VAL CG1 HG11 sing N N 288 VAL CG1 HG12 sing N N 289 VAL CG1 HG13 sing N N 290 VAL CG2 HG21 sing N N 291 VAL CG2 HG22 sing N N 292 VAL CG2 HG23 sing N N 293 VAL OXT HXT sing N N 294 # _pdbx_audit_support.funding_organization 'Ministry of Science and Technology (MoST, China)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name RoseTTAFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9K5H _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.021004 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021004 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018462 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O ZN # loop_ #